Click here to load reader

Sponge-Stick - 3M · Sponge-Stick Eponge Sponge-Stick Sponge-Stick Spugna con supporto in plastica Sponge-Stick Sponge-Stick ... contaminées pour les boissons ou la nourriture,

  • View
    236

  • Download
    0

Embed Size (px)

Text of Sponge-Stick - 3M · Sponge-Stick Eponge Sponge-Stick Sponge-Stick Spugna con supporto in plastica...

  • Product InstructionsSSL100 / SSL10BPW / SSL10NB / SSL10NB2G / SSL10NBDBL / SSL10NB6X9 / SSL10LET / SSL10LET2G / SSL10DE

    3

    Sponge-StickEponge Sponge-StickSponge-StickSpugna con supporto in plasticaSponge-StickSponge-StickSponge-StickSponge-StickSponge-Stick fuktet svaberSponge-Stick SienitikkuSponge-Stick Sztyft z gbkSponge-Stick szivacsos mintavteli plcaTyinka s houbikouBurete de recoltare Sponge-Stick

    -

    FR

    DE

    IT

    ES

    NL

    SV

    DA

    NO

    FI

    PT

    EL

    PL

    HU

    CS

    RO

    RU

    JA

    ZH

    TH

    KO

  • (English)

    1

    PRODUCT DESCRIPTIONDry or Pre-hydrated and biocide-free 3.8 x 7.6 cm (1.5 x 3 in.) sponge in sample bag. Pre-hydrated with specified agent. Various bag sizes. With or without gloves.

    For Laboratory Use Only. Material Safety Data Sheet available.

    SAFETYThe user should read, understand, and follow all safety information in the instructions. Retain the safety instructions for future reference.

    WARNING Indicates a hazardous situation, which, if not avoided, could result in death or serious injury and/or property damage.

    NOTICE Indicates a potentially hazardous situation which, if not avoided, could result in property damage.

    W WARNING

    To reduce the risks associated with environmental contamination: Followcurrentindustrystandardsandlocalregulationsfordisposalofcontaminatedwaste.

    To reduce the risks associated with exposure to biohazards: Disposeofsamplesaccordingtoallapplicablegovernmentregulationsandapplicablelaboratoryprocedures.

    To reduce the risk associated with false negatives resulting in the use of contaminated carcass or environmental surfaces for food or beverage products: Alwaysreferencepackagelabelforstorageinstructionandexpirationdate. Alwaysreferenceproductinstructionforusage.

    To reduce the risks associated with exposure to chemicals and biohazards: Alwaysfollowstandardgoodlaboratorysafetypractices(GLP1 or ISO 170252), including proper containment procedures, wearing appropriate

    protective apparel while handling testing materials and test samples.

    NOTICE

    To reduce the risk of false-positive results due to cross contaminated carcass or environmental surfaces for food or beverage products that may result in re-testing or the rejection of food or beverage product: Donottouchthespongeorspongesticktoanyunintendedsurface. Donotbreakthespongefromthespongestickwhilesampling. Donotreachintothespongebag.

    To reduce the risk of cross contamination from reuse of sample handling device: Donotusethesamespongestickmorethanonce.

    USER RESPONSIBILITYUsers are responsible for familiarizing themselves with product instructions and information. Visit our website at www.3M.com/foodsafety, or contact your local 3M representative or distributor for more information.

    When selecting a test method, it is important to recognize that external factors such as sampling methods, testing protocols, sample preparation, handling, and laboratory technique may influence results.

    It is the users responsibility in selecting any test method or product to evaluate a sufficient number of samples with the appropriate matrices and microbial challenges to satisfy the user that the chosen test method meets the users criteria.

    It is also the users responsibility to determine that any test methods and results meet its customers and suppliers requirements.

    Aswithanytestmethod,resultsobtainedfromuseofany3MFoodSafetyproductdonotconstituteaguaranteeofthequalityofthematricesorprocesses tested.

    LIMITATION OF WARRANTIES / LIMITED REMEDYEXCEPTASEXPRESSLYSTATEDINALIMITEDWARRANTYSECTIONOFINDIVIDUALPRODUCTPACKAGING,3MDISCLAIMSALLEXPRESSANDIMPLIEDWARRANTIES,INCLUDINGBUTNOTLIMITEDTO,ANYWARRANTIESOFMERCHANTABILITYORFITNESSFORAPARTICULARUSE.Ifany3MFoodSafetyProduct is defective, 3M or its authorized distributor will, at its option, replace or refund the purchase price of the product. These are your exclusive remedies.Youmustpromptlynotify3Mwithinsixtydaysofdiscoveryofanysuspecteddefectsinaproductandreturnitto3M.PleasecallCustomerService(1-800-328-1671intheU.S.)oryourofficial3MFoodSafetyrepresentativeforaReturnedGoodsAuthorization.

    Issue Date: 2013-03

    Sponge-Stick

    3Product Instructions

  • (English)

    2

    LIMITATION OF 3M LIABILITY3MWILLNOTBELIABLEFORANYLOSSORDAMAGES,WHETHERDIRECT,INDIRECT,SPECIAL,INCIDENTALORCONSEQUENTIALDAMAGES,INCLUDINGBUTNOTLIMITEDTOLOSTPROFITS.Innoeventshall3Msliabilityunderanylegaltheoryexceedthepurchasepriceoftheproductalleged to be defective.

    STORAGE AND DISPOSALStorage:Refertopackagelabelforstorageinformation.

    Disposal: Follow current industry standards and local regulations for disposal of contaminated waste. Consult the Material Safety Data Sheet for additional information.

    Product Description Volume REF Volume of Bag Gloves

    3MSponge-Stick 0 mL SSL100 0.89 L (30 oz.) 0

    3MSponge-StickwithBufferedPeptoneWaterBroth 10 mL SSL10BPW 0.89 L (30 oz.) 0

    3MSponge-StickwithLetheenBroth 10 mL SSL10LET 0.89 L (30 oz.) 0

    3MSponge-StickwithLetheenBroth,2Gloves 10 mL SSL10LET2G 0.89 L (30 oz.) 2

    3MSponge-StickwithNeutralizingBuffer 10 mL SSL10NB 0.89 L (30 oz.) 0

    3MSponge-StickwithNeutralizingBuffer,2Gloves 10 mL SSL10NB2G 0.89 L (30 oz.) 2

    3MSponge-StickwithNeutralizingBuffer 10 mL SSL10NB6X9 6 x 9 bag 0

    3MSponge-StickwithD/EBroth 10 mL SSL10DE 0.89 L (30 oz.) 0

    INSTRUCTIONS FOR USE1. Shakesticktoendofbag.

    2. Tear bag open. NOTE:Addsterilediluentorbrothtodrysponge.

    3. Squeezebagtoopen.Asepticallygraspthestickabovethethumb-stoplinetoremovethesponge.

    4. Asepticallyswabacrosstheentiresamplingsurface3,4,5,6.

    5. Turnspongeover.Changedirection90.Asepticallyswabthesamesampledsurface.

    6. Asepticallyplacespongeintobaguptothethumb-stop.

    7. Holdspongeinplaceinsidebag.Bendsticktobreak.Allowspongetodropinbag.Discardstick.

    8. Fold bag to close.

    9. Fold ends of blue wires inward.

    10. Following user established procedures, remove any remaining enrichment broth or neutralizing solution residue from the sampled surface.

    REFERENCES1. U.S.FoodandDrugAdministration.CodeofFederalRegulations,Title21,Part58.GoodLaboratoryPracticeforNonclinicalLaboratoryStudies.

    2. ISO/IEC17025.Generalrequirementsforthecompetenceoftestingandcalibrationlaboratories.

    3. AmericanPublicHealthAssociation-CompendiumofMethodsfortheMicrobiologicalExaminationofFoods-Chapter3:MicrobiologicalMonitoring of the Food Processing Environment, 4th edition.

    4. USFoodandDrugAdministration-BacteriologicalAnalyticalMethod(availableonlineat http://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.html).

    5. UnitedStatesDepartmentofAgriculture-MicrobiologicalLabGuidebook-Chapters4.04,5.04,and8.07.

    6. AmericanPublicHealthAssociation-StandardMethodsfortheExaminationofDairyProducts-Chapter13:MicrobiologicalTestsforEquipment,Containers,Water,andAir,17thedition.

    Refer to the current version of the standard methods listed above.

  • (English)

    3

    EXPLANATION OF SYMBOLS

    Consult instructions for use

    The lot in a box and the hourglass symbols are symbols that represent lot number and expiration date. The hourglass is followed byayear,month,anddaywhichrepresentstheexpirationdate(year,month,andday:YYYY-MM-DD).TheentirelineaftertheLOTrepresentsthelotnumber(YYYY-MMAZ).

    Storage conditions

  • (English)

    4

    1

    5

    9

    2

    6

    3

    7

    4

    8

  • 3M Health Care2510ConwayAveSt.Paul,MN55144USAwww.3M.com/foodsafety

    2013,3M.Allrightsreserved.3Misatrademarkof3M.UsedunderlicenseinCanada.

    34-8711-5866-2

    3

    3M Food Safety3M United States3M Center

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-800-328-6553

    3M CanadaPostOfficeBox5757

    London,OntarioN6A4T1

    Canada

    1-800-563-2921

    3M Europe and MEA3MDeutschlandGmbH

    Carl-Schurz - Strasse 1

    D41453Neuss/Germany

    +49-2131-14-3000

    3M Latin America3M Center

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-954-340-8263

    3M Asia PacificNo1,YishunAvenue7

    Singapore, 768923

    65-64508869

    3M Japan3MHealthCareLimited

    33-1, Tamagawadai 2-chrome

    Setagaya-ku,Tokyo

    158-8583, Japan

    81-570-011-321

    3M AustraliaBldgA,1RivettRoad

    NorthRyde,NSW2113

    Australia

    61 1300 363 878

  • (Franais)

    1

    FR

    Description Du proDuitponge sche ou humidifie sans biocide de 3,8 x 7,6 cm (1,5 x 3 po.) dans un sac chantillons. Humidifie avec un agent spcifi. Diffrentes tailles de sac. Avec ou sans gants.

    Destin uniquement l'usage en laboratoire. Fiche signaltique de scurit du produit disponible.

    consiGnes De scuritL'utilisateur doit lire, comprendre et suivre toutes les informations de scurit mentionnes dans les instructions. Conserver ces consignes de scurit.

    Mise en GArDe Indique une situation dangereuse, qui, si elle n'est pas vite, pourrait entraner le dcs, des blessures graves et/ou des dommages matriels.

    AVis Indique une situation dangereuse, qui, si elle n'est pas vite, pourrait entraner des dommages matriels.

    W Mise en GArDeAfin de rduire les risques de pollution environnementale : Suivrelesnormesindustriellesactuellesainsiquelarglementationlocalepourletraitementdesdchetscontamins.Afin de rduire les risques d'exposition des dangers biologiques : liminerleschantillonsconformmenttouteslesrglementationsgouvernementalesetauxprocduresdelaboratoireenvigueur.Afin de rduire le risque de rsultats faux ngatifs causs par l'utilisation de surfaces de l'environnement ou de carcasses contamines pour les boissons ou les produits alimentaires : Toujourssereporterl'tiquettedel'emballagepourlesinstructionsd'entreposageetladatedepremption. Toujourssereporterauxinstructionsduproduitpourl'utilisation.Afin de rduire les risques associs l'exposition aux produits chimiques et biologiques dangereux : Toujoursrespecterlespratiquesdescuritrglementairesenlaboratoire(GLP1ouISO170252), notamment les procdures de confinement

    appropries et le port d'un quipement protecteur adquat lors de la manipulation des produits et des chantillons d'analyse.

    AVis

    Afin de rduire le risque de rsultats faux positifs causs par la contamination croise de surfaces de l'environnement ou de carcasses contamines pour les boissons ou la nourriture, pouvant entraner une nouvelle analyse ou un rejet de la boisson ou du produit alimentaire : Nepasposerl'pongeoulebtonnetdel'pongesurunesurfacenonprvueceteffet. Nepasenleverl'pongedesonbtonnetlorsduprlvement. Nepasmettrelamaindanslesacdel'ponge.

    Afin de rduire le risque de contamination croise due la rutilisation des dispositifs de transport d'chantillon : Nepasutiliserlammepongeplusdunefois.

    responsABiLit De L'utiLisAteurIl incombe aux utilisateurs de connatre les instructions et les informations relatives au produit. Rendez-vous sur notre site www.3M.com/foodsafety pour obtenir de plus amples informations ou contactez votre reprsentant ou distributeur local 3M.Lors du choix d'une mthode d'analyse, il est important de savoir que des facteurs externes comme les mthodes d'chantillonnage, les protocoles d'analyse, la prparation des chantillons, la manipulation et les techniques de laboratoire peuvent avoir un impact sur les rsultats.Il incombe l'utilisateur de slectionner une mthode ou un produit d'analyse adapt pour valuer un nombre suffisant d'chantillons avec les matrices et les souches microbiennes appropries, afin de garantir que la mthode d'analyse est conforme ses critres.Il incombe galement l'utilisateur de dterminer si les mthodes et les rsultats des tests correspondent aux exigences de ses clients et de ses fournisseurs.Commepourtoutemthoded'analyse,lesrsultatsobtenusavecunproduit3MScuritAlimentaireneconstituentpasunegarantieencequiconcerne la qualit des matrices ou des processus tests.

    LiMitAtion De GArAntie / LiMites De recoursSAUFMENTIONEXPRESSEDANSLASECTIONDEGARANTIELIMITED'UNEMBALLAGEDEPRODUITINDIVIDUEL,3MREJETTETOUTEGARANTIEEXPLICITEETIMPLICITE,YCOMPRIS,ENTREAUTRES,TOUTEGARANTIEDECOMMERCIALISATIONOUD'ADQUATIONUNEUTILISATIONPARTICULIRE.Encasdedfautsurtoutproduit3MScuritAlimentaire,3Mousondistributeuragrsengage,sonentirediscrtion,remplacerourparerleproduit,ouleremboursersonprixd'achat.Cesontllesuniquesrecours.Toutdfautsupposduproduitdevratrenotifi3Mdansundlaide60joursetleproduitdevratrerenvoy3M.VeuillezappelerleServiceclientle(1-800-328-1671auxtats-Unis)ouvotrereprsentantofficiel3MScuritAlimentairepourobteniruneautorisationderenvoi.

    Datedeparution:2013-03

    eponge sponge-stick

    3instructions relatives au produit

    http://www.3M.com/foodsafety

  • (Franais)

    2

    FRLiMitAtion De responsABiLit De 3M3MNEPOURRAENAUCUNCASTRETENURESPONSABLEDESPERTESOUDESDOMMAGESVENTUELS,QU'ILSSOIENTDIRECTS,INDIRECTS,SPCIFIQUES,ACCIDENTELSOUCONSCUTIFS,YCOMPRIS,ENTREAUTRES,LESPERTESDEBNFICES.Enaucuncasetenaucunemanire,laresponsabilit de 3M ne sera engage lgalement au-del du prix d'achat du produit prsent comme dfectueux.

    conserVAtion et trAiteMent Des DcHetsconservation : se reporter l'tiquette pour connatre les informations concernant le stockage.

    limination des dchets : suivre les normes industrielles actuelles ainsi que la rglementation locale pour le traitement des dchets contamins. Consulter la fiche de donnes de scurit pour plus d'informations.

    Description du produit Volume rF. Volume du sac Gants

    3MEpongeSponge-Stick 0ml SSL100 0,89l(30oz) 0

    3MEpongeSponge-StickavecEauPeptoneTamponne 10ml SSL10BPW 0,89l(30oz) 0

    3MSponge-StickavecbouillonLetheen 10ml SSL10LET 0,89l(30oz) 0

    3MSponge-StickavecbouillonLetheen,2gants 10ml SSL10LET2G 0,89l(30oz) 2

    3MEpongeSponge-Stickavectamponneutralisant 10ml SSL10NB 0,89l(30oz) 0

    3MEpongeSponge-Stickavectamponneutralisant,2gants 10ml SSL10NB2G 0,89l(30oz) 2

    3MEpongeSponge-Stickavectamponneutralisant 10ml SSL10NB6X9 Sacde15,24cmx22,86cm(6pox9po)

    0

    3MSponge-StickavecbouillonD/E 10ml SSL10DE 0,89l(30oz) 0

    MoDe D'eMpLoi1. Secouerlebtonnetendirectiondel'extrmitdusac.

    2. Ouvrirlesac. REMARQUE:ajouterundiluantstrileouunbouillonsurl'pongesche.

    3. Appuyersurlesacpourl'ouvrir.Saisirlebtonnetdemanireaseptiqueau-dessusdel'ongletpourenleverl'ponge.

    4. Prleverdemanireaseptiquesurtoutelasurfacedeprlvement3,4,5,6.

    5. Retournerl'ponge.Changerladirectionde90.Prleverdemanireaseptiquesurlammesurfacedel'chantillon.

    6. Demanireaseptique,placerl'pongedanslesacjusqu'l'onglet.

    7. Maintenirl'pongeenplacel'intrieurdusac.Plierlebtonnetjusqu'cequ'ilsecasse.Laissertomberl'pongedanslesac.Jeterlebtonnet.

    8. Replier le sac afin de le fermer.

    9. Plierlesextrmitsdesbandesbleuesversl'intrieur.

    10.Enrespectantlesprocdurestabliespourl'utilisateur,retirertoutrsidudesolutionneutralisanteoudebouillond'enrichissementdelasurfacechantillonne.

    rFrences1. U.S.FoodandDrugAdministration.CodeofFederalRegulations,Title21,Part58.GoodLaboratoryPracticeforNonclinicalLaboratoryStudies.

    2. ISO/IEC17025.Exigencesgnralesrelativesauxcomptencespourlesanalysesetlestalonnagesenlaboratoire.

    3. AmericanPublicHealthAssociation-CompendiumofMethodsfortheMicrobiologicalExaminationofFoods-Chapter3:MicrobiologicalMonitoringoftheFoodProcessingEnvironment,4thedition.

    4. FoodandDrugAdministration(tats-Unis)-BacteriologicalAnalyticalMethod(disponibleenligneenanglaisl'adressesuivante: http://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.html).

    5. UnitedStatesDepartmentofAgriculture-MicrobiologicalLabGuidebook-Chapters4.04,5.04et8.07.

    6. AmericanPublicHealthAssociation-StandardMethodsfortheExaminationofDairyProducts-Chapter13:MicrobiologicalTestsforEquipment,Containers,Water,andAir,17thedition.

    Sereporterauxversionsencoursdevaliditdesmthodesnormalisescitesplushaut.

    http://http://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.htm

  • (Franais)

    3

    FReXpLicAtion Des sYMBoLes

    Consulter le mode d'emploi.

    Le mot lot encadr et le sablier sont des symboles qui reprsentent le numro du lot et la date limite d'utilisation. Le sablier estsuividel'anne,dumoisetdujourcorrespondantladatelimited'utilisation(anne,moisetjour:AAAA-MM-JJ).Touslescaractres figurant aprs le sablier reprsentent le numro du lot (AAAA- MM AZ).

    Conditions de conservation

  • (Franais)

    4

    FR

    1

    5

    9

    2

    6

    3

    7

    4

    8

  • 3M Health care2510ConwayAveSt.Paul,MN55144USAwww.3M.com/foodsafety

    2013,3M.Allrightsreserved.3Misatrademarkof3M.UsedunderlicenseinCanada.

    34-8711-5866-2

    3

    3M Food safety3M united states3M Center

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-800-328-6553

    3M canadaPostOfficeBox5757

    London,OntarioN6A4T1

    Canada

    1-800-563-2921

    3M europe and MeA3MDeutschlandGmbH

    Carl-Schurz-Strasse1

    D41453Neuss/Germany

    +49-2131-14-3000

    3M Latin America3M Center

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-954-340-8263

    3M Asia pacificNo1,YishunAvenue7

    Singapore,768923

    65-64508869

    3M Japan3M Health Care Limited

    33-1,Tamagawadai2-chrome

    Setagaya-ku,Tokyo

    158-8583,Japan

    81-570-011-321

    3M AustraliaBldgA,1RivettRoad

    NorthRyde,NSW2113

    Australia

    611300363878

  • (Deutsch)

    1

    DE

    ProduktbeschreibungTrockener oder befeuchteter und biozidfreier Schwamm (3,8 x 7,6 cm) im Probenbeutel. Mit angegebenem Mittel befeuchtet. Beutel in verschiedenen Gren. Mit oder ohne Handschuhe.

    Nur fr den Laborgebrauch bestimmt. Sicherheitsdatenblatt verfgbar.

    sicherheitDer Benutzer muss alle Sicherheitshinweise der Anleitung lesen, verstehen und befolgen. Diese Sicherheitshinweise aufbewahren, um spter auf sie zurckgreifen zu knnen.

    WArnung Deutet auf eine Gefahrensituation hin, die bei Nichteinhaltung der Sicherheitsmanahmen zum Tod oder schweren Verletzungen und/oder Sachschden fhren kann.

    beAchten Deutet auf eine potentielle Gefahrensituation hin, die bei Nichteinhaltung der Sicherheitsmanahmen zu Sachschden fhren kann.

    W WArnung

    Zur Verminderung der risiken, die mit umweltverschmutzung verbunden sind: BefolgenSiedieaktuellenIndustrienormenunddielokalenVorschriftenfrdieEntsorgungkontaminierterAbflle.

    Zur Verminderung der risiken, die mit einer belastung durch chemikalien verbunden sind: DieProbeninbereinstimmungmitdengeltendenVorschriftenunddergltigenVorgehensweiseimLaborentsorgen.

    Zur Verminderung der risiken, die mit falsch negativen ergebnissen verbunden sind und zur Verwendung von kontaminierten schlachtkrpern oder kontaminierten Flchen fr Lebensmittel- und getrnkeprodukte fhren: ImmerdieAngabenaufdemVerpackungsetikettbezglichLagerungundHaltbarkeitbeachten. ImmerdieAnweisungenzurVerwendungdesProduktsbeachten.

    Zur Verminderung der risiken, die mit der belastung durch chemikalien und biogefhrdung verbunden sind: ImmerdieStandard-SicherheitsmanahmenfreineguteLaborpraxis(GLP1oderdieNormISO170252) einhalten. Dies umfasst die ordnungsgeme

    VerwendungvonSicherheitsbehlternsowiedasTragenangemessenerSchutzkleidungbeimUmgangmitTestmaterialienund-proben.

    beAchten

    Zur Verminderung der risiken, die durch falsch positive ergebnisse verursacht werden, die wiederum aufgrund von durch kreuzkontamination verschmutzten schlachtkrpern oder kontaminierten Flchen fr Lebensmittel- und getrnkeprodukte entstehen, sowie zur Verringerung von neuen tests oder der Ausmusterung von Lebensmittel- oder getrnkeprodukten, die aufgrund dieser risiken erforderlich sind: Daraufachten,dassderSchwammoderSchwammstocknichtunbeabsichtigtmitirgendeinerFlcheinKontaktkommt. DenSchwammnichtwhrendeinerProbennahmevomStockabbrechen. NichtindenSchwammbeutelgreifen.

    Zur Verminderung des risikos einer kreuzkontamination durch Wiederverwendung eines Probenbearbeitungsgerts: EinSchwammstockdarfnichtwiederverwendetwerden.

    VerAntWortung des AnWendersAnwendermssensichaufeigeneVerantwortungmitdenGebrauchsanweisungenundInformationenzumProduktvertrautmachen.FrweitereInformationenbesuchenSieunsereWebsiteunterwww.3M.com/foodsafetyoderwendenSiesichanIhrenlokalen3MVerkaufsvertreteroderHndler.

    BeiderAuswahleinerTestmethodeistzubeachten,dassexterneFaktorenwieProbennahme,Testprotokoll,Probenaufbereitung,HandhabungundLabortechnikdieErgebnissebeeinflussenknnen.

    EsliegtinderVerantwortungdesAnwenders,beiderAuswahleinerTestmethodeodereinesProdukts,diesebzw.diesesmiteinerausreichendenAnzahl von Proben mit geeigneten Matrizen und mikrobiellen Pathogenen zu evaluieren, um sicherzustellen, dass die gewhlte Testmethode den Anforderungen entspricht.

    DerAnwendertrgtebenfallsdieVerantwortungdafr,dassdieangewendetenTestmethodenundErgebnissedenAnforderungenseinerKundenundLieferanten entsprechen.

    WiebeiallenTestmethodenstellendiemit3MFoodSafetyerzieltenErgebnissekeineGarantiefrdieQualittderuntersuchtenMatrizenoderProzesse dar.

    Erscheinungsdatum:2013-03

    sponge-stick

    3Produktanweisungen

  • (Deutsch)

    2

    DEhAFtungsbeschrnkungen / beschrnkte rechtsMitteLAUSSERESWIRDAUSDRCKLICHANDERSIMABSCHNITTDERHAFTUNGSBESCHRNKUNGENDERVERPACKUNGDESJEWEILIGENPRODUKTSANGEGEBEN,LEHNT3MALLEAUSDRCKLICHENUNDSTILLSCHWEIGENDENGARANTIEN,EINSCHLIESSLICH,JEDOCHNICHTBESCHRNKTAUFDIEGEWHRLEISTUNGDERMARKTGNGIGKEITODERDEREIGNUNGFREINENBESTIMMTENZWECKAB.SolltesicheinProduktvon3MFoodSafetyalsdefektherausstellen,wirdesvon3ModereinemautorisiertenVertragshndlernacheigenemErmessenersetzt,repariertoderderKaufpreiszurckerstattet. Gewhrleistungsansprche bestehen nicht. Sie sind verpflichtet, 3M umgehend innerhalb von sechzig Tagen nachdem die mutmalichen DefekteamProduktfestgestelltwurden,diesbezglichzuinformierenunddasProduktan3Mzurckzusenden.BitterufenSiedazudenKundendienst (1-800-328-1671indenUSA)oderIhrenautorisiertenVertretervon3MFoodSafetyanundsprechenSiemitihmberdieRcksendungderWare.

    3M hAFtungsbeschrnkungen3MHAFTETNICHTFRVERLUSTEODERSCHDEN,GANZGLEICHOBMITTELBARE,UNMITTELBARE,SPEZIELLE,NEBEN-ODERFOLGESCHDEN,EINSCHLIESSLICH,ABERNICHTBESCHRNKTAUFENTGANGENENGEWINN.InkeinemFallbersteigtdieHaftungder3MdenKaufpreisdesangeblichdefekten Produkts.

    LAgerung und entsorgungLagerung:InformationenzurLagerungbittedemVerpackungsetikettentnehmen.

    entsorgung: BefolgenSiedieaktuellenIndustrienormenunddielokalenVorschriftenfrdieEntsorgungkontaminierterAbflle.WeitereInformationenfinden Sie im Sicherheitsdatenblatt.

    Produktbeschreibung Volumen bestellnr. beutelvolumen handschuhe

    3MSponge-Stick 0ml SSL100 0,89l(30oz.) 0

    3MSponge-StickmitgepuffertemPeptonwasser 10ml SSL10BPW 0,89l(30oz.) 0

    3MSponge-StickmitLetheen-Bouillon 10ml SSL10LET 0,89l(30oz.) 0

    3MSponge-StickmitLetheenBouillon,1PaarHandschuhe 10ml SSL10LET2G 0,89l(30oz.) 2

    3MSponge-StickmitNeutralisationspuffer 10ml SSL10NB 0,89l(30oz.) 0

    3MSponge-StickmitNeutralisationspuffer,1PaarHandschuhe 10ml SSL10NB2G 0,89l(30oz.) 2

    3MSponge-StickmitNeutralisationspuffer 10ml SSL10NB6X9 6x9Beutel 0

    3MSponge-StickmitD/EBouillon 10ml SSL10DE 0,89l(30oz.) 0

    gebrAuchsAnWeisung1. DurchSchttelndenStockansEndedesBeutelsbringen.

    2. Beutelaufreien. HINWEIS:SterilesVerdnnungsmittelodersterileBouillonzumtrockenenSchwammhinzufgen.

    3. Beutel zum ffnen drcken. Den Stock mittels einer aseptischen Methode oberhalb der Daumenstopplinie greifen, um den Schwamm zu entfernen.

    4. Die gesamte Probenflche mit dem Schwamm aseptisch abtupfen3,4,5,6.

    5. Schwammdrehen.Richtungum90ndern.DieselbeProbenflchemitdemSchwammaseptischabtupfen.

    6. Schwamm aseptisch in dem Beutel auf Hhe des Daumenstopps platzieren.

    7. SchwammimBeutelanOrtundStellehalten.DenStockbiegen,umihnzubrechen.DenSchwammindenBeutelfallenlassen.DenStockentsorgen.

    8. Beutel zum Schlieen falten.

    9. DieEndenderblauenDrhtenachinnenfalten.

    10.UnterBeachtungdervorgeschriebenenVerfahrenRckstndederAnreicherungsbouillonoderNeutralisierungslsungvonderProbenflcheentfernen.

    LiterAturAngAben1. U.S.FoodandDrugAdministration.CodeofFederalRegulations,Title21,Part58.GoodLaboratoryPracticeforNonclinicalLaboratoryStudies

    (BewhrteLaborpraktikenfrnicht-klinischeLaborstudien).

    2. ISO/IEC17025.Generalrequirementsforthecompetenceoftestingandcalibrationlaboratories(AllgemeineAnforderungenandieKompetenzvonPrf-undKalibrierlaboratorien).

    3. AmericanPublicHealthAssociation-CompendiumofMethodsfortheMicrobiologicalExaminationofFoods-Chapter3:MicrobiologicalMonitoringoftheFoodProcessingEnvironment,4thedition.

    4 USFoodandDrugAdministration-BacteriologicalAnalyticalMethod(siehehttp://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.html).

    5. UnitedStatesDepartmentofAgriculture-MicrobiologicalLabGuidebook-Chapters4.04,5.04,and8.07.

    6. AmericanPublicHealthAssociation-StandardMethodsfortheExaminationofDairyProducts-Chapter13:MicrobiologicalTestsforEquipment,Containers,Water,andAir,17thedition.

    Bitte beachten Sie die aktuellen Versionen der oben aufgefhrten Standardverfahren.

  • (Deutsch)

    3

    DEerkLrung der sYMboLe

    Anweisungen beachten

    DiemiteinemRahmenversehenenBuchstabenLOTunddieSanduhrsindgrafischeSymbolefrdieBegriffeChargennummerundVerwendbarbis.HinterdemSymbolSanduhrfolgtdieAngabevonJahr,MonatundTagdesjeweiligenVerfallsdatums(Jahr,MonatundTag:JJJJ-MM-TT).DieZeilenebenLOTstelltdieChargenbezeichnung(JJJJ-MMXX)dar.

    Lagerbedingungen

  • (Deutsch)

    4

    DE

    1

    5

    9

    2

    6

    3

    7

    4

    8

  • 3M health care2510ConwayAveSt.Paul,MN55144USAwww.3M.com/foodsafety

    2013,3M.Allrightsreserved.3Misatrademarkof3M.UsedunderlicenseinCanada.

    34-8711-5866-2

    3

    3M Food safety3M united states3MCenter

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-800-328-6553

    3M canadaPostOfficeBox5757

    London,OntarioN6A4T1

    Canada

    1-800-563-2921

    3M europe and MeA3M Deutschland GmbH

    Carl-Schurz-Strasse1

    D41453Neuss/Germany

    +49-2131-14-3000

    3M Latin America3MCenter

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-954-340-8263

    3M Asia PacificNo 1, Yishun Avenue 7

    Singapore,768923

    65-64508869

    3M Japan3MHealthCareLimited

    33-1,Tamagawadai2-chrome

    Setagaya-ku,Tokyo

    158-8583,Japan

    81-570-011-321

    3M AustraliaBldgA,1RivettRoad

    NorthRyde,NSW2113

    Australia

    611300363878

  • (Italiano)

    1

    IT

    Descrizione Del proDottoSpugna secca o pre-idratata e priva di biocidi 3,8 x 7,6 cm (1,5 x 3 poll.) in sacchetto campione. Pre-idratata con l'agente specificato. Sacchetti di varie dimensioni. Con o senza guanti.

    Esclusivamente per uso di laboratorio. disponibile la scheda di sicurezza del materiale.

    sicUrezzAL'utente deve leggere, comprendere e seguire tutte le informazioni per la sicurezza contenute nelle istruzioni. Conservare queste istruzioni per la sicurezza per poterle consultare in futuro.

    AVVertenzA Indica una situazione pericolosa che, se non evitata, potrebbe provocare la morte o lesioni gravi e/o danni materiali.

    AVViso Indica una situazione potenzialmente pericolosa che, se non evitata, potrebbe provocare danni materiali.

    W AVVertenzA

    per ridurre i rischi associati alla contaminazione ambientale: Seguireglistandarddisettoreelenormativelocalivigentiperlosmaltimentodirifiuticontaminati.

    per ridurre i rischi associati all'esposizione a sostanze a rischio biologico: Smaltireicampionisecondotuttelenormegovernativeeleproceduredilaboratorioapplicabili.

    per ridurre il rischio associato ai falsi negativi che comporterebbero l'uso di carcasse o superfici ambientali contaminate per alimenti o bevande: Controllaresemprel'etichettasullaconfezioneperleistruzionidiconservazioneeladatadiscadenza. Faresempreriferimentoalleistruzioniperlusodelprodotto.

    per ridurre i rischi associati all'esposizione a sostanze chimiche e a sostanze a rischio biologico: Seguiresemprelecorrettepratichedisicurezzastandarddilaboratorio(GLP1 o ISO 170252), incluse le adeguate procedure di contenimento e

    l'uso di indumenti protettivi quando si maneggiano materiali e campioni di analisi.

    AVViso

    per ridurre il rischio di risultati falsi positivi dovuti a carcasse o superfici ambientali contaminate per alimenti o bevande che possono portare a ripetere le analisi o al rifiuto dell'alimento o della bevanda: Nontoccarelaspugnanilsupportoinplasticaconqualsiasisuperficienonprevista. Nonromperelaspugnadalsupportoinplasticaduranteilcampionamento. Nonpescaredalsacchettodellaspugna.

    per ridurre il rischio di contaminazione crociata da riutilizzo del dispositivo di manipolazione dei campioni: Nonutilizzarelastessaspugnaconsupportoinplasticapidiunavolta.

    responsABilit Dell'UtenteGliutentisonotenutialeggereeapprendereleistruzionieleinformazionirelativealprodotto.VisitareilsitoWebwww.3M.com/foodsafety o contattare il distributore o il rappresentante 3M di zona per ulteriori informazioni.

    Nellasceltadiunmetododianalisi,importantetenercontodelfattochefattoriesterniqualiimetodidicampionamento,iprotocollidianalisi,lapreparazione del campione, la manipolazione e le tecniche di laboratorio possono influenzare i risultati.

    Durantelaselezionediqualsiasiprodottoometododianalisi,responsabilitdell'utentevalutareunnumerosufficientedicampioniconlematriciappropriateeconparticolaricaratteristichemicrobicheperassicurarecheilmetododianalisisceltosoddisfiicriteridellutente.

    L'utentehainoltrelaresponsabilitdiaccertarsichetuttiimetodidianalisieirisultatiottenutisoddisfinoirequisitideiclientiedeifornitori.

    Come per qualsiasi metodo di analisi, i risultati ottenuti grazie all'uso di prodotti di 3M Sicurezza alimentare non costituiscono una garanzia della qualitdellematriciodeiprocessisottopostiadanalisi.

    Data di pubblicazione: 2013-03

    spugna con supporto in plastica

    3istruzioni sul prodotto

  • (Italiano)

    2

    ITliMitAzione Di GArAnziA/riMeDio liMitAtoSALVONEICASIESPRESSAMENTEINDICATIINUNASEZIONEDIGARANZIALIMITATADELLASINGOLACONFEZIONEDELPRODOTTO,3MNONRICONOSCEALCUNAGARANZIAESPLICITAOIMPLICITA,INCLUSE,MANONAESSELIMITATE,LEEVENTUALIGARANZIEDICOMMERCIABILITODIIDONEITAUNOSCOPOPARTICOLARE.Qualoraunprodottodi3MSicurezzaalimentaresiadifettoso,3Moilsuodistributoreautorizzatoprovvederanno,alorodiscrezione,allasostituzioneoalrimborsodelprezzod'acquistodelprodotto.Questisonogliunicirimediadisposizionedelcliente.Sidovravvisareimmediatamente3Mentrosessantagiornidalriscontrodieventualidifettisospettinelprodotto,provvedendoarispedirloa3M.Chiamarel'assistenzaclienti(1-800-328-1671negliStatiUniti)orivolgersialrappresentanteautorizzatodi3MSicurezzaalimentareperottenere l'autorizzazione alla restituzione del prodotto.

    liMitAzione Di responsABilit DA pArte Di 3M3MNONSARRESPONSABILEDIPERDITEODANNI,DIRETTI,INDIRETTI,SPECIALI,INCIDENTALIOCONSEGUENTI,INCLUSA,MANONAESSALIMITATA,LAPERDITADIPROFITTO.Innessuncasolaresponsabilitlegaledi3Mandroltreilprezzod'acquistodelprodottopresuntodifettoso.

    conserVAzione e sMAltiMentoconservazione: fare riferimento all'etichetta sulla confezione per le informazioni di conservazione.

    smaltimento: seguire gli standard di settore e le normative locali vigenti per lo smaltimento di rifiuti contaminati. Per ulteriori informazioni, consultare la scheda di sicurezza dei materiali.

    Descrizione del prodotto Volume reF Volume del sacchetto Guanti

    Spugna con supporto in plastica 3M 0 ml SSL100 0,89 l (30 once) 0

    Spugna con supporto in plastica 3M con brodo di acqua peptonata tamponata

    10 ml SSL10BPW 0,89 l (30 once) 0

    Spugna con supporto in plastica 3M con brodo Letheen 10 ml SSL10LET 0,89 l (30 once) 0

    Spugna con supporto in plastica 3M con brodo Letheen e 2 guanti 10 ml SSL10LET2G 0,89 l (30 once) 2

    Spugna con supporto in plastica 3M con tampone neutralizzante 10 ml SSL10NB 0,89 l (30 once) 0

    Spugna con supporto in plastica 3M con tampone neutralizzante e 2 guanti

    10 ml SSL10NB2G 0,89 l (30 once) 2

    Spugna con supporto in plastica 3M con tampone neutralizzante 10 ml SSL10NB6X9 Sacchetto da 15,24 x 22, 86 cm (6 x 9)

    0

    Spugna con supporto in plastica 3M con brodo D/E 10 ml SSL10DE 0,89 l (30 once) 0

    istrUzioni per l'Uso1. Agitare il supporto in plastica fino alla fine del sacchetto.

    2. Aprire il sacchetto. NOTA:aggiungerediluentesterileobrodoallaspugnasecca.

    3. Comprimere il sacchetto per aprirlo. Afferrare asetticamente il supporto in plastica sopra la linea massima del pollice per rimuovere la spugna.

    4. Tamponareasetticamentelungol'interasuperficiedicampionamento3,4,5,6.

    5. Capovolgerelaspugna.Cambiareladirezionedi90.Tamponareasetticamentelastessasuperficiecampionata.

    6. Riporreasetticamentelaspugnanelsacchettofinoallalineamassimadelpollice.

    7. Tenerelaspugnaallinternodelsacchetto.Piegareilsupportoinplasticaperromperlo.Farcaderelaspugnanelsacchetto.Gettareilsupportoinplastica.

    8. Ripiegareilsacchettoperchiuderlo.

    9. Piegareleestremitdeifilibluversol'interno.

    10. Seguendo le procedure prestabilite dall'utente, rimuovere ogni residuo di brodo di arricchimento o soluzione neutralizzante dalla superficie campionata.

  • (Italiano)

    3

    ITriFeriMenti1. U.S.FoodandDrugAdministration.CodeofFederalRegulations,Title21,Part58.GoodLaboratoryPracticeforNonclinicalLaboratoryStudies.

    2. ISO/IEC17025.Requisitigeneraliperlacompetenzadeilaboratoridianalisiedicalibrazione.

    3. AmericanPublicHealthAssociation-CompendiumofMethodsfortheMicrobiologicalExaminationofFoods-Capitolo3:MicrobiologicalMonitoringoftheFoodProcessingEnvironment,4aedizione.

    4. USFoodandDrugAdministration-BacteriologicalAnalyticalMethod(disponibileonlineall'indirizzo http://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.html).

    5. UnitedStatesDepartmentofAgriculture-MicrobiologicalLabGuidebook-Capitoli4.04,5.04e8.07.

    6. AmericanPublicHealthAssociation-StandardMethodsfortheExaminationofDairyProducts-Capitolo13:MicrobiologicalTestsforEquipment,Containers,Water,andAir,17aedizione.

    Fareriferimentoallaversioneattualedeimetodistandardelencatiinprecedenza.

    leGenDA Dei siMBoli

    Consultare le istruzioni per l'uso

    Il termine lot all'interno di un riquadro e la clessidra sono simboli che rappresentano il numero di lotto e la data di scadenza. La clessidraseguitadaanno,meseegiornocherappresentanoladatadiscadenza(anno,meseegiorno:AAAA-MM-GG).L'interarigasuccessivaalLOTTOrappresentailnumerodilotto(AAAA-MMAZ).

    Condizioni di conservazione

  • (Italiano)

    4

    IT

    1

    5

    9

    2

    6

    3

    7

    4

    8

  • 3M Health care2510ConwayAveSt.Paul,MN55144USAwww.3M.com/foodsafety

    2013, 3M. All rights reserved.3Misatrademarkof3M.UsedunderlicenseinCanada.

    34-8711-5866-2

    3

    3M Food safety3M United states3M Center

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-800-328-6553

    3M canadaPostOfficeBox5757

    London,OntarioN6A4T1

    Canada

    1-800-563-2921

    3M europe and MeA3MDeutschlandGmbH

    Carl-Schurz - Strasse 1

    D41453Neuss/Germany

    +49-2131-14-3000

    3M latin America3M Center

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-954-340-8263

    3M Asia pacificNo1,YishunAvenue7

    Singapore, 768923

    65-64508869

    3M Japan3M Health Care Limited

    33-1,Tamagawadai2-chrome

    Setagaya-ku,Tokyo

    158-8583, Japan

    81-570-011-321

    3M AustraliaBldgA,1RivettRoad

    NorthRyde,NSW2113

    Australia

    61 1300 363 878

  • (Espaol)

    1

    ES

    Descripcin Del proDuctoEsponja seca o hidratada previamente y libre de biocida, de 3,8 x 7,6 cm (1,5 x 3 pulg.) en bolsa de muestreo. Hidratada previamente con agente especificado. Varios tamaos de bolsa. Con o sin guantes.

    Solo para uso de laboratorio. Est disponible la Hoja de datos sobre seguridad de materiales.

    seGuriDADEl usuario debe leer, comprender y respetar toda la informacin de seguridad que se incluye en las instrucciones. Guarde las instrucciones de seguridad para referencias futuras.

    ADVertenciA Indica una situacin peligrosa que, si no se evita, podra ocasionar la muerte o lesiones graves y/o daos a la propiedad.

    AViso Indica una situacin potencialmente peligrosa que, si no se evita, podra ocasionar daos a la propiedad.

    W ADVertenciApara reducir los riesgos relacionados con la contaminacin ambiental: Procedadeacuerdoconlanormativalocalylosestndaresdelaindustriaactualesparaeldesechodedesperdicioscontaminados.

    para reducir los riesgos relacionados con la exposicin a riesgos biolgicos: Desechelasmuestrasconformeatodaslasnormativasgubernamentalesvigentesyatodoslosprocedimientosdelaboratoriocorrespondientes.

    para reducir los riesgos relacionados con resultados falso negativos debido al uso de carcasas o superficies ambientales contaminadas para productos alimenticios o bebibles: Consultesiemprelaetiquetadeempaqueparaobtenerinstruccionesdealmacenamientoylafechadevencimiento. Consultesiemprelasinstruccionesdeusodelproducto.

    para reducir los riesgos relacionados con la exposicin a productos qumicos y riesgos biolgicos: Respetesiemprelasbuenasprcticasestndaresdeseguridaddelaboratorio(GLP1 o ISO 170252), incluidos los procedimientos de contencin

    correctos, y el uso de la ropa de proteccin adecuada durante la manipulacin de materiales y muestras de prueba.

    AVisopara reducir los riesgos de resultados falso positivos debido a carcasas o superficies ambientales para productos alimenticios o bebibles con contaminacin cruzada que puedan provocar la repeticin de pruebas o el rechazo de productos alimenticios o bebibles: Evitequelaesponjaoelasadelaesponjahagacontactoconcualquiersuperficienodeseada. Noseparelaesponjadelasadelaesponjaduranteelmuestreo. Nometalamanodentrodelabolsadelaesponja.

    para reducir los riesgos de contaminacin cruzada por la reutilizacin del dispositivo de manipulacin de muestras: Nouselamismaesponjamsdeunavez.

    responsABiliDAD Del usuArioLosusuariossonresponsablesdefamiliarizarseconlainformacinylasinstruccionesdelproducto.Visitenuestrositioweben www.3M.com/foodsafety o pngase en contacto con su representante o distribuidor local de 3M para obtener ms informacin.Al seleccionar un mtodo de prueba, es importante reconocer que factores externos tales como los mtodos de muestreo, los protocolos de prueba, la preparacin de la muestra, la manipulacin y la tcnica de laboratorio pueden afectar los resultados.

    Al seleccionar cualquier mtodo de prueba o producto, es responsabilidad del usuario evaluar un nmero suficiente de muestras con retos microbianos y matrices apropiadas para satisfacer al usuario en cuanto a que el mtodo de prueba cumple los criterios necesarios.

    Adems, es responsabilidad del usuario determinar que cualquier mtodo de prueba y sus resultados cumplen los requisitos de sus clientes y proveedores.

    Como sucede con cualquier mtodo de prueba, los resultados obtenidos del uso de cualquier producto de 3M Food Safety no constituyen una garanta decalidaddelasmatricesnidelosprocesosanalizados.

    liMitAcin De GArAntAs/recurso liMitADoSALVOLOEXPRESAMENTEESTIPULADOENUNASECCINDEGARANTALIMITADAENELEMBALAJEDEUNPRODUCTOESPECFICO,3MRENUNCIAATODASLASGARANTASEXPRESASYTCITAS,INCLUIDASENTREOTRASGARANTASDECOMERCIABILIDADOIDONEIDADPARAUNUSOENPARTICULAR.Siunproductode3MFoodSafetyesdefectuoso,3Mosudistribuidorautorizadoreemplazarelproductooreembolsarelpreciodecompradelproducto,asueleccin.Estossonsusrecursosexclusivos.Debernotificarinmediatamentea3Menunlapsodesesentadasapartirdeldescubrimientodecualquiersospechadedefectoenunproductoydevolverdichoproductoa3M.ComunqueseconelDepartamentodeAtencinalCliente(1-800-328-1671enEE.UU.)oconsurepresentanteoficialde3MFoodSafetyparaobtenerunaAutorizacindeDevolucindeProductos.

    Fecha de emisin: 2013-03

    sponge-stick

    3instrucciones del producto

  • (Espaol)

    2

    ESliMitAcin De lA responsABiliDAD De 3M3MNOSERRESPONSABLEDENINGUNAPRDIDANININGNDAO,YASEADIRECTO,INDIRECTO,ESPECIAL,ACCIDENTALORESULTANTE,INCLUIDAPEROSINLIMITARSEALAPRDIDADEBENEFICIOS.Enningncaso,laresponsabilidadde3Mconformeaningunateoralegalexceder el precio de compra del producto supuestamente defectuoso.

    AlMAcenAMiento Y DesecHoAlmacenamiento: Consulte la etiqueta de empaque para obtener informacin de almacenamiento.

    Desecho: Procedadeacuerdoconlanormativalocalylosestndaresdelaindustriaactualesparaeldesechodedesperdicioscontaminados.Consulte la Hoja de datos sobre seguridad de materiales para obtener ms informacin.

    Descripcin del producto Volumen reF Volumen de la bolsa

    Guantes

    3M Sponge-Stick 0 ml SSL100 0,89L(30oz) 0

    3MSponge-StickconAguaPeptonadaBuferada 10mL SSL10BPW 0,89L(30oz) 0

    3MSponge-StickconcaldoLetheen 10mL SSL10LET 0,89L(30oz) 0

    3MSponge-StickconcaldoLetheen,2guantes 10mL SSL10LET2G 0,89L(30oz) 2

    3MSponge-Stickcontampnneutralizante 10mL SSL10NB 0,89L(30oz) 0

    3MSponge-Stickcontampnneutralizante,2guantes 10mL SSL10NB2G 0,89L(30oz) 2

    3MSponge-Stickcontampnneutralizante 10mL SSL10NB6X9 Bolsade6x9 0

    3MSponge-StickconcaldoD/E 10mL SSL10DE 0,89L(30oz) 0

    instrucciones De uso1. Sacuda la esponja hasta el extremo de la bolsa.

    2. Rompalabolsaparaabrirla. NOTA:Agreguediluyenteestrilocaldoalaesponjaseca.

    3. Comprima la bolsa para abrir. Aspticamente, sujete el asa por encima de la lnea de alto del pulgar para retirar la esponja.

    4. Frote aspticamente la esponja por toda la superficie de muestreo3, 4, 5, 6.

    5. Dvueltalaesponja.Cambieladireccinen90.Froteaspticamentelaesponjaporlamismasuperficiedemuestreo.

    6. Aspticamente, coloque la esponja dentro de la bolsa hasta el alto del pulgar.

    7. Mantengalaesponjaenellugardentrodelabolsa.Dobleelasahastaromperla.Permitaquelaesponjacaigadentrodelabolsa.Desecheelasa.

    8. Doblelabolsaparacerrarla.

    9. Doblelosextremosdelascintasazuleshaciaadentro.

    10.Deacuerdoconlosprocedimientosestablecidosparaelusuario,quitecualquierrestodecaldodeenriquecimientooresiduodesolucinneutralizantedelasuperficiedemuestreo.

    reFerenciAs1. AdministracindeAlimentosyFrmacosdelosEstadosUnidos(FDA,FoodandDrugAdministration).CdigodeRegulacionesFederales,Ttulo21,

    Parte58.BuenasPrcticasdeLaboratorioenestudiosdelaboratorionoclnicos.

    2. ISO/IEC17025.Requisitosgeneralesparalacompetenciadeloslaboratoriosdeensayoydecalibracin.

    3. Asociacin estadounidense de salud pblica - Compendio de mtodos para el anlisis microbiolgico de alimentos - Captulo 3: Seguimiento microbiolgico del entorno alimentario, 4. edicin.

    4. Manualdeanlisisbacteriolgico(BAM)delaAdministracindeAlimentosyFrmacosdelosEstadosUnidos(disponibleenlneaen http://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.html).

    5. GuaparaLaboratoriodeMicrobiologadelDepartamentodeAgriculturadelosEstadosUnidosCaptulos4.04,5.04y8.07.

    6. Asociacin estadounidense de salud pblica - Mtodos estndares para el examen de productos lcteos - Captulo 13: Ensayos microbiolgicos para equipos, recipientes, agua y aire, 17. edicin.

    Consulte la versin actual de los mtodos estndares enumerados anteriormente.

  • (Espaol)

    3

    ESeXplicAcin De los sMBolos

    Consulte las instrucciones de uso.

    LapalabraLOTdentrodeunrecuadroyelrelojdearenasonsmbolosquerepresentanelnmerodeloteylafechadevencimiento.Elrelojdearenavaseguidodelao,elmesyelda,loscualesrepresentanlafechadevencimiento(ao,mes,da:AAAA-MM-DD).TodalainformacinaladerechadeLOTrepresentaelnmerodelote(AAAA-MMAZ).

    Condiciones de almacenamiento.

  • (Espaol)

    4

    ES

    1

    5

    9

    2

    6

    3

    7

    4

    8

  • 3M Health care2510ConwayAveSt.Paul,MN55144USAwww.3M.com/foodsafety

    2013, 3M. All rights reserved.3Misatrademarkof3M.UsedunderlicenseinCanada.

    34-8711-5866-2

    3

    3M Food safety3M united states3M Center

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-800-328-6553

    3M canadaPostOfficeBox5757

    London,OntarioN6A4T1

    Canada

    1-800-563-2921

    3M europe and MeA3MDeutschlandGmbH

    Carl-Schurz-Strasse1

    D41453Neuss/Germany

    +49-2131-14-3000

    3M latin America3M Center

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-954-340-8263

    3M Asia pacificNo1,YishunAvenue7

    Singapore, 768923

    65-64508869

    3M Japan3MHealthCareLimited

    33-1,Tamagawadai2-chrome

    Setagaya-ku,Tokyo

    158-8583,Japan

    81-570-011-321

    3M AustraliaBldgA,1RivettRoad

    NorthRyde,NSW2113

    Australia

    61 1300 363 878

  • (Nederlands)

    1

    NL

    PRODUCTBESCHRIJVINGDroge of geprehydrateerde en biocidevrije spons van 3,8 x 7,6 cm (1,5 x 3 in.) in monsterzak. Geprehydrateerd met gespecificeerd middel. Zak in verschillende afmetingen. Met of zonder handschoenen.

    Uitsluitend voor laboratoriumgebruik. Veiligheidsinformatieblad beschikbaar.

    VEILIGHEIDDe gebruiker dient alle veiligheidsinformatie in de instructies te lezen, te begrijpen en zich eraan te houden. Bewaar de veiligheidsinstructies om later te kunnen raadplegen.

    WAARSCHUWING Geeft een gevaarlijke situatie aan, die als ze niet vermeden wordt, de dood of ernstig letsel en/of materile schade tot gevolg kan hebben.

    KENNISGEVING Geeft een mogelijk gevaarlijke situatie aan die, als ze niet vermeden wordt, kan resulteren in materile schade.

    W WAARSCHUWINGOm de risico's van milieuverontreiniging te verminderen: Volgdeactuelesectornormenenlokalereglementenvoorhetafvoerenvanbesmetafvalmateriaal.Om de risico's van blootstelling aan biorisico's te verminderen: Voermonstersafovereenkomstigalletoepasselijkeoverheidsverordeningenenlaboratoriumprocedures.Om het risico op vals negatieve resultaten, resulterend in het gebruik van verontreinigde karkassen of omgevingsoppervlakken voor voedsel- en drankproducten, te verminderen: Raadpleegaltijdhetetiketopdeverpakkingvooropslaginstructiesendevervaldatum. Raadpleegaltijddeproductinstructiesvoordatuhetproductgebruikt.Om het risico op blootstelling aan biologische en chemische gevaren te voorkomen: Houdualtijdaandenormalepraktijkenvooreengoedelaboratoriumveiligheid(GLP1 of ISO 170252), waaronder passende procedures voor

    insluiting, en draag passende beschermende kleding terwijl u testmaterialen en testmonsters hanteert.

    KENNISGEVING

    Om het risico op vals positieve resultaten ten gevolge van kruisbesmetting op karkassen of omgevingsoppervlakken voor voedsel- en drankproducten, hetgeen kan leiden tot hertesten of afkeuring van het voedsel- of drankproduct, te verminderen: Zorgdatdesponsofsponge-sticknietincontactkomtmeteenoppervlakwaarvoorhetnietisbedoeld. Maakdesponsnietvandespongesticklostijdensmonstername. Steekuwhandnietindesponszak.Om het risico op kruisbesmetting als gevolg van hergebruik van het monsternameapparaat te verminderen: Gebruikdezelfdesponge-sticknietmeerdannkeer.

    VERANTWOORDELIJKHEID VAN DE GEBRUIKERGebruikerswordengeachtzichvertrouwdtemakenmetdeproductinstructiesen-informatie.Bezoekonzewebsitewww.3M.com/foodsafety of neemcontactopmetuwplaatselijke3M-vertegenwoordigerof-distributeurvoormeerinformatie.Bij het kiezen van een testmethode is het belangrijk om te erkennen dat externe factoren zoals proefmethoden, testprotocollen, monstervoorbereiding en-behandelingenlaboratoriumtechniekinvloedkunnenhebbenopderesultaten.De gebruiker is verantwoordelijk voor de selectie van een testmethode of product waarbij een voldoende aantal monsters met gepaste matrices en microbile problemen wordt onderzocht zodat de gekozen testmethode voldoet aan de criteria van de gebruiker.Hetisookdeverantwoordelijkheidvandegebruikeromtebepalenofdetestmethodenen-resultatenvoldoenaandevereistenvanklantenenleveranciers.Zoals bij elke testmethode garanderen de verkregen resultaten van het gebruik van een 3M Voedselveiligheidproduct de kwaliteit van de geteste matrices of processen niet.

    BEPERKTE GARANTIE/BEPERKT VERHAALBEHALVEWAARUITDRUKKELIJKVERMELDINEENBEPERKTEGARANTIEBEPALINGVANEENINDIVIDUELEPRODUCTVERPAKKING,WIJST3MALLEUITDRUKKELIJKEENIMPLICIETEGARANTIESAF,METINBEGRIPVAN,MAARNIETBEPERKTTOT,ELKEGARANTIEMETBETREKKINGTOTDEGOEDEWERKINGENDEGESCHIKTHEIDVOOREENBEPAALDDOEL.Alseen3MVoedselveiligheidproductgebrekkigis,zal3Mofzijngevolmachtigdedistributeur naar eigen keuze het product vervangen of de aankoopprijs van het product terugbetalen. Dit is het enige rechtsmiddel waarover u beschikt. Indien u vermoedt dat een product gebrekkig is, dan moet u 3M daarvan binnen de 60 dagen na het vaststellen op de hoogte brengen. Belonzeklantenservice(1-800-328-1617indeVS)ofuwerkendevertegenwoordigervoor3MVoedselveiligheid,dieuautorisatievoorhetretourneren van de goederen zal geven.

    Datumvanuitgifte:2013-03

    Sponge-Stick

    3Productinstructies

    http://www.3M.com/foodsafety

  • (Nederlands)

    2

    NLBEPERKING VAN 3M AANSPRAKELIJKHEID3MISNIETAANSPRAKELIJKVOORENIGVERLIESOFSCHADE,ONGEACHTOFHETGAATOMRECHTSTREEKSE,ONRECHTSTREEKSE,SPECIALE,INCIDENTELEOFGEVOLGSCHADE,METINBEGRIPVAN,MAARNIETBEPERKTTOTWINSTDERVING.Ingeengevalzaldewettelijkeaansprakelijkheidvan 3M onder welke juridische theorie ook de aankoopprijs van het zogenaamd gebrekkige product overschrijden.

    OPSLAG EN AFVALVERWERKINGOpslag: raadpleeg het etiket op de verpakking voor informatie over opslag.

    Verwijdering: volgdeactuelesectornormenenlokalereglementenvoorhetafvoerenvanbesmetafvalmateriaal.Raadpleeghetveiligheidsinformatieblad voor aanvullende informatie.

    Productbeschrijving Volume REF Volume van de zak

    Handschoenen

    3MSponge-Stick 0mL SSL100 0,89 l (30 oz) 0

    3MSponge-Stick-Gebufferdpeptonwater 10mL SSL10BPW 0,89 l (30 oz) 0

    3MSponge-Stick-Letheen 10mL SSL10LET 0,89 l (30 oz) 0

    3MSponge-Stick-Letheen-2handschoenen 10mL SSL10LET2G 0,89 l (30 oz) 2

    3MSponge-Stick-Neutraliserendebuffer 10mL SSL10NB 0,89 l (30 oz) 0

    3MSponge-Stick-Neutraliserendebuffer-2handschoenen 10mL SSL10NB2G 0,89 l (30 oz) 2

    3MSponge-Stick-Neutraliserendebuffer 10mL SSL10NB6X9 Zak van 15 cm x 23 cm (6" x 9")

    0

    3MSponge-Stick-D/Eneutraliserendebuffer 10mL SSL10DE 0,89 l (30 oz) 0

    GEBRUIKSAANWIJZINGEN1. Schud de stick naar het uiteinde van de zak.

    2. Scheur de zak open. OPMERKING:voegsterielverdunningsmiddelofbouillonaandedrogesponstoe.

    3. Knijpindezakomhemteopenen.Neemopaseptischewijzedestickbovendeduimmarkeringomdesponsteverwijderen.

    4. Neemopaseptischewijzeeenuitstrijkjevanhetgeheleoppervlakvanhetmonster3, 4, 5, 6.

    5. Draaidesponsom.Veranderderichting90.Neemopaseptischewijzeeenuitstrijkjevanhetzelfdemonsteroppervlak.

    6. Plaatsdesponsopaseptischewijzeindezaktotaandeduimmarkering.

    7. Houddesponsopzijnplaatsindezak.Buigstickomhemtebreken.Laatdesponsindezakvallen.Gooidestickweg.

    8. Vouw de zak om deze te sluiten.

    9. Vouw de uiteinden van de blauwe draden naar binnen.

    10. Verwijder, conform de vaste gebruikersprocedures, alle resten van de verrijkingsbouillon of neutraliserende oplossing van het oppervlak waarvan u een monster hebt genomen.

    REFERENTIES1. DeAmerikaanseFoodandDrugAdministration.Federalenormen,hoofdstuk21,deel58.GoodLaboratoryPracticevoorniet-medisch

    laboratoriumonderzoek.

    2. ISO/IEC17025.Algemeneeisenvoordebekwaamheidvantest-&ijkingslaboratoria.

    3. AmericanPublicHealthAssociation-CompendiumofMethodsfortheMicrobiologicalExaminationofFoods-Hoofdstuk3:MicrobiologicalMonitoringoftheFoodProcessingEnvironment,4euitgave.

    4. USFoodandDrugAdministration-BacteriologicalAnalyticalMethod(onlinebeschikbaarop http://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.html).

    5. UnitedStatesDepartmentofAgriculture-MicrobiologicalLabGuidebook-Hoofdstuk4.04,5.04en8.07.

    6. AmericanPublicHealthAssociation-StandardMethodsfortheExaminationofDairyProducts-Hoofdstuk13:MicrobiologicalTestsforEquipment,Containers,Water,andAir,17euitgave.

    Raadpleegdehuidigeversiesvandestandaardmethodesdiehierbovenzijnopgesomd.

    http://http://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.html

  • (Nederlands)

    3

    NLVERKLARING VAN SYMBOLEN

    Raadpleegdegebruiksaanwijzing

    Hetwoord"lot"ineenkaderenhetzandlopersymboolvormenhetlotnummerendevervaldatum.Dezandloperwordtgevolgddooreenjaar,maandendag,diedevervaldatumvormen(jaar,maandendag:JJJJ-MM-DD).DevolledigeregelnahetwoordLOTvertegenwoordigthetpartijnummer(JJJJ-MMAZ).

    Opslagvoorwaarden

  • (Nederlands)

    4

    NL

    1

    5

    9

    2

    6

    3

    7

    4

    8

  • 3M Health Care2510ConwayAveSt.Paul,MN55144USAwww.3M.com/foodsafety

    2013,3M.Allrightsreserved.3Misatrademarkof3M.UsedunderlicenseinCanada.

    34-8711-5866-2

    3

    3M Food Safety3M United States3MCenter

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-800-328-6553

    3M CanadaPostOfficeBox5757

    London,OntarioN6A4T1

    Canada

    1-800-563-2921

    3M Europe and MEA3MDeutschlandGmbH

    Carl-Schurz-Strasse1

    D41453Neuss/Germany

    +49-2131-14-3000

    3M Latin America3MCenter

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-954-340-8263

    3M Asia PacificNo1,YishunAvenue7

    Singapore, 768923

    65-64508869

    3M Japan3MHealthCareLimited

    33-1,Tamagawadai2-chrome

    Setagaya-ku,Tokyo

    158-8583,Japan

    81-570-011-321

    3M AustraliaBldgA,1RivettRoad

    NorthRyde,NSW2113

    Australia

    61 1300 363 878

  • (Svenska)

    1

    SV

    ProduktbeskrivningTorr eller frhydrerad samt biocidfri 3,8 x 7,6 cm (1,5 x 3 tum) svamp i provtagningspse. Frhydrerad med specificerat medel. Olika psstorlekar. Med eller utan handskar.

    Endast fr laboratoriebruk. Skerhetsdatablad fr material finns tillgngligt.

    skerHetAnvndaren br lsa, frst och flja all skerhetsinformation i instruktionerna. Behll dessa skerhetsfreskrifter fr framtida referens.

    vArning Anger en farlig situation som, om den inte undviks, kan orsaka ddsfall eller allvarliga personskador och/eller materiella skador.

    observerA Anger en potentiellt farlig situation som, om den inte undviks, kan orsaka materiella skador.

    W vArningFr att minska de risker som frknippas med miljfrorening ska du: Fljaaktuellabranschstandarderochlokalafreskriftergllandekasseringavkontamineratavfall.

    Fr att minska riskerna som frknippas med exponering fr biologiska risker ska du: Kasseraproverenligtallatillmpligastatligareglerochtillmpligalaboratorierutiner.

    Fr att minska riskerna som frknippas med falska negativa resultat som leder till anvndning av kontaminerade slaktkroppar eller ytor fr livsmedels- eller dryckprodukter ska du: Alltidlsafrpackningsetikettenfrfrvaringsinstruktionerochutgngsdatum. Alltidlsaproduktensbruksanvisning.

    Fr att minska de risker som frknippas med exponering fr kemikalier och biologiska risker: Fljalltidstandardiserad,godlaboratoriesedfrskerhet(GLP1 eller ISO 170252), inklusive rutiner fr korrekt inneslutning, och br lmplig

    skyddskldsel vid hantering av testmaterial och testprover.

    observerA

    Fr att minska riskerna fr falska positiva resultat p grund av korskontaminerade slaktkroppar eller ytor fr livsmedels- eller dryckprodukter, vilket kan leda till tertestning eller avvisning av livsmedels- eller dryckprodukten, ska du: Inteltasvampenellerprovtagningspinnenrravidngonickeavseddyta. Intebrytaavsvampenfrnprovtagningspinnenunderprovtagning. Intestrckadignerisvamppsen.

    Fr att minska risken fr korskontaminering vid teranvndning av provhanteringsenheten ska du: Inteanvndasammaprovtagningspinnemernengng.

    AnvndArens AnsvArDet ligger anvndarna att gra sig infrstdda med produktinstruktioner och produktinformation. Besk vr webbplats p adressen www.3M.com/foodsafety eller kontakta din lokala 3M-representant eller -leverantr fr mer information.

    Vid val av testmetod r det viktigt att inse att externa faktorer ssom provtagningsmetod, testprotokoll, provpreparering, hantering och laboratorieteknik kan pverka resultaten.

    Det ligger anvndaren att vid val av testmetoder eller produkt utvrdera tillrckligt mnga prover med lmpliga matriser och mikrobiella utmaningar fr att vertyga anvndaren att den valda metoden uppfyller anvndarens krav.

    Det ligger ocks anvndaren att faststlla att alla testmetoder och deras resultat uppfyller kraven frn dennes kunder och leverantrer.

    Ilikhetmedallatestmetoderutgrinteresultatsomerhllitsgenomanvndningavngonproduktfrn3MLivsmedelshygienengarantifrkvalitetenhos de matriser eller processer som testats.

    gArAntibegrnsningAr/begrnsAd ersttningMEDUNDANTAGAVVADSOMUTTRYCKLIGENANGESIAVSNITTOMGARANTIBEGRNSNINGFRINDIVIDUELLAFRPACKNINGARFRNSGERSIG3MALLAUTTRYCKLIGAOCHUNDERFRSTDDAGARANTIER,INKLUSIVE,MENINTEBEGRNSATTILL,ALLAGARANTIERBETRFFANDESLJBARHETELLERLMPLIGHETFRETTVISSTNDAML.Omngonproduktfrn3MLivsmedelshygienrdefektkommer3Mellerdessauktoriseradeleverantrattefteregetgottfinnandeersttaproduktenellerterbetalaproduktensinkpspris.Dettardenendaersttningsomges.Kundenmstemeddela3Mochreturneraproduktentill3Minomsextiodagarefterupptcktenavenmisstnktdefekt.Ringkundtjnst(iUSA:1-800-328-1671)ellerdinofficiellarepresentantfr3MLivsmedelshygienfrenauktorisationavseendereturavprodukt.

    Datumfrutgva:2013-03

    sponge-stick

    3Produktinformation

  • (Svenska)

    2

    SV3M:s AnsvArsbegrnsning3MKOMMERINTEATTTASIGNGOTANSVARFRFRLUSTELLERSKADOR,VARESIGDIREKTA,INDIREKTA,SRSKILDA,TILLFLLIGAELLEREFTERFLJANDESKADOR,INKLUSIVE,MENINTEBEGRNSADETILL,FRLORADEVINSTER.Underingaomstndigheterska3M:sansvaringotsomhelst lagrum verskrida inkpspriset fr den psttt defekta produkten.

    FrvAring oCH kAsseringFrvaring:Lsfrpackningensetikettfrinformationomfrvaring.

    kassering: Flj aktuella branschstandarder och lokala freskrifter gllande kassering av kontaminerat avfall. Se skerhetsdatabladet fr ytterligare information.

    Produktbeskrivning volym reF Psens volym Handskar

    3M Sponge-Stick 0 ml SSL100 0,89 l (30 oz) 0

    3M Sponge-Stick med buffrat peptonvatten 10 ml SSL10BPW 0,89 l (30 oz) 0

    3MSponge-Stick-Letheenbuljong 10 ml SSL10LET 0,89 l (30 oz) 0

    3MSponge-Stick-Letheenbuljong-2handskar 10 ml SSL10LET2G 0,89 l (30 oz) 2

    3M Sponge-Stick - Neutraliserande buffert 10 ml SSL10NB 0,89 l (30 oz) 0

    3M Sponge-Stick - Neutraliserande buffert - 2 handskar 10 ml SSL10NB2G 0,89 l (30 oz) 2

    3M Sponge-Stick - Neutraliserande buffert 10 ml SSL10NB6X9 15,24 cm x 22,86 cm pse

    0

    3M Sponge-Stick - D/E buljong 10 ml SSL10DE 0,89 l (30 oz) 0

    bruksAnvisning1. Skaka ned pinnen till botten av psen.

    2. Rivupppsen. OBS:Tillsttsteriltutspdningslsningellermediumtilldentorrasvampen.

    3. Klmfrattppnapsen.Fattaaseptisktpinnenvertumstopplinjenfrattavlgsnasvampen.

    4. Svabba aseptiskt ver hela provtagningsytan3,4,5,6.

    5. Vndpsvampen.ndrariktning90.Svabbaaseptisktsammaprovtagningsyta.

    6. Placeraaseptisktsvampenipsenupptilltumstoppet.

    7. Hllsvampenpplatsinutipsen.Bjpinnentillsdenbryts.Ltsvampenfallanedipsen.Kasserapinnen.

    8. Vik psen fr att stnga den.

    9. Vik ndarna p de bla trdarna int.

    10. Flj frutbestmda anvndningsrutiner och avlgsna eventuella rester av kvarvarande berikningsmedium eller neutraliseringslsning frn den provtagna ytan.

    reFerenser1. U.S.FoodandDrugAdministration.CodeofFederalRegulations,titel21,avsnitt58.GoodLaboratoryPracticeforNonclinicalLaboratoryStudies.

    2. ISO/IEC17025.Allmnnakompetenskravfrprovnings-ochkalibreringslaboratorier.

    3. AmericanPublicHealthAssociation-CompendiumofMethodsfortheMicrobiologicalExaminationofFoods-Kapitel3:MicrobiologicalMonitoringoftheFoodProcessingEnvironment,4:eupplagan.

    4. US Food and Drug Administration - Bacteriological Analytical Method (tillgnglig online p http://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.html).

    5. UnitedStatesDepartmentofAgriculture-MicrobiologicalLabGuidebook-MicrobiologicalLabGuidebook-Kapitel4.04,5.04,och8.07.

    6. AmericanPublicHealthAssociation-StandardMethodsfortheExaminationofDairyProducts-Kapitel13:MicrobiologicalTestsforEquipment,Containers,Water,andAir,17:eupplagan.

    Se de aktuella versionerna av de standardmetoder som anges ovan.

  • (Svenska)

    3

    SVsYMboLFrkLAring

    Se bruksanvisningen

    Symbolerna lot i en ruta och timglaset representerar partinummer och utgngsdatum. Timglaset fljs av ett rtal, en mnad och en dagvilketvisarutgngsdatum(r,mnadochdag:-MM-DD).HelaradenefterLOTrepresenterarpartinumret(-MMAZ).

    Frvaringsfrhllanden

  • (Svenska)

    4

    SV

    1

    5

    9

    2

    6

    3

    7

    4

    8

  • 3M Health Care2510ConwayAveSt.Paul,MN55144USAwww.3M.com/foodsafety

    2013, 3M. All rights reserved.3Misatrademarkof3M.UsedunderlicenseinCanada.

    34-8711-5866-2

    3

    3M Food safety3M united states3MCenter

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-800-328-6553

    3M CanadaPostOfficeBox5757

    London,OntarioN6A4T1

    Canada

    1-800-563-2921

    3M europe and MeA3MDeutschlandGmbH

    Carl-Schurz-Strasse1

    D41453Neuss/Germany

    +49-2131-14-3000

    3M Latin America3MCenter

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-954-340-8263

    3M Asia PacificNo1,YishunAvenue7

    Singapore, 768923

    65-64508869

    3M Japan3MHealthCareLimited

    33-1, Tamagawadai 2-chrome

    Setagaya-ku, Tokyo

    158-8583,Japan

    81-570-011-321

    3M AustraliaBldgA,1RivettRoad

    NorthRyde,NSW2113

    Australia

    61 1300 363 878

  • (Dansk)

    1

    DA

    ProduktbeskrivelseTr eller forvdet og biocidfri 3,8 x 7,6 cm svamp i en prvepose. Forvdet med et specificeret stof. Forskellige posestrrelser. Med eller uden handsker.

    Kun til laboratoriebrug. Sikkerhedsdatablad er tilgngeligt.

    sikkerHedBrugeren skal lse, forst og flge alle sikkerhedsoplysninger i instruktionerne. Opbevar disse sikkerhedsinstruktioner til senere brug.

    AdvArsel Angiver en farlig situation, som udgr en risiko for dd eller alvorlig personskade og/eller skade p ejendom, hvis den ikke undgs.

    beMrk Angiver en potentiel farlig situation, som udgr en risiko for beskadigelse af ejendom, hvis den ikke undgs.

    W AdvArsel

    For at reducere risici forbundet med miljforurening: Flggldendeindustristandarderoglokalebestemmelservedr.bortskaffelseafkontamineretaffald.

    For at reducere risici forbundet med eksponering for biologiske farer: Bortskafprverneioverensstemmelsemedallegldendestatsregulativeroggldendelaboratorieprocedurer.

    For at reducere risikoen forbundet med falske negative resultater, der medfrer kontaminerede kadaver- eller miljoverflader til fde- og drikkevareprodukter: Derhenvisesaltidtilskensetiketforopbevaringsinstruktionerogudlbsdato. Derhenvisesaltidtilproduktinstruktionerneforanvendelse.

    For at reducere risici forbundet med eksponering for kemikalier og biologiske farer: Flgaltidstandardenforgodsikkerhedspraksisilaboratoriet(GLP1 eller ISO 170252), inklusive korrekte opbevaringsprocedurer, brug af passende

    beskyttelsesudstyr under hndtering af analysematerialer og prver.

    beMrk

    For at reducere risikoen forbundet med falske positive resultater, der skyldes krydskontaminerede kadaver- eller miljoverflader til fde- og drikkevareprodukter, der kan medfre gentestning eller afvisning af fde- og drikkevareproduktet: Svampenellersvampeholderenmikkekommeikontaktmedenhverutilsigtetoverflade. Svampenmikketagesafsvampeholderenunderprvetagning. Stikikkehndennedisvampenspose.

    For at reducere risikoen for krydskontaminering fra genanvendelse af prvehndteringsenheden: Densammesvampeholdermikkebrugesmereendngang.

    bruGerANsvArBrugerne er ansvarlige for at gre sig bekendt med produktinstruktioner og -oplysninger. Besg vores websted p www.3M.com/foodsafety, eller kontakt din lokale 3M reprsentant eller distributr for yderligere oplysninger.Nr der vlges en testmetode, er det vigtigt, at man er klar over, at eksterne faktorer, ssom prveudtagningsmetoder, testprotokoller, klargring af prven, hndtering samt laboratorieteknikker, kan pvirke resultaterne.Deterbrugerensegetansvaratvlgeentestmetode,somevaluererettilstrkkeligtantalprvermeddepassendematricerogmikrobielleudfordringer for derved at sikre brugeren, at den valgte testmetode lever op til brugerens krav.Deterogsbrugerensansvaratfastsl,attestmetoderneogresultaterneleveroptilkundernesogleverandrerneskrav.Som med alle andre testmetoder glder det, at de resultater, der opns med dette 3M Food Safety-produkt, ikke giver garanti for kvaliteten af de testede matricer og processer.

    beGrNsNiNG AF GArANtier / beGrNset retsMiddelBORTSETFRAHVADDERERUDTRYKKELIGTANFRTIDENBEGRNSEDEGARANTITILINDIVIDUELPRODUKTEMBALLAGE,FRASIGER3MSIGALLEUDTRYKKELIGEOGUNDERFORSTEDEGARANTIERINDBEFATTET,MENIKKEBEGRNSETTIL,ENHVERGARANTIOMSALGBARHEDELLEREGNETHEDTILENBESTEMTANVENDELSE.Hviset3MFoodSafety-produkterbehftetmedfejlellermangler,vil3Mellerenafdennesautoriserededistributrerefterdennesegetsknudskifteellerrefundereproduktetskbspris.Detteerdetenestetilrdighedsvrenderetsmiddel.Duskalstraks,indenfortresdageefterathaveopdagetenhverformodetfejlvedetprodukt,meddeledetteogreturnereproduktettil3M.Kontaktkundeservice(1-800-328-1671iUSA)ellerdenlokale3MFoodSafetykonsulentforetRMA-nummer.

    Udstedelsesdato:2013-03

    sponge-stick

    3Produktinstruktioner

    http://www.3M.com/foodsafety

  • (Dansk)

    2

    DAbeGrNsNiNG AF 3M's ANsvAr3MKANIKKEHOLDESANSVARLIGFOREVT.TABELLERSKADER,HVADENDDEEROPSTETDIREKTE,INDIREKTE,UNDERSRLIGEOMSTNDIGHEDERELLERTILFLDIGESKADERINDBEFATTET,MENIKKEBEGRNSETTIL,MISTETFORTJENESTE.Underingenomstndighederskal3M's erstatningsansvar kunne overstige kbsprisen af produktet, der efter sigende er behftet med fejl.

    oPbevAriNG oG bortskAFFelseopbevaring:Derhenvisestilskensetiketforopbevaringsoplysninger.

    bortskaffelse: Flg gldende industristandarder og lokale bestemmelser vedr. bortskaffelse af kontamineret affald. Se sikkerhedsdatabladet for yderligere oplysninger.

    Produktbeskrivelse volumen reF. Posens volumen

    Handsker

    3M Sponge-Stick 0 ml SSL100 0,89 l 0

    3MSponge-StickmedBufferedPeptonvandBouillon 10 ml SSL10BPW 0,89 l 0

    3MSponge-StickmedLetheenBouillon 10 ml SSL10LET 0,89 l 0

    3MSponge-StickmedLetheenBouillon,2handsker 10 ml SSL10LET2G 0,89 l 2

    3M Sponge-Stick med neutraliserende Buffer 10 ml SSL10NB 0,89 l 0

    3M Sponge-Stick med neutraliserende Buffer, 2 handsker 10 ml SSL10NB2G 0,89 l 2

    3M Sponge-Stick med neutraliserende Buffer 10 ml SSL10NB6X9 6 x 9 pose 0

    3MSponge-StickmedD/EBouillon 10 ml SSL10DE 0,89 l 0

    bruGsANvisNiNG1. Ryst holderen ned til posens ende.

    2. Riv posen ben. BEMRK:Putsterilfortynderellerbouillonpdentrresvamp.

    3. Klem om posen for at bne den. Tag fat om holderen over tommelfingerstoppets linje vha. en aseptisk metode for at fjerne svampen.

    4. Gnidsvaberenoverheleprveoverfladenvha.enaseptiskmetode3, 4, 5, 6.

    5. Vendsvampenom.Skiftretningmed90.Gniddensammeprveoverflademedensvabervha.enaseptiskmetode.

    6. Anbring svampen i posen op til tommelfingerstoppet vha. en aseptisk metode.

    7. Holdsvampenppladsindeiposen.Bjholderenforatknkkeden.Ladsvampenfaldenediposen.Kassrholderen.

    8. Fold posen for at lukke den.

    9. Fold de bl ledningers ender indad.

    10. Flg brugeretablerede procedurer, fjern al resterende opformeringsbouillon eller rester af neutraliseringsoplsning fra prveoverfladen.

    litterAturHeNvisNiNGer1. U.S.FoodandDrugAdministration.CodeofFederalRegulations,Title21,Part58.GoodLaboratoryPracticeforNonclinicalLaboratoryStudies.

    2. ISO/IEC17025.Generalrequirementsforthecompetenceoftestingandcalibrationlaboratories.

    3. AmericanPublicHealthAssociation-CompendiumofMethodsfortheMicrobiologicalExaminationofFoods-Chapter3:MicrobiologicalMonitoringoftheFoodProcessingEnvironment,4thedition.

    4. USFoodandDrugAdministration-BacteriologicalAnalyticalMethod(tilgngeligonlinep http://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.html).

    5. UnitedStatesDepartmentofAgriculture-MicrobiologicalLabGuidebook-Chapters4.04,5.04,and8.07.

    6. AmericanPublicHealthAssociation-StandardMethodsfortheExaminationofDairyProducts-Chapter13:MicrobiologicalTestsforEquipment,Containers,Water,andAir,17thedition.

    Vi henviser til de opdaterede versioner af de standardmetoder, som er angivet ovenfor.

    http://http://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.html

  • (Dansk)

    3

    DAsYMbolForklAriNGer

    Se brugsanvisningen

    Symbolerne lot pr. ske og timeglasset reprsenterer lotnummer og udlbsdatoen. Timeglasset efterflges af rstallet, mneden og dagenforudlbsdatoen(r,mnedogdag:-MM-DD).HelelinjenefterLOThenvisertillotnummeret(-MMAZ).

    Opbevaringsforhold

  • (Dansk)

    4

    DA

    1

    5

    9

    2

    6

    3

    7

    4

    8

  • 3M Health Care2510ConwayAveSt.Paul,MN55144USAwww.3M.com/foodsafety

    2013, 3M. All rights reserved.3Misatrademarkof3M.UsedunderlicenseinCanada.

    34-8711-5866-2

    3

    3M Food safety3M united states3MCenter

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-800-328-6553

    3M CanadaPostOfficeBox5757

    London,OntarioN6A4T1

    Canada

    1-800-563-2921

    3M europe and MeA3MDeutschlandGmbH

    Carl-Schurz-Strasse1

    D41453Neuss/Germany

    +49-2131-14-3000

    3M latin America3MCenter

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-954-340-8263

    3M Asia PacificNo1,YishunAvenue7

    Singapore, 768923

    65-64508869

    3M Japan3MHealthCareLimited

    33-1, Tamagawadai 2-chrome

    Setagaya-ku, Tokyo

    158-8583,Japan

    81-570-011-321

    3M AustraliaBldg A, 1 Rivett Road

    NorthRyde,NSW2113

    Australia

    61 1300 363 878

  • (Norsk)

    1

    NO

    ProduktbeskrivelseTrr eller forfuktet og biocid-fri 3,8 x 7,6 cm (1,5 x 3 tommer) svamp i prvepose. Forfuktet med spesifisert middel. Forskjellige posestrrelser. Med eller uten hansker.

    Kun til laboratoriebruk. HMS-datablad tilgjengelig.

    sikkerHetBrukeren m lese, forst og flge all sikkerhetsinformasjon i denne anvisningen. Behold sikkerhetsinstruksjonene for fremtidig referanse.

    AdvArsel Indikerer en farlig situasjon som, dersom den ikke unngs, kan fre til dd eller alvorlig skade og/eller materielle skader.

    MerkNAd Indikerer en potensielt farlig situasjon som, dersom den ikke unngs, kan fre til materielle skader.

    W AdvArsel

    For redusere risiko forbundet med miljforurensning: Flggjeldendestandarderoglokaleforskrifterforavhendingavkontaminertavfall.

    For redusere risikoene forbundet med eksponering for biologiske farer: Avhendprverihenholdtilallegjeldendeoffentligeforskrifteroggjeldendelaboratorieprosedyrer.

    For redusere risikoen forbundet med falsk-negative resultater ved bruk av kontaminerte skrotter eller miljoverflater for mat- eller drikkevareprodukter: Sealltidppakningsmerkingenforinformasjonomlagringogutlpsdato. Sealltidiproduktinstruksjoneneforbruk.

    For redusere risiko forbundet med eksponering for kjemikalier og biologiske farer: Flgalltidstandardgodlaboratoriepraksis(GLP1 eller ISO 170252),samtkorrekteoppsamlingsprosedyrer,brukavegnetverneutstyrved

    hndtering av testmaterialer og prver.

    MerkNAd

    For redusere risikoen for falsk-positive resultater p grunn av krysskontaminerte skrotter eller miljoverflater for mat- eller drikkeprodukter som kan resultere i ny testing eller at mat- eller drikkeproduktet forkastes: Ikkeberrnoenutilsiktedeoverflatermedsvampenellersponge-stickfuktetsvaber. Ikkebrekksvampenfrasponge-stickfuktetsvabernrmantarprver. Ikkestikkhndeninniposenmedsvampen.

    For redusere risikoen for krysskontaminering ved gjenbruk av hndteringsenhet for prver: Brukaldrisammesponge-stickfuktetsvabermerennngang.

    brukerANsvArBrukere er ansvarlige for sette seg inn i instruksjoner og informasjon om produktet. Besk vr nettside www.3M.com/foodsafety, eller kontakt din lokale 3M-representant eller forhandler for mer informasjon.Vedvalgavtestmetodeerdetviktigtahensyntilateksternefaktorersommetoderforstikkprver,testprotokoller,klargjringavprver,hndteringog laboratorieteknikk kan pvirke resultatene.Ved valg av testmetode er det brukerens ansvar vurdere et tilstrekkelig antall prver med passende matriser og mikrobielle utfordringer for tilfredsstillebrukerenomatdenvalgteprvemetodenoppfyllerbrukerenskriterier.Det er ogs brukerens ansvar fastsl at alle prvemetoder og resultater tilfredsstiller kundens og leverandrens krav.Sommedalletestmetoder,utgjrikkeresultatenesomoppnsvedbrukavnoe3MFoodSafety-produktnoengarantiomkvalitetenavmatriseneellerprosessene som testes.

    beGreNsNiNG Av GArANtier / beGreNsede rettsMidlerMEDMINDREDETERUTTRYKKELIGSKREVETIENBEGRENSETGARANTIPENPRODUKTPAKNING,FRASKRIVER3MSEGALLEDIREKTEOGINDIREKTEGARANTIER,INKLUDERTMENIKKEBEGRENSETTIL,ENHVERGARANTIOMSALGBARHETELLERANVENDELSETILETBESTEMTFORML.Hvisnoe3MFoodSafety-produkterdefektvil3Mellerdetsautorisertedistributrerstatte,reparereellerrefundereproduktetskjpesumetteregetskjnn. Dette er dine ubetingede rettsmidler. Du m straks varsle 3M innen seksti dager fra oppdagelsen av enhver mulig feil i et produkt og returnere detteproduktettil3M.Ringkundeservice(1-800-328-1671iUSA)ellerdinoffisielle3MFoodSafety-representantforetautoriseringsnummerforretur av produktet.

    Utgivelsesdato: 2013-03

    sponge-stick fuktet svaber

    3Produktveiledning

    http://www.3M.com/foodsafety

  • (Norsk)

    2

    NObeGreNsNiNG Av 3Ms ANsvAr3MVILIKKEVREANSVARLIGFORNOETAPELLERSKADE,DIREKTEELLERINDIREKTE,SPESIELL,TILFELDIGELLERFLGESKADE,INKLUDERT,MENIKKEBEGRENSETTIL,TAPTFORTJENESTE.Ikkeundernoenomstendighetskal3Msansvar,undernoenjuridiskteori,overstigekjpesummenforetprodukt som antas vre defekt.

    oPPbevAriNG oG AvHeNdiNGoppbevaring: Se pakningsmerkingen for informasjon om lagring.

    Avhending: Flg gjeldende standarder og lokale forskrifter for avhending av kontaminert avfall. Se HMS-databladet for mer informasjon.

    Produktbeskrivelse volum reF Posevolum Hansker

    3M Sponge-Stick fuktet svaber 0 ml SSL100 0,89 l (30 oz.) 0

    3M Sponge-Stick fuktet svaber med buffret peptonvann 10 ml SSL10BPW 0,89 l (30 oz.) 0

    3MSponge-StickfuktetsvabermedLetheen-buljong 10 ml SSL10LET 0,89 l (30 oz.) 0

    3M Sponge-Stick fuktet svaber med letheen buljong - 2 hansker 10 ml SSL10LET2G 0,89 l (30 oz.) 2

    3MSponge-Stickfuktetsvabermednytralbuffer 10 ml SSL10NB 0,89 l (30 oz.) 0

    3MSponge-Stickfuktetsvabermednytralbuffer-2hansker 10 ml SSL10NB2G 0,89 l (30 oz.) 2

    3MSponge-Stickfuktetsvabermednytralbuffer 10 ml SSL10NB6X9 15,2 cm x 22,9 cm pose (6 x 9 tommer)

    0

    3M Sponge-Stick fuktet svaber med D/E-buljong 10 ml SSL10DE 0,89 l (30 oz.) 0

    bruksANvisNiNG1. Rist pinnen til enden av posen.

    2. Riv opp posen. MERK:Tilfrsteriltfortynningsmiddelellerbuljongtiltrrsvamp.

    3. Klempposenforpneden.Grippinnenaseptiskovertommel-stopp-linjenfortautsvampen.

    4. Fr svampen aseptisk over hele prveflaten3,4,5,6.

    5. Vend svampen rundt. Endre retning 90. Fr svampen aseptisk over den samme prveflaten.

    6. Plassersvampenaseptiskinniposenopptiltommel-stopp.

    7. Holdsvampeninniposen.Bypinnenslikatdenbrekker.Lasvampenfallenediposen.Kastpinnen.

    8. Fold sammen posen for lukke den.

    9. Fold endene p de bl trdene innover.

    10.Flgbrukeretablerteprosedyrervedfjerningaveventuellgjenvrendeoppformertbuljongellerresteravnytraliserendeopplsningfraprveoverflaten.

    reFerANser1. U.S.FoodandDrugAdministration.CodeofFederalRegulations,tittel21,del58.Godlaboratoriepraksisforikke-kliniskelaboratoriestudier.

    2. ISO/IEC17025.Generellekravtilkompetansefortestings-ogkalibreringslaboratorier.

    3. AmericanPublicHealthAssociationKompendiumformetoderformikrobiologiskeunderskelseravmatKapittel3:Mikrobiologiskovervkingav miljer i matproduksjon, 4. utgave.

    4. USFoodandDrugAdministrationBakteriologiskeanalysemetoder(tilgjengeligp http://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.html).

    5. UnitedStatesDepartmentofAgricultureHndbokformikrobiologisklabKapitlene4.04,5.04og8.07.

    6. AmericanPublicHealthAssociationStandardmetoderforunderskelseavmeieriprodukterKapittel13:Mikrobiologisketesterforutstyr,beholdere, vann og luft, 17. utgave.

    Se gjeldende versjon av standardmetodene oppfrt ovenfor.

    http://http://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.html

  • (Norsk)

    3

    NOsYMbolForklAriNG

    Se bruksanvisning

    DeinnrammedebokstaveneLOTogtimeglass-symboletangirpartinummerogutlpsdato.Timeglassetetterflgesavr,mnedogdagsomangirholdbarhetsdato(r,mnedogdag:-MM-DD).HelelinjenetterLOTrepresentererpartinummeret(-MMAZ).

    Oppbevaringsforhold

  • (Norsk)

    4

    NO

    1

    5

    9

    2

    6

    3

    7

    4

    8

  • 3M Health Care2510ConwayAveSt.Paul,MN55144USAwww.3M.com/foodsafety

    2013,3M.Allrightsreserved.3Misatrademarkof3M.UsedunderlicenseinCanada.

    34-8711-5866-2

    3

    3M Food safety3M united states3MCenter

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-800-328-6553

    3M CanadaPostOfficeBox5757

    London,OntarioN6A4T1

    Canada

    1-800-563-2921

    3M europe and MeA3MDeutschlandGmbH

    Carl-Schurz-Strasse1

    D41453Neuss/Germany

    +49-2131-14-3000

    3M latin America3MCenter

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-954-340-8263

    3M Asia PacificNo1,YishunAvenue7

    Singapore, 768923

    65-64508869

    3M Japan3MHealthCareLimited

    33-1, Tamagawadai 2-chrome

    Setagaya-ku,Tokyo

    158-8583,Japan

    81-570-011-321

    3M AustraliaBldgA,1RivettRoad

    NorthRyde,NSW2113

    Australia

    61 1300 363 878

  • (Suomenkielinen)

    1

    FI

    TuoTTeen kuvausKuiva tai esikostutettu ja biosiditon 3,8 x 7,6 cm (1,5 x 3 tuumaa) sieni nytepussissa. Esikostutettu, sislt ilmoitettua ainetta. Eri pussikokoja. Suojaksineill tai ilman.

    Ainoastaan laboratoriokyttn. Kyttturvallisuustiedote saatavissa.

    TuRvaLLIsuusKyttjn tulee lukea ja ymmrt kaikki annetut turvaohjeet sek noudattaa niit. Silyt turvallisuusohjeet myhemp kytt varten.

    vaRoITus Osoittaa vaarallisen tilanteen, joka saattaa johtaa kuolemaan tai vakavaan loukkaantumiseen ja/tai omaisuusvahinkoon, jos tilannetta ei vltet.

    HuoMIo Osoittaa mahdollisesti vaarallisen tilanteen, joka saattaa johtaa omaisuusvahinkoon, jos tilannetta ei vltet.

    W vaRoITus

    vhenn ympristn saastumiseen liittyvi riskej toimimalla seuraavasti: Noudatavallitseviateollisuusstandardejajapaikallisiamryksisaastuneenjtteenhvittmisess.

    vhenn biologisiin vaaratekijihin liittyvi riskej noudattamalla seuraavia ohjeita: Hvitnytteetkaikkiensovellettavienviranomaismrystenjalaboratoriomenettelyidenmukaan.

    elintarvikkeiden tai juomien kontaminoituneessa ruhossa tai ympristn pinnoilla kytst johtuvien vrien negatiivisten vaaran vhentminen: Katsovarastointiohjeetjaviimeinenkyttpivainapakkausmerkinnist. Tutustuainatuotteenkyttohjeisiin.

    Jotta voit vhent kemikaaleille altistumiseen ja biologisiin vaaratekijihin liittyvi riskej, toimi seuraavasti: Noudatanormaalejahyvilaboratorionturvallisuuskytntj(GLP1 tai ISO 170252) mukaan lukien asianmukaiset suojausmenettelyt ja

    suojavaatteiden kytt koemateriaalien ja testinytteiden ksittelyn yhteydess.

    HuoMIo

    Ristiinkontaminoituneesta ruhosta tai ympristn pinnoista johtuvien uusintatestaukseen tai elintarvikkeen tai juoman hylkmiseen johtavien vrien positiivisten vaaran vhentminen: lkoskesienelltaisienitikullapintoihin,joihineioletarkoituskoskea. lirrotasientsienitikustanytteenotonaikana. ltartusienenpussiin.

    nytteiden ksittelylaitteen uudelleenkytst johtuvan ristikontaminaation vaaran vhentminen: Kytkutakinsienitikkuavainkerran.

    kYTTJn vasTuuKyttjn vastuulla on tutustua tuotteen kyttohjeisiin ja tietoihin. Saat listietoja verkkosivuiltamme osoitteesta www.3M.com/foodsafety tai ottamalla yhteytt paikalliseen 3M-edustajaan tai -jlleenmyyjn.

    Testausmenetelmvalitessaontrkeottaahuomioon,ettulkoisettekijt,kutennytteenottomenetelmt,testauskytnnt,nytteidenvalmistus,ksittely ja laboratoriotekniikat, voivat vaikuttaa testaustuloksiin.

    Kyttj on aina testausmenetelm tai tuotetta valitessaan vastuussa siit, ett hn arvioi riittvn mrn nytteit kyseisist elintarvikkeista ja mikrobialtistuksista varmistamaan kyttjn kriteerien tyttymisen.

    Kyttjn vastuulla on mys varmistaa, ett testausmenetelmt ja tulokset tyttvt hnen asiakkaidensa tai toimittajiensa vaatimukset.

    Kuten kaikkien testausmenetelmien kohdalla, mink tahansa 3M Food Safety -tuotteen kytst saadut tulokset eivt ole takuu matriisien tai testattujen prosessien laadusta.

    Takuun RaJoITus / RaJoITeTTu koRvausveLvoLLIsuus3MKIISTKAIKKINIMENOMAISETJAEPSUORATTAKUUTMUKAANLUKIEN,MUTTAEINIIHINRAJOITTUEN,KAIKKITAKUUTKYPYYDESTTAISOPIVUUDESTATIETTYYNKYTTTARKOITUKSEEN,ELLEITUOTEPAKKAUKSENTAKUUOSIOSSATOISINMAINITA.Josmiktahansa3MFoodSafety-tuoteonviallinen,3Mtaisenvaltuutettujlleenmyyjjokokorvaatuotteen,korjaatuotteentaipalauttaasenostohinnan.Nmovatainoatmynnettvt korvaukset. Kyttjn on ilmoitettava viipymtt kuudenkymmenen pivn sisll kaikista epillyist tuotevirheist ja palautettava tuote 3M:lle.Pyydpalautusohjeetottamallayhteysasiakaspalveluun(1-800-328-1617,Yhdysvallat)taiviralliseen3MFoodSafety-edustajaasi.

    Julkaisuajankohta:2013-03

    sponge-stick sienitikku

    3Tuoteseloste

  • (Suomenkielinen)

    2

    FI3M:n vasTuun RaJoITukseT3MEIOLEVASTUUSSAMENETYKSISTTAIVAHINGOISTA,OLIVATNESITTENSUORIA,EPSUORIA,ERITYISLAATUISIA,SATUNNAISIATAIVLILLISI,MUKAANLUKIEN(MUTTAEINIIHINRAJOITTUEN)VOITONMENETYKSET.Missntapauksessa3M:nvastuueiminknlaillisenperusteenmukaanolesuurempi kuin vialliseksi vitetyn tuotteen hinta.

    sILYTYs Ja HvITTMInensilytys: Katso silytyst koskevat tiedot pakkausetiketist.

    Hvittminen: Noudatasaastuneenjtteenhvittmisessvallitseviateollisuusstandardejajapaikallisiamryksi.Katsolistietojakyttturvallisuustiedotteesta.

    Tuotteen kuvaus Tilavuus vIITe Pussin tilavuus

    ksineet

    3M Sponge-Stick Sienitikku 0 ml SSL100 0,89 l (30 oz.) 0

    3M Sponge-Stick Sienitikku puskuroidulla peptonivedell 10 ml SSL10BPW 0,89 l (30 oz.) 0

    3MSponge-StickSienitikku-Letheeniliuoksella 10 ml SSL10LET 0,89 l (30 oz.) 0

    3MSponge-StickSienitikku-Letheeniliuoksella-2suojaksinett 10 ml SSL10LET2G 0,89 l (30 oz.) 2

    3MSponge-StickSienitikku-Neutraloivallapuskurilla 10 ml SSL10NB 0,89 l (30 oz.) 0

    3MSponge-StickSienitikku-Neutraloivallapuskurilla-2suojaksinett 10 ml SSL10NB2G 0,89 l (30 oz.) 2

    3MSponge-StickSienitikku-Neutraloivallapuskurilla 10 ml SSL10NB6X9 6 x 9 tuuman pussi

    0

    3MSponge-StickSienitikku-D/Eliuoksella 10 ml SSL10DE 0,89 l (30 oz.) 0

    kYTToHJeeT1. Ravistatikkupussinperlle.

    2. Revipussiauki. HUOMAUTUS:Lissienitikkuunsteriililaimennusainettataiseosta.

    3. Avaa pussi puristamalla. Irrota sieni tarttumalla tikkuun aseptisesti peukalon merkkiviivan ylpuolelta.

    4. Pyyhiaseptisestikokonytteenottoalueelta3, 4, 5, 6.

    5. Knnsieni.Vaihdasuuntaa90.Pyyhiaseptisestisamanytepinta.

    6. Aseta sieni aseptisesti pussiin peukalon merkkiviivaan asti.

    7. Pidsienipaikallaanpussinsisll.Katkaisetikkutaivuttamalla.Annasienenpudotapussiin.Hvittikku.

    8. Sulje taittamalla pussi.

    9. Taitasinistenjohtojenptsisnpin.

    10.Poistajljellolevarikastusliuostaineutralisointiliuosnytepinnastakyttmllvakiintuneitamenettelytapoja.

    LHDevIITTeeT1. U.S.FoodandDrugAdministration.CodeofFederalRegulations,Title21,Part58.GoodLaboratoryPracticeforNonclinicalLaboratoryStudies.

    2. ISO/IEC17025.Testaus-jakalibrointilaboratorioidenptevyys.Yleisetvaatimukset.

    3. AmericanPublicHealthAssociation-CompendiumofMethodsfortheMicrobiologicalExaminationofFoods-Chapter3:MicrobiologicalMonitoringoftheFoodProcessingEnvironment,4thedition.

    4. USFoodandDrugAdministration-BacteriologicalAnalyticalMethod(kytettvissosoitteessahttp://www.fda.gov/Food/ScienceResearch/LaboratoryMethods/BacteriologicalAnalyticalManualBAM/default.html).

    5. UnitedStatesDepartmentofAgriculture-MicrobiologicalLabGuidebook-Chapters4.04,5.04,and8.07.

    6. AmericanPublicHealthAssociation-StandardMethodsfortheExaminationofDairyProducts-Chapter13:MicrobiologicalTestsforEquipment,Containers,Water,andAir,17thedition.

    Katso edell mainittujen standardien mukaisten menetelmien ajantasaiset versiot.

  • (Suomenkielinen)

    3

    FIMeRkkIen seLITYkseT

    Katso kyttohje

    LaatikossaolevamerkintLOTjatiimalasiilmaisevaternumeronjaviimeisenkyttpivn.Tiimalasinperssolevavuosi,kuukausijapivilmaisevatviimeisenkyttpivn(vuosi,kuukausi,piv:VVVV-KK-PP).KokoLOT-merkinnnjlkeinenriviilmoittaaernumeron(VVVV-KKAZ).

    Silytysolosuhteet

  • (Suomenkielinen)

    4

    FI

    1

    5

    9

    2

    6

    3

    7

    4

    8

  • 3M Health Care2510ConwayAveSt.Paul,MN55144USAwww.3M.com/foodsafety

    2013, 3M. All rights reserved.3Misatrademarkof3M.UsedunderlicenseinCanada.

    34-8711-5866-2

    3

    3M Food safety3M united states3MCenter

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-800-328-6553

    3M CanadaPostOfficeBox5757

    London,OntarioN6A4T1

    Canada

    1-800-563-2921

    3M europe and Mea3MDeutschlandGmbH

    Carl-Schurz-Strasse1

    D41453Neuss/Germany

    +49-2131-14-3000

    3M Latin america3MCenter

    Bldg.275-5W-05

    St.Paul,MN55144-1000

    USA

    1-954-340-8263

    3M asia PacificNo1,YishunAvenue7

    Singapore, 768923

    65-64508869

    3M Japan3MHealthCareLimited

    33-1,Tamagawadai2-chrome

    Setagaya-ku,Tokyo

    158-8583,Japan

    81-570-011-321

    3M australiaBldgA,1RivettRoad

    NorthRyde,NSW2113

    Australia

    61 1300 363 878

  • (Portugus)

    1

    PT

    Descrio Do ProDutoSeca ou pr-hidratada e livre de biocidas 3,8 x 7,6 cm (1,5 x 3 in.) Esponja em bolsas de amostra. Pr-hidratada com agente especificado. Vrios tamanhos de bolsas. Com ou sem luvas.

    Apenas para uso no laboratrio. Ficha de Informaes de Segurana de Produto Qumico disponvel.

    seGurANAO usurio deve ler, compreender e seguir todas as informaes de segurana contidas nas instrues. Conservar as instrues de segurana para consulta posterior.

    AViso Indica uma situao de perigo que, se no evitada, pode resultar em morte ou ferimentos graves e/ou danos propriedade.

    oBserVAo Indica uma situao potencialmente perigosa que, se no evitada, pode resultar em danos propriedade.

    W AViso

    Para reduzir os riscos associados contaminao ambiental: Sigaospadresatuaisdosetoreosregulamentoslocaisparaodescartederesduoscontaminados.

    Para reduzir os riscos associados exposio a agentes nocivos biolgicos: Descarteasamostrasdeacordocomosregulamentosgovernamentaiseosprocedimentoslaboratoriaisaplicveis.

    Para reduzir os riscos associados a um resultado falso negativo, que pode resultar no uso de carcaa contaminada ou superfcies ambientais para alimentos ou bebidas: Sempreconsulteortulodaembalagemparaobterinformaessobreinstruesdearmazenamentoedatadevalidade. Sempreconsulteasinstruesdeusodoproduto.

    Para reduzir os riscos de exposio a produtos qumicos e agentes nocivos biolgicos: Sempresigaanormademelhoresprticaslaboratoriais(GLP1 ou ISO 170252), inclusive procedimentos de conteno adequados, usando

    equipamentos de proteo apropriados e proteo para os olhos ao manipular materiais e amostras de testes.

    oBs