Tampa Bay Wellness - August, 2014

Tampa Bay Wellness • AUGUST 2014 1www.tampabaywellness.com

MAGAZINEVolume XXIX: Issue XX • AuGusT 2014 • FRee

Shilpa P. Saxena, M.D.

“An innovative medical practice dedicated to helping patients achieve lifelong, vibrant health.”19105 US Highway 41 North | Suite 100Lutz, FL 33549p: 813.269.2700 | f: 813.269.2701

2 AUGUST 2014 • Tampa Bay Wellness www.tampabaywellness.com

Lectures available in Tampa, Clearwater, St Petersburg, Dunedin and Bradenton. $20 per person, includes dinner.

Call (813) 440-1299 to make your reservation for the journey & dining experience

This lecture is strictly based on factual experiences and unbiased wisdom without theological ties.

www.GreenDreamsFL.com Holistic Practices include:regenerative agriculturePermaculture designconsulting serviceschemical-Free Vegetable Gardens & orchardsrestaurant/culinary Gardensedible landscape nursery & supplies

Demonstration Site/Education [email protected]


After

Throat cancer was killing me. How could this happen to me? I eat 90% organic. I consume no sugar. I have an active life style. I am doing everything right. Of course, 50 years of smoking cigars might have a great deal to do with it. Yes, I quit 15 years ago, but the damage had already been done. The slow build up of symptoms didn’t alert me to my situation until I had achieved a stage four squamous cell carcinoma at the base of my tongue. The tumor was so aggressive it grew out of the side of my throat.

That was a year ago. I followed the same protocol we prescribe for our patients, and now the cancer is gone. I contribute our success to a total life style change and Ozone therapy. Because injectable Ozone therapy is illegal

in this country, we

used in other countries to allow us to use it here at the Sentient Temple Healing Center. We have this therapy available here now

for only $30 a treatment. The

Therapy is miraculous. Transdermal Ozone, also known as Hyperthermic Ozone and Transcutaneous Ozone Therapy, is a method in which Ozone is introduced into the body via the skin while sitting in a hot steam cabinet. As the pores of the skin open as a result of being surrounded by the warm steam, Ozone enters the body transdermally (i.e. via the skin).

The Ozone then penetrates the blood, lymph and fat. By allowing Ozone in, and toxins out, via the sweating process that is induced, Transdermal Ozone Therapy is one of the most powerful methods of detoxifying and oxygenating the body in existence. This accounts for the effect that heat stress has in killing cancer. Both heat stress and Ozone kill cancer so this treatment offers the best

opportunity to eliminate cells which are

fermenting sugar anerobically, halt

metastasis and restore healthy aerobic

function.

Call the Sentient Temple Healing Center for your appointment

and evaluation. Lose weight, reduce pain, and cure

your cancer with proven methods usedin Europe and Mexico.

Before

YOU HAVE 4 MONTHS TO LIVE!

SE

N

TIENT TEMPL

E

CO

LL

EG

E OF ALTERNATIVE M

ED

ICIN

E

Call 727-323-2793, and save your life.WWW.MEDICALQIGONGFLORIDA.COM

$30 per treatment


Sam Belyea is a Nationally Certified Reflexologist specializing in chronic

pain and dis-ease.

“When the door to health seems closed, we can open a window through your feet. Jokingly my clients kept calling

me the Foot-Whisperer and it stuck. I would love to show you what your feet

have to say about your health.”

Massage Redefined, LLC 4707 Gandy Blvd. Suite 6

Tampa, FL 33611 813-831-9420

www.massageredefined.com [email protected]

MA#56213 MM#23019

Available Monday – Saturday 9am to 7pm by appointment only

Reflexology

300-‐hour Reflexology Training Program

Therapeutic Massage

Bodywork Coaching

Reiki Sessions & Instruction

Private Yoga Instruction

Massage Therapy CEUs

Workshops

It’s Your Life. Live It Well!


We currently have SICK CARE, not HEALTH CARE Last year Americans spent $2.8

trillion on healthcare. That is around $8,000 per person. So does this mean that we are all healthy and living well? Absolutely NOT! In fact, we lead the world in heart disease, obesity, and cancer. Astonishingly, 5 out of 6 Americans will be diagnosed with ei-ther heart disease or cancer. If we were spending the most money in healthcare and had the healthiest people, maybe it would be worth it. But we are spending the most money AND have the unhealthiest people. In a study by the Journal of the American Medi-cal Association, of 37 different developed coun-tries the United States ranked 37th (dead last) in terms of overall health of the population.

SO where are we spending all of this money?

When we are sick or in pain, we go to the doctor. We get prescriptions to help cure and prevent ill-ness and pain. What do we do when that medi-cation has a side effect or no longer works? We go back and get more medications for the next side effect. Americans take up 5% of the world’s population, yet we consume 85% of the world’s medications. You would think that if drugs make you healthy then we would be the healthiest na-tion, and that is far from the truth. We had 1.1 million people die last year because of drugs and these are not street drugs like heroin or other illegal drugs. These are prescription drugs that were prescribed for the right condition, the right amount, the right time. Prescriptions are not the only culprit, a large amount of that money is spent in nursing homes and cancer treatment centers. We have so many sick and ailing people in our population that we are seeing more and more long-term nursing fa-cilities. People may be living longer, but we are not living better. The focus needs to change. We cannot be okay with a health system that has no regard for health. It is time to take the focus off of SICK care and focus on health.

TAKE CHARGE OF YOUR HEALTH

A lot of people believe that genetics are to blame for the disease we see in our society today, but only 2-5% of degenerative illnesses are actually caused by genetics. So that leaves 95-98% of dis-ease that is caused by lifestyle. The foods we eat, the drinks we drink, and the habits we live are the main cause of the increase in disease. Our offices are focused on HEALTH care. We recognize that health is not just about what you eat and whether or not you exercise. Our of-fices implement maximized mind, maximized nutrition, maximized nerve supply, maximized

oxygen and lean muscle. We personalize each care plan and work with our patients to establish health and wellness goals that create a healthy lifestyle that maximizes each patients’ quality of life. We offer full health and wellness care that ex-cludes drugs, shots, and harmful combinations or both. Our goal is to make sure our patients live the healthiest life possible.

BUT WHAT TRULY SETS US APART FROM ALL OTHER WELLNESS CLINICS

It is our dedication to whole health wellness. Our patients are not just adjusted and sent on their way. We spend time focusing on spinal COR-RECTION not just spinal alignment. By pro-viding our patients with in office and at home stretching, strengthening, and lifestyle changes, our patients are the healthiest they can possibly be without introducing toxins. It is truly about balance and focus on health.

What does CORRECTIVE CARE mean?

If your spine and Central Nervous System are “abnormal,” there is a need for corrective chi-ropractic care. This type of care will restore “normal” spinal position and alignment. By properly restoring normal curves to the spine and aligning the vertebrae, it will eliminate in-terferences allowing your body to function and heal “normally.” This optimizes your chance to live at 100% of your body’s peak performance. A healthy spine will allow your body to express a normal body temperature, a normal blood pres-sure, and other measureable norms for the spine itself. There are four primary curves of the spine in the lateral (side) view of the spine. These curves give the spine strength, stability, and flexibility. Any loss of integrity of these curves can affect the function of the nervous system as this is the basis of evolution. These misalignments can put further stress on several aspects of the spine in-cluding the soft tissue structures, muscles, liga-ments and discs that support the spine and its normal function. Much like braces straighten teeth, it is our aim to restore the proper alignment of your spine. Recent research allows us to now know the mea-surements and proper alignment of your spine. There is a normal body temperature, a nor-mal blood pressure, and there are measureable norms for the spine. We take the necessary steps to restore the regions of abnormal alignment to normal through whole health wellness. Obtaining the level of normal alignment al-lows us to cure and prevent disease that other-wise leads to a lifetime of harmful shots and pills. Take the next step and allow your body to function at 100% of peak performance.

How Much Longer Will You Be Okay With SICK CARE!??!

With all of the changes in insurance, making your HEALTH CARE work for you is more important than ever.

Conforti Chiropractic &Wellness Center, Inc.Dr. Carl Conforti &Dr. Michael Turner

4040 Tampa Road, Oldsmar813.818.7499

Benttree ClinicDr. Damien Rogers and Dr. Michael Giaolousis

10935 N Dale Mabry Hwy, Tampa 813.969.2225

Conforti’s Crossroads Chiropractic

Dr. Todd Bodanza1811 Healthcare Drive Trinity

727.376.9611

New Tampa Chiropractic &Injury CenterDr. Bill Scheu

2312 Crestover Lane St. 102 Wesley Chapel813.994.6111

St. Pete Chiropractic &Injury Center

Dr. Ashley Heyward2206 4th Street N, St. Petersburg

727.822.6700

Palma Ceia Chiropractic &Wellness CenterDr. Dex Alvarez

1502 South MacDill Ave, Tampa813.251.0246

GIFT OF HEALTH $49 NEW PATIENT EVALUATIONIncludes exam, x-rays (if necessary), and

consultation with our team of doctors

$295 valueYou will receive a consultation with our

team of doctors to determine your path to health and wellness.

THE PATIENT & ANY OTHER PERSON RESPONSIBLE FOR PAYMENT HAS A RIGHT TO REFUSE TO PAY, CANCEL PAYMENT, OR BE REIM-BURSED FOR ANY PAYMENT OR ANY OTHER SERVICE, EXAMINA-TION, OR TREATMENT WHICH IS PERFORMED AS A RESULT OF AND WITHIN 72 HOURS OF RESPONDING TO THE FREE, DISCOUNTED, OR REDUCED FEE, SERVICE, EXAMINATION, OR TREATMENT

Dr. Carl Conforti, D.C.


© 2014 by Tampa Bay Wellness. All rights reserved. Tampa Bay Wellness is published monthly by KEM Media Group, LLC. It is distributed free thoughout Pinellas, Hillsbor-ough and southern Pasco counties to over 400 locations.

The information provided herein should not be construed as a health-care diagnosis, treatment regimen or any other prescribed health-care advice or instruction. The pub-lisher does not advise or recommend to its readers treatment or action with regard to matters relating to their health other than to suggest that readers consult appropriate health-care professionals in such matters. The publisher is not responsible for errors or omissions.

PublIshErKeith Matter

KEM Media Group, [email protected]

EdItor & AccouNt MANAGEr Katy Cox

813-501-4894 [email protected]

AccouNt MANAGErJeanne Jones

[email protected]

1936 Bruce B. Downs Blvd., #105 Wesley Chapel, FL 33544

(813) 501-4894 www.tampabaywellness.com

P u B L I s H E d s I n C E 1 9 8 6

Find us throughout the bay area, from st. Pete Beach to

north Tampa 21,000+ strong!

(813.949.1112

[email protected]

Get started today!

50% OFFyOur First bOx

promo code:

GOODLIVING

Fresh, Organic PrOduce delivered year-round• Customize your box with your favorite fruits and veggies

• Receive a box weekly or create your own delivery schedule

• No commitment or delivery fees and 100% guaranteed

Find us! Like us!

On Facebook!

Get Wellness updates!

1200 66th St North, Saint Petersburg www.MindofLight.net

(727) 417-0163

Holistic Practitioners Workshops, Groups, Classes Individual Sessions & Readings Books, Crystals, Sacred Art & Gifts

Harmony Metaphysical Church

2517 W. Henry Avenue, Tampa, FL

(813) 872-0295 WWW.IAMHARMONY.COM

Under New Management

PsychicFair

June 21st10a-4p

Rev. Sheila

Sunday Worship Service: 11a ~ Spiritual Healing & Meditation @ 10:30a Thur sday Message Service: 7p $10.00 Psychic Fair: Aug 2nd 10a-4p

Karla M. GutierrezMedium Clairvoyant Reiki Master

Do you want to communicate with a lovedone on the other side?

...Your bridge between the spiritual & physical world...

To schedule a reading or energy work call: (813) 340-1874or email: [email protected]

for more info on Karla please visit www.karla-gutierrez.comLocated in Tampa, FL

She can help you find the answers you need now.


Find us! Like us!

On Facebook!

Get Wellness updates!

PATHWAYS TO AWAKENING Center for Intuitive & Spiritual Studies

Intuitive Development

Bio: Rev. Marcella Zinner, MMA, Cht., ThM, is a Professional Intuitive Counselor, Past Life Regression Therapist, Spiritual Educator, Certified Hypnotherapist and Panel Psychic for the Edgar Cayce Foundation. Marcella specializes in helping others heal emotional and karmic struggles blocks and fears. Marcella has studied at many national Intuitive Development centers including the famed Arthur Findley College for Psychic and Mediumship research in England. She holds a Masters Degree in Theology and is currently a Doctoral candidate for Transpersonal Psychology and Theology at Holos University in Springfield Missouri. Marcella and her husband Charlie are the founders of Pathways to Awakening. Marcella has developed a series of products to uplift your energy and vibration. She can be reached at 727-785-8780 or [email protected] Visit her web page at www.marcellaz.com

5771 Roosevelt Blvd, #300Clearwater, FL 33760

[email protected]

www.marcellaz.com

Emotional Healing • Business ReadingsCareer Guidance • Relationship Issues

Health Issues • Past Life Regression

Rev. Marcella Zinner. MMA, ChT.Th. M

Healing

Oriental

Touch

Medicine

Guest Speaker - Saturday, March 9, 2013 at 3PM Nature’s Food Patch

Dr. Mary Riggin, LAc, AP, DAc, DOM Is your Thyroid Sluggish?

727-669-6000

We have Solutions!

“For a natural way to handle your hormone issues, our unique approach might be right for you.”

2 locations to serve youClearwater &

Palm Harbor (East Lake Rd. and Tampa Rd.)

www.HealingTouchOM.com

Dr. Mary Riggin, LAc, DAc, AP, DOM

Clinic Founder and DirectorRadio Host, Food is the First Medicine (FitFM)

President, FL Society for Doctors of Oriental Medicine

Mention this ad and receive an evaluation for only $29 ($150 value.)

Do suffer with:fatigue?brain fog?anxiety?hair loss?

loss of memory?bloating?stubborn weight?low sex drive?

Your thyroid might not be functioning as good as it could - even if your lab work is normal!

Swedish Massage General relaxation

Deep Tissue MassageA release of chronic tension

Chair MassageOpen up the back & neck muscles.

Pregnancy Massage Relieve the stresses associated with pregnancy.

Sports MassageStrokes and stretches for performance, etc.

Neuromuscular TherapySoft tissue manipulation

Hot Stone MassagePenetrating heat massage.

Couples MassageShare the experience.

ReikiAncient hands-on non-invasive healing system.

Thai Yoga MassageA unique experience.

AromatherapyEntice the senses.

Quick FixMaximize your time and health benefits.

www.relaxtampa.com

NO MEMBERSHIPREQUIREMENTS

MALE & FEMALETHERAPISTS

OPEN7 DAYS A WEEK

10025 N. Dale MabryTampa, FL

813-961-7306

SERVICES

Always Just

$3995

For ASwedish Massage

Call Now!For Your

NextMassage


newsbriefsDo You Suffer ChroniC...

BackPain

Do you live with any or all of the following?

• Back pain due to sciatica• Sleepless nights• Back or neck injury because of an

accident• Back or leg pain when seated.• numbness in your hands or toes• Degenerative Disc Disease

The good news is that if you suffer from any of the ailments above we can offer a new solution to your problems which

you previously believed you either had to live with or go through painful

surgeries to correct.

www.trinityDrX.comDr. Carl Comforti, D.C.

Contact the location nearest you:

PinellaS 813-749-8331

PaSCo 727-376-9611hillSBorough

813-969-2225

Holistic Workshop AcademyHelping Practitioners Grow Their Business Your potential clients need to know that what you offer will improve the quality of their life and they must trust that you are someone who can help solve their problems. One of the most effective ways to do this is by offering educational opportunities that address their concerns. This provides value and builds trust. As a holistic practitioner you have a great deal of wisdom. You excel at what you do and you want to help people. However, you may not possess the skills to organize and deliver your expertise in a way that effectively communicates your message and keeps clients coming back. Or, perhaps you are just starting out as a holistic practitioner and are looking to create a name for yourself and build credibility. Holistic Workshop Academy provides a roadmap for you to design, develop and deliver your own educational offerings. The program’s expert speakers share their tips and insights so you can avoid costly mistakes and gain from their years of experience. You are guided through the process of creating workshops to improve people’s lives and exceed your business goals. The program also provides the best techniques to fill your events including instruction on using social media and other technology to promote your offerings. You also get templates, checklists, and other resources that put you on the fast-track to growing your business. By the end of the program you will have launched your first successful workshop! Founder, Deserie Valloreo teaches and facilitates the Holistic Workshop Academy

program along with a host of expert speakers on topics ranging from “Best Practices for Teaching Adults” to “Overcoming Technology Hurdles”. Deserie has a Bachelor of Science in Information Systems Management and over 10 years of experience in developing educational programs combined with 6 years of delivering wellness workshops through her company, HerbalWise. Get details and register at HolisticWorkshopAcademy.com or email [email protected] •

HOLISTICWORKSHOPACADEMY

Give More Value

Get More ClientsBEGINS AUGUST 26TH

Register Now!HolisticWorkshopAcademy.com


newsbriefs

We Fix Your Health...Naturally

301 Turner Street, Clearwater, FL 33756 (727) 466-6789

www.lifeworkswellnesscenter.com

Are youready tofinally be aswell & healthy as youshould be?

Thai Yoga BodyworkAugust 15-17th | Friday, 7-9pm | Saturday & Sunday, 9:00am-6:00pm This workshop is open to all! Come learn the 1.5 hour sequence of Thai Yoga Bodywork with world renowned instructor Michael “Mukti” Buck. Nuad Borarn (Vedic Thai Massage or Assisted Yoga) is viewed as a martial art of healing and is reported to manifest instant positive results. In Thailand, bodywork is utilized medicinally as a cherished and revered indulgence to remedy the prominent social ailments such as emotional stress and physical inertia. Thai Yoga sessions inspire the soul and tranquilize the body. This course teaches a basic 1.5-hour sequence of Thai Yoga bodywork techniques. You’ll watch dem-onstrations, take notes in your manual, and then practice giving and receiving with various partners in the class. You will learn: •HowtoapplyabasicsequenceofThaiYogabodyworkasanasandtechniques,includingtransitions. •Howtousebreath,meditation,mantra,bandha,andyogictechniquestoenhancethequality of the session. •Tocomprehendthetheoriesofreleasingtheenergyonaphysical,emotional,andspirituallevel.Mukti (Michael Buck), the founder and director of the Vedic Conservatory, is celebrated as an accom-plishedinstructor’sinstructorintheartofThaiYogabodywork.His2007inductionintoTheWorldMassageFestivalHallofFamepraisedhismorethan14yearsofcontinuoustravelingandteaching,withnearlytenthousandpupilsin7countries.HeisagraduateofTheSwedishInstitute,TheOhashiInstitute,andThaischoolsITMandLekChaya.HereceivedinstructorcertificationfromtheAnmanInstituteandTheInternationalThaiTherayAssociation(I.T.T.A.). Mukti was an ordained Vaisnava monastic from 1976-1980,andtraveledincessantlyopeningmeditationcentersandsharinglessonsfromtheVedic classics with thousands of people. 18 credit hours (also CEC for NCBTMB & T.H.A.I.) (Elective Hours) Cost: $280 Call (813) 961-3160 or find us online at www.lotuspondyoga.com - The Lotus Pond Center for Yoga & Health 6201 Lynn rd. Tampa, FL 33625.


he tears are falling once more and it just took two glasses of wine to make it happen. I am on my way home to Florida from England, following a visit with my

daughter, Maiteland, and her two children. Next time I write a story on an airplane I will probably becomingbackfromvisitingtheminSpain. There’s no getting around it; no matter how many miles apart we live, my daughter’s life is definitelyenmeshedinmine.Herchildrenaremyheartbeatasmuchassheis.AndIjustleftthembehind… again. I was with my daughter and her kids in Englandforfifteendaysanditwaslikeridingamerry-go-roundtheentiretime.Or,tobemorehonest, a roller coaster, with emotions going round and round, up and down, and a little bit out of control. Asforme,I’musuallyastoicduringsuchsituations and I don’t break down until after the fact.ThatiswhereIamnow.“Afterthefact”andheading home, with a worried mind and an ach-ingheart.Andthewineisn’thelpingasmuchasI’d hoped. I try hard to stay strong. That’s just how I am; I want to be strong. I have been taught to depend on myself and that is what I do. But emotionally-charged situations can sometimes dredge up deep-seated memories and what my daughter is going through right now is like watching a rerun of my own life’s movie, roller coaster and all. Maiteland is the same age as me in my flash-back and, like me, is getting ready for a divorce. The breakup involves two small children and my heart is full of sorrow because I already know what this journey is like. I don’t tend to dwell on the past but, because this is my daughter, the memories come back in floods. Mygrandson,Joshua,isfiveyearsoldandBella, my granddaughter, is seventeen months.

WhenIdivorcedmysons’father,myboyswerenot as young as that. My older son was nine and my youngest was seven, almost eight. They were twenty-one months apart in age. That was one stage of my life; then after another nine years or so, I divorced my daughter’s father and left for Florida. Maiteland was four at the time and I was every bit of thirty-seven years old. That is the age of my daughter now… thirty-seven. The pain goes away but the memory does not. My life has taught me a lot and I feel I have come a long way but, even with a wealth of life experiences, I can help my daughter only so much. I can support her decisions and lend her some strength, but she needs to make the moves. Sheneedstodowhatshefeelsisbestforherselfand her two children. You know and I know that life is good, but sometimes things can get a little “crazy.” That’s a good word for all the confusion and challenges life brings and, of course, we worry about mak-ing the right decisions. In my spiritual training over the years, however, I’ve learned that there’s no such thing as a “wrong” decision; we just do exactly what we are supposed to do at the time. I sincerely believe that now, but I wish I had known that spiritual truth when I was younger. It would have lifted some of the heaviness from the load I felt I was carrying. My daughter knows the deci-sions she is making now are the correct ones for her so I stand back and allow. It’s all good. I feel fortunate about the fact that Maiteland and I can talk about these things and our discus-sionsoftenrevolvearoundspiritualsolutions.Wetalk about our dreams, our feelings, and what the Universe has in store for us. My heart hurts, knowingfirst-handjustwhatshe’sgoingthroughright now and I hope my life experiences can help her to get where she needs to go. I know my son-in-law is having problems with allthis,butItrytostayneutral.Heisagoodfather and I understand that he’d feel devas-

tated about being separated from his children. I know his love for Joshua and Bella is strong andI’mcertainhewillfightbackasmuchashecan. I wouldn’t want to be in his shoes… or my daughter’s so, to be fair, I will do everything in my power to stay neutral. Hopefullysomekindofpeacefulsolutionwillcome that makes sense for both of them. The twist, however, is that my daughter may be forced tomovebacktoSpainbecauseshehasbeendeniedresidencyinEngland.Sheandmyson-in-law have been separated for over six months now and that denial for residency is a blow for all involved. Visitation is not so easy when it’s across the English Channel. ThefirsttimeMaitelandandIwereinSpaintogether, she had a vision at a castle we visited. The vision was from a past life in which she was supposed to get married, but it did not transpire. The vision was so powerful that she started crying immediately and it took me a while to calm her down. I feel she has karma there that still needs to be resolved, not to mention that there is something aboutSpainthathasastrongholdonher.Ineight years of marriage she and her family went backandforthseveraltimes.SpaintoEngland,EnglandtoSpain.PerhapsthistimeshecangetgroundedandtrulyfindoutwhatSpainhastoofferher.IpersonallyloveSpain;theclimateis superb and the mountains and water views breath-taking. It’s like getting the best of both worlds. But,lifemovesondoesn’tit?Sometimesinconversation I’ll toss out the phrase “to be contin-ued” and that’s the situation with my daughter at this time. Because of our very close relationship, I’m sure it means the same thing for me. SoIsay,withalargemeasureofhopeandtrustthatallisinDivineOrder–staytuned,thisstoryisdefinitelygoingtobecontinued.•

To Be Continued by Janet Reynolds

Well, here I go again.

Rev. Janet M. Reynolds is a Certified Spirit Medium and ordained minister with a private practice in Tampa, FL. She specializes inpractical channeled guidance from the spirit world, through private intuitive consultations and group séance gatherings. She is a

graduate of the mediumship certification program of the College of Metaphysical Studies in Clearwater, FL and has also studied at the Arthur Finlay College in England. Janet was ordained as a minister through Harmony Church in Tampa. She is Certified in clinical hypnotherapy

and has obtained advanced instruction in hypnosis and past life regression at the Edgar Cayce Foundation in Virginia. She has studied medical intuition with Caroline Myss and Dr.Shealy and is a certified Reiki Master. Contact Janet at [email protected].

T


heGlotoSleepisauniquesleeptherapy mask device that helps people sleep better, naturally and effectively, by focusing the mind on the process

of relaxation and sleep, helping users to fall asleep quickly, stay asleep for the duration of the time desired and wake up feeling rested, whether for justanaporafullnight’ssleep.Worksanywhere,anytime whether at home or on the road, in

your own bed or on the train, in the airplane or in a hotel room. Resembling a lightweight and comfortablesleepmask,theGlotoSleeputilizesspecially designed lights inside the mask, called PointsofGlo,toslowbrainactivity,achieveanalpha wave brain state and engage deep, natural

Product Review

andrestorativesleep.ThePointsofGloalsoacttoeffectively block out all external light, prevent-ing it from interfering with the effect of the Glo toSleep,whilerecessedeyepiecesstillallowtheeyestoblinknormally.TheGlotoSleepisfullyadjustable and made from lightweight, non-toxic, hypoallergenic, breathable foam, making it com-fortable to wear for anyone for any period of time. Completely wireless and no batteries required.

ThePointsofGlosimplyneedtobeexposed to any light source (sun, light bulb,etc)forabout30secondstobecomeactivated. They then emit this absorbed light for before gradually fading over time. To use, just put on, look up into the eye piecesandholdagazeonthePointsofGlowhilebreathingdeeply.TheGlotoSleepthen rapidly slows the brain’s activity level to a deep relaxed state. Features brightness

anddimmingcontrol,from10minutedimmingrampdowntimeto30minutes.LookingupatthebluePointsofGlowillbethelastthingtheuserremembersuponawakening.100%money-backguaranteed.$39.99,sound-oasis.com.•

Tested by our staff to be comfortable and helpful - TBW

T

SUNDAY, AUGUST 17TH, 1-3PM• Kid-friendly snacks, activities, Hillsborough county f ire truck and more!

• First 100 children will receive a free, healthy sack lunch for the f irst day of school!

3802 NORTHDALE BLVD. • (813) 264-3600 • OPEN DAILY 8AM - 9PMWebsite: wholefoodsmarket.com/carrollwood facebook.com/wholefoodsmarketcarrollwood twitter.com/wfmcarrollwood

WHOLE FOODS MARKET® CARROLLWOOD

WHOLE FOODS MARKET CARROLLWOOD

BACK-TO-SCHOOL BASHBACK-TO-SCHOOL BASHWHOLE FOODS MARKET CARROLLWOOD®®

CHANNELED ACCELERATED REGRESSION HEALINGBE THE CHANGE!

Alchemist Healing - Eliminate traumas and un-desired presences from many lifetimes which still influence our present and future. Teletransportaion healing is a form of regres-sion therapy, which does not use hyponosis, in which the healer moves from one dimension to the other. It can slso be applied to homes and land.

Release Blocked Energy - from the physical, emotional and mental “bodies” which helps “forgivings and makes “light”.

Receive Cosmic Energy - as much as your heart desires. Cosmic Energy cleans, changes, heals and empowers.

Receive Channeled Guidance and Informa-tion on health and spiritual wealth. Personal and Teacher guides answer questions.

LIFE FORCE ACADEMYCall Jacques and Monika Thomet

(941) 741-8736www.lifeforceacademy.org

Visit OurWebsite


early a year ago, Karen Taylor decided to change the way she lived her life, both physically and mentally.Shewaslookingforalifestyle change that included eating

healthier, being active, and dedicating more time to relaxation, but could also easily be incorporated into her life as a business professional, wife, and motheroftwochildren.Shedidn’tknowwheretostart, until one afternoon a friend told her about agreatplacecalledEnergiaWellnessStudiothatoffered exactly what she was looking for. Karen regis-tered for their beginner classes and was immediately impressed with their small class sizes and friendly, certifiedstaff. Now, almost a year later, Karen still enjoys the luxury of small class sizes and individualized at-tention.AlthoughEnergiahasgrownfromasmallbusiness to a state-of-the-art total wellness studio, their commitment to personalized instruction has

remained steadfast. Energia is able to offer more classes, growing from only a handful when they openedlastOctober,toovertwentyinstructedcourses, including one-on-one personal training sessions, classes, guided meditation, yoga classes, Zumba classes, massage therapy and more. WithhelpfromVirnaLichter,theownerofthestudio, and her well-trained and professional staff, Karen has not only transformed her life, but that of herfamilyaswell.EnergiaWellnessStudioisdevot-ed to the idea of an active family. Their Family Yoga class offers an opportunity for adults and children to practice together, strengthening bonds between family members by emphasizing the importance of a support system. The Zumba Kids program promotes fitnesswhileremindingchildrenthatbeingactivecanbefun,andwiththeirnewActiveFamilySum-merPass,parentsandsiblingscangetinvolvedtoofor one affordable rate each month.

Thepasscomesina30-dayor60-daypackage,starting at $99, and truly encourages the family unit by offering additional family members to be added foronly$10.Italsoofferstheflexibilityofindividualtraining; the summer pass allows children to partici-pate in many of the kids classes, while parents are free to use the studio’s exercise equipment.

A Personal Touch The personal training program at Energia begins

with a complimentary consulta-tion,inordertodevelopfitnessgoals for the individual. Clients then begin a four-phase body transformation plan in which he or she moves through each phase once certain personalized objec-tives have been met. The purpose of the customized regimes, says Lichter, is to ensure that clients complete their wellness routines in a safe, enjoyable and effective program.“Wewantpeopletorespectthemselves,” Lichter insists. “They shouldn’t have to wait until theylose20lbs.tofeelbetterabout themselves. They should feel good about themselves today. Everyone progresses at a different

pace based on their physical abilities and personal goals.”Andyoucanfindevidenceofthiswithjustone glance at her eclectic classes and her variety of clients. Sophia,along-timeclient,reflects,“I’vebeengo-ing to Energia for awhile and it has been the best ex-perience that my mind and body have gone through. The atmosphere is peaceful and Virna, the owner and instructor, is very thoughtful and experienced. I haveenjoyedguidedmeditation,hathayoga,Stralayoga, gentle yoga and aromatherapy yoga. I’ve also taken some Zumba and yogalates. I’m really enjoy-ing my journey at Energia.”

What’s New at Energia This past summer, Virna and Energia offered, for thefirsttime,aYogaSummerProgramforkids.Of-feredtochildrenages5-12,thebasicsofyoga,medi-tation, healthy eating, and sustainability are taught

in a kid-friendly and fun environment. Each week is themed, while the most recent movie themeofHarryPotterresonateshighlywiththe children. The classes help build self discipline, coordination and balance, concentration, andmostimportantly,self-confidence. TheSummerCampatthebeginningofAugustalsofocusesonaBack-to-Schoolpositive self-image, dedicated to preparing

children for their return to classes by emphasizing self-assurance and character. “It’s important to start the year off right,” says Virna, “so we highlight the importanceofmentalstrengthandconfidencetoensure the kids are encouraged when returning to school.” The yoga and meditation classes help childrenstarttheschoolyearwithconfidenceinthemselves, ensuring they are more involved in class participation, as well as positively shaping their relationships with teachers and their classmates.

Everyone Can Be Healthy Lichter values ongoing education and was adamant that all of the dance, yoga and meditation instructors as well as the massage therapists should be well-educated and experienced in their respective fields.Takingtheirknowledgeandspreadingittothe community is something Energia takes very seri-ously. Energia will offer Free Yoga in the Lawn classes atTheShopsatWiregrassduringthemonthsofAugustandSeptemberfrom6:30-7:30pm.Thissummer, Virna has also held multiple Kid’s Club eventsinthemorningsatTheShopsatWiregrass.Kids participate in guided Yoga and Zumba classes as well as face painting, balloon art, healthy activities and more. Virna is able to share her dedication to wellness and a healthy lifestyle with the community by reach-ing out and partnering with local businesses to bring her passion and knowledge to those who need it, ratherthanwaitingforthemtofindher. EnergiaWellnessStudiohasseenmonumentalgrowth within only a year, and it is refreshing to see that their core values of mental and physical strength, and overall well-being are being shared with more individuals now than ever. The studio is locatedinSevenOaksat3836FlatironLoop,Suite101,WesleyChapel.Foradditionalinformationorto schedule an appoint-ment,visitEnergiaWell-nessStudio.com.Youalsocan “Like” their page on Facebook.com or call 813-973-7300tospeakdirectlytoVirna.•

businesss spotlight

N

Virna Lichter, Owner of Energia Wellness Studio


SALT ELEMENTS is located on Tyrone Blvd N between 38th and Park across from Sprint

3831 Tyrone Blvd North • St Petersburg, FL 33709 727-877-SALT (7258)

Closed on Monday • Tues.- Fri. 10-7pm • Sat. 10-5pm • Sunday 12-5pm

www.saltelements.comJo and Bill Mayfield, Owner/Manager • [email protected] • [email protected]

Don’t we all deserve to brea the easy? Introducing St Pete’s first All Natural, organic, drug-free, DRY Salt Therapy Center for Skin & respiratory issues. European Studies show Halotherapy successful in relieving the following: Acne

AsthmaAllergiesBronchitisColdsCoughCOPDCystic Fibrosis

Dry itchy skinDermatitisEar infectionsEmphysemaEczemaHay feverJet lag

• N A T U R E ’ S H E A L I N G H A N D •

August Specials! Ask us about our Halotherapy Specials for August!

FREE 1/2 pound of pink Himalayan salt

(med grind) with any lamp purchase of $40 or more!

8/8 Save the Date! FREE Tan FRiDay!

Aloe based, no chemicals. Appointments appreciated.

*Only pharmaceutical grade salt is used during the Halotherapy (dry salt therapy) session.

“Like A Tooth Brush for Your Lungs”

PsoriasisPneumoniaRespiratory infectionsRhinitis

Smokers coughSinusitisSnoringTonsillitisWheezing

Large seLection of products & beautifuL saLt Lamps avaiLabLe in aLL shapes & sizes

Gift CertifiCates and Gift baGs available


PART 2

Temple ofLOVE & HEALING

UCM Charter #759Psychic Fair1st Fri. Monthly5:30-9pm$12 eachMessage Circle3rd Fri. Montly$12, 7:30-9pm

Psychic Fair1st Sat. in Jan, Apr, Jul,

Oct, 10am-3pmHealing Share

Sundays, 1pm to 3pmReiki Healing

2nd & 3rd Sat, 7pmSun. & Wed. Healing & Worship Services 7-9pm

Weddings Memorial Services Baptisms Seminars3700 40th Ave. North, St. Petersburg, FL 33714

www.templeofloveandhealing.us (727)545-1122

n the last month’s article, I related stories about two men who received a healing from John of God. Both stories were what I call miracles but at the Casa of Dom Ignacio, they

were the result of spiritual surgeries per-formed by the Entities and John of God. Most surgeries at Casa Dom Ignacio are spiritualsurgeries–healingfromthespiri-tualdimension.However,ifyouvisitJohnof God, there is an opportunity to receive a visible surgery. This article is my eyewit-ness account of a visible surgery of a friend. The visible surgeries get most of the media attention results in sensationalism. There have been several documentaries about JohnofGodaswellastwoABCPrimetimeepisodes. Casa Guides say that all health prob-lems can be treated with spiritual surgeries. Visible surgeries, in contrast, are chosen by thepatient.Peoplearedrawntohavingavisible surgery for several reasons, includ-ing needing physical proof that ‘something happened.’AsmanyYouTubevideosdepict,visible surgeries are performed without local orgeneralanaesthesia.Painissaidtobeminimal or non-existent. If you choose a

physical surgery, John of God decides which typeofvisiblesurgeryyoureceive:scrapingthe eye with a knife, surgical scissors inserted deep into the nose, and incisions with a scalpel followed by stitches. Withthisbackground,Itelltherestofthe story. The week I met John of God, a smallgroupofyoungAustraliansarrivedatthePousadawhereIwasstaying.Withminutes they invited me to be part of their group and in particular, I became a good friend of the only man in the group. Like me, Richard was a bit sceptical but was nonethelessspirituallyoriented.Hedidnotcome with physical crisis, but wanted to feel closertoSpritorGod.Onemightdescribehis issue as a crisis of faith. Regardless, Richard and I became friends in the days preceding our meeting John of God. Rich-ardwantedavisiblesurgery–someproof,somethingtangible–eventhoughoCasaGuide said that visible surgeries may not be offered or he may not be selected to have one.Heradvicewastosethisexpectationsaccordingly. JohnofGodbeginsworkeveryWednes-day. The Casa becomes very busy on Wednesdayandpeoplestandinlinesfor

hours to meet John of God. John of God sees everyone who comes to the Casa, no matter how long it takes. OnthisparticularWednesday,Johnof God took the stage, incorporated, and offered physical surgeries. This was an unexpected event as the many people

had already entered the main healing room. John of God came to the stage, forcing the line to stop just as Richard was about to enter. I doubt it was a coincidence that Richardwasthefirsttowalkonstageandreceiveavisiblesurgery!AsIpassedJohnofGod, I witnessed John of God cutting into Richard’s chest with a scalpel. Richard did not flinch or show any sign of pain while being cut. Richard later said could feel being cut but felt no pain. The most pain, he said, was a result of the stiches, not the surgery. Asthepicture,takenaweekafterthesur-gery, shows it has mostly healed and was not infected. AfterRichardreturnedhome,Iemailedhim and asked what he got from the experi-ence.Hewrotemesayingthathisfaithwasrenewed; he realized that we are energy and ourbodyisonlytemporal,anditisourSpir-it is what makes us alive. In general, he said he feels more energized and happier. Richard also believes that we can heal ourselves with our mind. I had wonderful experiences, relishing the stories of miracles, the experiences of being there, and enjoying time with people I met.Personally,Ifeelmorespirituallyawareand the meditation experience while at the Casa is one of the most profound experi-ences I have ever had. The Casa of Dom Ignacio sits on a huge deposit of quartz crys-tals, clearly supporting the energy necessary forJohnofGodtodohiswork.• A great deal of information about John of God and his Crystal Healing Bed can be found on the Internet. To find out when the next film about John of God is being shown, call Crystal Corner’s at (813) 788-4999 or visit the website, http://www.crystalcornerinc.com.

John of God Performs Visible & Spiritual Surgeries By Cy ENgLER

I


• Inituitive Readings• Wedding Facilitator• Ceremonies• Unified ServicePrivate and Confidential

813.455.6209SacredLady.com

REV. Arianna

Intuitive Counselor Certified Spirit Medium www.bluefeather.net [email protected]

Rev. Janet M. ReynoldsNeed help untying the knots of life?I specialize in treating depression, anxiety, trauma, PTSD, grief and loss, co-dependency and life transitions.

Letha F. Miller, LCSWLicensed Clinical Social Worker

15310 Amberly Dr., Suite #250 • Tampa, Florida 33647813.777.1829

[email protected]

ear, in and of itself, is neither good nor bad. It is just one end of the emotional energetic spectrum

that humans have created and taught to each other. It is an energy that can be felt, smelled, tasted and the results of it can easily be seen. There was an overabundance of this energy created and passed around during the last few thousand years of the great cycle that has just ended12/21/12. Whilelivinginthisenergy,many of our life experiences have been fear based. Being human can

be very confusing. Fear of failure, fear of success, fear of being alone, fear of being with others, fear of not being loved, and fear of being loved.Allareimagescreatedbyus.Imagesare mental games we play with ourselves. Images are illusions.

Imagesdrivefear.Wecreateimages.Wecreatefear.Itisanenergythatpermeates everything and everyone. Weareasaccustomedtofearasafishistowater.Butthereareotherways to interpret life beyond using images. Ahumanisamixedsoupofavariety of aspects of consciousness. Someaspectsareintegrated,someare not. The unintegrated aspects are destructive and are hiding a gift that can only be revealed by personal work. That means honest introspec-tion, not only alone but with others appropriately trained in the clearing process. By benevolently connecting

with and absorbing the unintegrated parts of ourselves, we become more. Aswegrowbyclearing,wehavemore of “who we really are” available to us. Therein hides the gift we give to ourselves. Fear is the flashing neon light drawing our attention

to the gift. The price is no self-delusion,noself-pity.Whenweletgo of that part of ourselves holding onto the fear, a great deal of extra energy is released. It takes effort and life force to hold onto fear. In letting go that energy is available to help us feelmorealivethanever.Wehaveopened a new path on our journey.

To quote Yoda the800-year-oldJediMasterfromStarWars,“Fear is the path to the dark side. Fear leads

toanger.Angerleadstohate.Hateleads to suffering”. The suffering is self-inflicted and wasteful of life force.LongbeforetheStarWarsquote, “May the Force Be with you” therewasFrankHerbert’s“Dune”series wherein the Bene Gesserit sis-

terhood both aspired and conspired tocreatetheperfecthuman.Oneof the tools that they used was the “LitanyAgainstFear”.“Imustnotfear. Fear is the mind killer. Fear is the little death that brings total obliteration. I will face my fear. I will permit it to pass over me and through me, and when it has gone past I will turn the inner eye to see itspath.Wherefearhasgone,therewillbenothing.OnlyIwillremain.Face your fears or they will climb overyourback”.•

Tony at Crystal Corner Metaphysical Center

38925 County Road 54Zephyrhills, Fl. 33542

813-788-4999www.crystalcornerinc.com

F

“Fear is the path to the dark side. Fear leads to anger. Anger leads to hate. Hate leads to suffering”.


re you fully allowing your taste buds experi-ence the abundance of flavors, spices, herbs, and exotic sauces

and condiments with your meals? I think of them as food accesso-ries.Steamedbroccoliisthemain‘body’, and balsamic glaze with sesame seeds serve as the accessories of this broccoli ‘body’☺. Gotta love my food analogies, what can I say, I love to play with my food and myCSI-mind,sothismakesforamemorable kind of read! Read on and be in Joy!

I had my share of travel and per-sonal observations on eating habits, including my own. I observed folks oftenreachforthesame:ketchup,mayonnaise, BBQ sauce, mus-tard, salt, pepper, garlic, parmesan cheese, hot sauce, etc. You get the idea!Whileinsomepartsofthisabundant world, it’s customary to serve fermented or pickled starters such as marinated olives, pickled, or fermented vegetables like Kimchee. These little starters aid of balancing your gut with various elements such as enzymes needed for breakdown and digestion of the

Do you have your senses tuned in & buds joyful

foodyoueat.Addingsomeoftheseitems to your dishes might just spice up and saucy up your buds to joy, andsensestobliss.AccordingtoAyurvedateachings,themoretastesyoucanfitinonebite,thebetteritis for you holistically and wholisti-cally. Life is really all about balance, eveninspiceandsauceworld.Andwhile we on this subject, let’s review majorleagueplayersfirst. Ketchup–conventionaltypescontaincornsyrup.SwitchtoOr-ganic.Don’tbefooledbyNoHighFructoseCornSyruporSugarFreelabels. Read the ingredients list! Bet-

teryet,addyourowntomato(PicodeGallo)sauceorSalsa(seerecipe). Mayonnaise–Bynow,youall know about hydrogenated oils. If youstillpurchaseHellmann’s,evenCholesterol-free one, please stop! Yes, you can certainly make your ownmayo,butyousay:Who’sgottime for that?!! I hear you, so here isthebetteroptiontouse:Soy-FreeVEGENAISE.Greathealthyalter-native to mayo is mashed avocado. Somebrandshavecleanhorseradishsauces that offer quite a bite, which you can mix with avocado. Mustard–honey,Dijon,and

all the rest… are all serve a common purpose to moisten your food and toadd“flavor”.Sameasketchup,lookattheingredientslist.Avoidsugarandartificialstuff,andwatchout for “Natural flavor” ingredi-ent,asitcanbethesameasMSG(monosodium glutamate). Better yet, change things up a bit. Parmesan Cheese–Probablythemostoverusedfakefoodonthetable.Whatkindof cheese is this that sprinkles in powder form from a container that sits on the shelf without need for refrigeration? Think about that one

for a moment. I have been using Nutritional Yeast for over 3 years now as my substitute to little flakes on salads, in my dressings and even Mac N’Cheese. Nutritional Yeast is not the same as baker’s yeast. It is in RAWFoodcategoryitems,superfood, loaded with B vitamins. Hot sauces–PleasechecktheingredientslistasMGS(naturalflavors) is a common ingredient in most. It really should have only three ingredients (for the most part):peppers,vinegaroracidofsome sort, and salt. It’s the variety of peppers used that give it a distinct

flavor. Salt–IhaddayswhereIdidn’tsalt my food at all, knowing that I get enough of salt from other sources. It’s not avoidance; it’s about balance and moderation. I only use SeaSaltandHimalayanPinkSalt,andonlyapinch.Saltbringsouttheflavors in other veggies by drawing out their water. It’s not necessary to measure by teaspoon, a little pinch willbeenough.Saltisbetterforbath! Black Pepper –Oh,howIused to reach for black pepper before I even tasted my food. I thought I was doing better than those who reachedforsalt,withouttastingfirst.Well,blackpepperisnoevil,butmoderation is the key. It is acidic, so use mindfully. If using black pepper, get the peppercorns kind. I use red peppersinceithasaddedbenefits. Dry spices and fresh herbs add such a dynamic to any dish. Many, however, only rely on a few very common such as parsley, basil, mint, oregano.Experiment,People!It’syourlife,makeitYOURadventure! Dried spices – tip: the smaller the container the better. Rotate your product, so it does not go rancid and change things up often. There is no need to buy every single spice there is, but have your Regionalbasicsonhand.Herearesome more common Blends to aid youinyourlife’stastyadventures: Italian – Oregano, Basil, Thyme, Garlic Powder. AddNu-tritional Yeast to pasta and sauces. Freshherbs:Can’toverdoanItaliandishwithParsley!Basiliscommonlyused too with tomatoes. Garnish your dish with fresh herbs at the time of serving, the steam carries it to your nose for sensory stimulation. Be present while you are eating, utilize all senses. Greek/Mediterranean – Oreg-ano, Tarragon, Thyme, Fennel. AddCapers,BigGreenOlivesorKalamataOlivestostews,sauces,

? A

by Sophia Zayman


© 2013 CSTPA. All Rights Reserved. OCA, OXFORD CAPACITY ANALYSIS and SCIENTOLOGY are trademarks and service marks owned by Religious Technology Center and are used with its permission. Services relating to Scientology religious philosophy are deliv-ered throughout the world exclusively by licensees of the Church of Scientology International with the permission of Religious Technology Center, holder of the SCIENTOLOGY and DIANETICS trademarks. Printed in USA.

www.energiawellnessstudio.com (813) 973-7300 3836 Flatiron Loop, Suite 101 • Wesley Chapel, Florida 33544

Located in Seven Oaks

THE PLACE TO TRANSFORM YOUR MIND AND BODY

YOGAMEDITATIONPILATESMASSAGEPERSONAL TRAININGGROUP FITNESSAROMATHERAPYKID’S CLASSES

Sophie’s Fresh Tomato Fresca (all organic ingredients recommended)

• 3-4RipeTomatoes,smalldice(and de-seeded, if you have time for that. You may want to try it with Mango, instead of tomatoes)• 1smallredonion,smalldice(orVidalia/sweetonion)• 2clovesofgarlic,minced(lessifyouchooseto)• 2-3freshjalapenos,deseeded,smalldiced (you might need to protect your hands with food safe gloves when working with hot peppers. As far as quantity, you can always taste to see if you need to add more)• APinchofBlackPepperandapinchofSeaSaltofHimalayanPinksalt• 2TBSPofCoconutAminos• 1tspofCoconutsugar• ½tspofSmokedPaprika• ¼tspofRedPepperflakesorredpepper(heattoyourliking)• 2tbspofLimeJuice• Garnishwithfreshcilantro(chopped,lightly)foraddedbenefitsandstrongerflavor

Creamy Salad DressingInablender,mixthefollowingingredients• 2tbspofsesameoil• 2tbspofTahini(sesamebutterusedinHummus)• 3clovesofmincedgarlic• 1tbspofapplecidervinger• ½tspoflemonjuice• ½tspofcoconutaminos• 2tbspofNutritionalYeast

Add water if too thick, or add more oil. This is just the base, you can jazz it up with basil and lemon for a pesto kind of dressing, or oregano with some olives blended for a more of a Greek style dressing. You can travel the world in your own kitchen with flavors, spices, and sauces. Possibilities are infinite, be creative!

and tables. Fresh Herbs: Oregano, Cilantro, and Basil forsomedishes.Someyogurt based salads use fresh dill as well and fennel. Mediterranean – Cumin, Coriander, Paprika, Chili Powder, and Bay Leaf,cinnamontoo.Addchick pea spreads like hummus, red pepper and eggplant spreads, mari-natedand/orpickledveggiessuchas

cauliflower, cabbage, raw sauerkraut. Fresh Herbs: Parsley, Cilantro. Asian – Ginger, Garlic, Lemon-grass, Garlic, Rice vinegar.Addcoconut-aminos instead of soy sauce,orlookforOrganic/NonGMOsoysauce.AddKimchee,horseradish, scallions as garnish. Use sesame oil for cooking in medium temperature for a deeper flavor. Indian – Turmeric, Cumin, Co-

riander, Mustard, Chili Powder. If you are not using Turmeric, you can certainly start at any time. It adds color to the food, a golden hue of yellow.Startwith1/8tspandbuildup from there. In small quantities, it’s virtually tasteless, but in large quantities it becomes bitter. You will findyourbalancewhenyoustartadding this highly medicinal spice to your food. To the list under Indian

blend, if you add lemongrass, ginger or cardamom, you basically make Thai cuisine with a little bit of raw coconut milk and some chili pep-pers. Cajun – Cayenne, Paprika, Oregano, Thyme, Mustard. Addsmoked paprika for extra flavorful punch.Anysalsatypeofsidedishwill work, or avocado based spreads anddips.•


hedictionarydefinesfearas:astate,feelingorconditionofalarm or dread caused by the expectation of danger, pain, disaster or the like. Weallexperiencefear.Fearcanprotectusfromthethreats in our surroundings, and has helped us survive as a

species, but it can also stop our progress and make it harder for us to discover and understand new things, encouraging rejection, closed mindedness, and inhibiting our personal and professional growth. IlovethisquotefromBusinessCoachandpublicspeakerJoeTye:Givefearaname,anditmerelybecomesaproblem.Aproblemcanbesolved.Oncewe identify our fears and give them a name, we can start paying attention in those areas or realms, work on solutions and use fear to help us evolve. Below are the 6 most common fears humans experience and practical steps you can take to overcome them. Fear of Failure - This fear deserves the top spot because it rules over allouractionsanddecisions.Wealldo,anddon’tdo,thingsinordertoavoidfailure.Failurecanbealotofthings:realizingyoudon’tliveyourlifethewayyouwantedto,notsucceedinginyourplans,findingyourselfhelpless,orinthe worst cases even hitting rock-bottom. Failure is a very ambiguous and subjective term because failure is not on the same level and perspective to everyone, what counts as failure to one might not be even halfway there to another. To some, failure is actually a way to learn lessons and try again, so it is not really an end, but a tool for future reference. The main fear of failing comes with the disappointment that follows, that feeling that despite your effort, nothing seemed to go as you wished it did, and itcausesafeelingsuchthatyoumightnotevenwanttotryagain.Oneofthemostcommonbehaviorsassociatedwiththisfearisprocrastination:haveyoubeen thinking about losing weight, exercising or cleaning out that garage for months?Years?Myadviceisthis.Startinsmallstepsandsmalltimeincre-ments. The smaller the commitment, the less chances of failure there are, and foreverystepyoudoreach,itwillboostyourconfidencetogotothenextone. Fear of Pain –Mostofusareintoleranttoorafraidofphysicalpain.This can be noted in the fact that there are a great amount of medications related to pain relief. The rejection of pain is caused because we associate physi-cal pain with illness and bad health, in general. Let’s face it, pain is not a good sensation, and like animals do, we tend to keep away from that which causes us pain, as it is one of the key elements in

Fear & Personal Growthsurvival instinct, as well as the way our brain tells us that there is something wrong with a certain part of our body or that the action we are doing is caus-ing a negative effect on it. In this case pain in itself is not a bad thing, but a way to let us know that we must stop doing what we are doing to avoid further damage to our body.

If you have chronic pain, don’t mask it with a pill. Rather, seek help from a chiropractor, an acupuncturist or a nutritionist who can help you identify “why” you have pain, and provide recommendations and natural remedies to repair the cause of the problem. Fear of Public Speaking –Thisfearisrelatedtothefearofgetting bad criticism, and is also caused by our social fear of not projecting a goodenoughimageofourselvestoothers.Weallhavefeltitatleastonceinourlives,havingtospeakorperforminfrontofanaudience.Wefearthatwemight mess up and cause the audience to respond negatively, either by mock-ing us with laughter or, in the worst cases, booing. Even though some people practice hard enough to not feel stage fright, orhaveawell-builtself-confidencethathelpsdealwiththeeffectsofbeinglaughed at or criticized, the fear of public performance never really leaves us because we don’t like the feeling of being in the spotlight for a negative reason, and being at the mercy of the opinions of others. I’ve been a teacher, public speaker for many years, and more recently, a radioshowhost.ThisiswhatIdobeforeeachpresentationtokeepmycool:I prepare, rehearse, practice, take time to breathe and remind myself that my presentations are not about me, but about my message. Fear of Rejection - This social fear is one of the main reasons peopleactthewaytheydo.Wetendto(sometimesblindly)followtheactionsofothers,becauseithelpsusavoiddealingwithrejectionfromthesociety.We

T

Spoil Me Bath & Body ShopEnter TBWELL at checkout on the website, AND get FREE shipping for $15 or more

in the US!

All Organic Bath, Body, Skin Care & Spa Products!Created Personally & Fresh Upon Ordering!An array of Spa Body Scrubs, Salt Glows, Spa Facial Therapies, Lotions & More! Available in over 200 Essential Oil Scents that are close to TOO strong & Last! Created by a Small Florida-Owned Business!

ORDER OVER THE PHONE & REQUEST A CATALOG BY EMAIL OR PRINT

Shop online! Easy & Secure Checkout!www.spoilmebath.com

1.888.623.5543 - Press #2


Isabelle M. Simon, M.A., C.N.Board Certified Holistic

Health PractitionerCertified Nutritionist & Wellness Consultant

ASNH Course Director - NutritionAmerican School of Natural Health

Tel/Fax: 813-445-4202www.asnh.us

Cleanse, Detox, Renew...ReClaim YouR HealtH natuRallY!

L.I.B.B.E. Open Colonic SystemLymphatic Decongestive Therapy (XP2 Technology)

Cranio Somatic Therapy - Pain Relief, TraumaIris Baulac, LMT • by Appt. 813.309.3039

Lakeland, Florida • oasisnaturaltherapies.com MA46891/MM18663Natural Therapies, Inc.

Fear & Personal Growthfear rejection because, like the fear of being alone, most of us can only justify our existence through the acknowledgement and acceptance of others. There are people who argue that acceptance from society is a mere illusion, and that there is no such thing as “normal” behavior from an individual within asociety–ifthisisthecase,thenwhydowefearnotbehaving“correctly”and in accordance with the cultural norms? This really puts into perspective our whole ethical infrastructure as a society- is something really good or bad justbecausesocietysaysso?Myruleofthumbisthis:believeinyourself,beauthentic, true to your values and respectful of others. Just because you may sayordosomethingthatisoutsidethecommonbeliefsornorm,doesNOTmakeyouwrong.Thinkaboutthis:Aristotlewasconsideredalunaticbecausehe claimed that the Earth was round, when the rest of the population believed it was flat. Fear of Loneliness - The fear of being alone is that dreadful feel-ing of emptiness caused by the absence of interaction with another human be-ing.Thisfearhasalsoevolvedfromoneofourearlysurvivalinstincts:wefearloneliness because it is more likely that we would survive if we live in group. The fear of loneliness is related to doing something and no one noticing. Weoftenfeelthatinorderforouractionstobemeaningful,someonehastonotice them. This relates to the philosophy quote “If a tree falls in a forest and no one is around to hear it, does it make a sound?” If you make a ground-breakingdiscoverybutnooneelseeverfindsaboutit,doesitstillcount? Fear of Death - This fear is not no. 1, because, even though it is the main reason our instincts tell us to act the way we do, it is a well-known truth that we all in the end will kick the bucket. But that doesn’t mean we have death as our worst everyday worry, because we avoid the thought of it as a near future occurrence in our lives. The fear of death is tightly tied to the fear of the unknown; we don’t know for sure what will happen to us when we leave this world. In fact, we are so interested in death that we have even developed whole cultures and religious beliefs that have tried to give an explanation to death since the beginning of time.Almostallancientcivilizationshaveagodlyformoramethodofwor-shiping death in some way, and we’ve all learned to respect it and eventually accept it. Free from Fear - My favorite technique to address my fears is the Emotional Freedom Technique (EFT), which is a form of energy psychology. Bygentlytappingyourfingersoncertainspotsonyourfaceandbody,youcaninduce an energetic and cognitive shift, which helps reframe the problem. By seeing the problem from a new angle, you will often experience new insight. These energetic movements can open new pathways for healing, without spending hours rehashing the past. Following a cognitive shift, you often feel less guilt and self-blame, more hope, or a simple sense of relief in an area where you’ve never felt relief before. EFT can be used to treat deep limiting beliefs, fears of the future, fear of success, fear of failure, anxiety about expectations, poorbodyimageandanythingelseyoucanthinkof.•

by Isabelle M. Simon, M.A., C.N.

Eve TorresLymphatic Specialist

Colonic HydrotherapistReiki Master

Garden of Eve specializes in colon hydrotherapy, lymphatic massage

and energy work.

(#MA56685)

Helping people make lifestyle changes with

therapies and products that create a healthy

home & body

Call 727-748-9017 to schedule your appointment.

Nyree Abdool D.O.1501 S. Pinellas Ave. Suite P • Tarpon Springs, FL 34689

(727) 940 [email protected] • www.doctor-nyree.com

Mention this ad and receive a

FREE30 Minute Infrared Sauna Session

HOLISTIC OSTEOPATHIC MEDICINEFOR THE TREATMENT OF

Neurological Disorders • Hypertension • Hormonal Imbalances • DiabetesFibromyalgia • Infections • Cardiovascular Disease • Depression • Anxiety

Bowel disorders • Allergies • Arthritis • ADD/ADHD

TREATMENTSHomeopathy • Medical Acupuncture • Allergy Elimination

Anti-aging Medicine • Weightloss & DetoxificationOral & IV Nutrition


n2007,Dr.ShilpaP.Saxenarealizedthat time had come for the practice of medicine to change when she launchedtheSevaMedInstitute.From the moment you step into the lobby, you realize this is not your typicaldoctor’soffice.Nationally-recognized as an expert in Integra-tive and Functional Medicine, Dr. Saxenasetouttocreateoneofthe

mostinnovativeexperiencesinhealthcare.Withthe commitment to create a true partnership with each of her patient members, she provides

a personalized health strategy that seeks out and uncovers the earliest signs of disease and focuses onhowtogetandstayhealthy.“Whenwefocusonthepersonfirst,andnotthedisease,we’reableto personalize the level of care far beyond the typi-calmedicaloffice. Dr.ShilpaP.Saxena,M.Dfeelsherpas-

cover story

sion and purpose has come to life through her experience with education and patient empower-ment.SheisaBoardCertifiedFamilyPracticephysician and makes it her personal goal to attain extraordinary life outcomes for her members and community.Dr.SaxenagraduatedfromtheUni-versity of Florida College of Medicine through the prestigiousJuniorHonorsMedicalProgram,thencompletingherFamilyPracticeresidencytrainingatSt.Vincent’sMedicalCenterinJacksonville,Florida.Withover15yearsofprogressivepatientcare,shehasappliedhercoreprincipalof“Pa-tientsPoweredbyKnowledge”toreversedisease. “Whenyouidentifythecauseofthesignsand symptoms of disease, you eliminate not only the signs and symptoms, but the disease itself.”, shesays.Sheisatrueprofessionalwhosewarmheartisveryevident.Workingside-by-sideforthelastfouryearsisJeanneLufkin,A.R.N.P.JeanneisanIntegrativeAdvancedRegisteredNursePractitionerwhocompletedhereducationandtrainingattheUniversityofSouthFloridaCollegeofNursing.Withover9yearsasaNursePractitioner,Jeannebringsextensiveexperienceinmedical technology, emergency room, intensive cardiacandsurgicalcriticalcaretoSevaMed.Shespecializes in women’s health including endocrine disorders, such as thyroid, adrenal and hormone imbalance and dysfunction, as well as advanced cardiovascular testing and lifestyle interventions and nutrition. TheSevaMedphilosophyissimple…seekout the root cause of disease, and then educate people so that they understand exactly the steps theyneedtomaketohelpthemselves.When

asked about how this type of care is different Dr.Saxenasays,“Typi-cal health care consists of short 15-minute visits, impersonal care, standard diagnostic testing, overuse of prescription medica-tion, and the treatment of symptoms without regard for the root cause of the disease. By contrast, our visits average45minutesandevery member receives a completely individu-

alized care plan based on advanced testing and prudentuseofmedication.We’redoinggreatthings for our patients and the entire community bytakingthepaththatputspatientsfirst.”. In2009,Dr.SaxenaalsolaunchedLivin-gWellnessUniversity.com,anonline,videoeduca-tion website where her patients can go to learn even more about their health conditions from an integrative and functional medical perspective. Priortoanofficevisit,it’scommonformembersto be asked to watch one or more of the videos as homework.Whenaskedaboutthevisionbehindtheeducationalwebsite,Dr.Saxenasaid,“Whenpatients come to their appointments with a strong understanding of their issues, the visit is more col-laborative and medical decisions are made in an informed,educatedmanner.Weknowthatbettereducated patients make better decisions about their healthcare”. Patientsnolongerfeelthattheyhavetomakeon-the-spot decisions with too little information, only later to be left contemplating about whether

theymadetherightchoiceornot.Patientsalsoenjoy the ability to create well-prepared questions and concerns, and always have the ability to go above and beyond with their education at home, without the limitations of appointment time, insuranceandfinancesrelatedtomultipledoctors’visits.Dr.Saxenahaslearnedthatpeoplearelesscommitted to following through on their deci-sionsiftheyarenotconfidenttheyarethebestones. TheSevaMedInstituteseespatientsfromall walks of life and of all ages. Members include families, executives, athletes, children, unhealthy folks looking to get better and healthy people

SevaMedInstitute

I


Crystal Corner

813.788.499938925 CR 54 • ZephyRhills, fl 33542

stones • jewelry • incense oils • wind chimes

figurines • drums greeting cards • candles

books • CDs • sagepsychic readings • classes • sarongs and much, much more!

looking to stay that way. They treat everything from a sinus infections, weight loss, women’s health to chronic diseases like diabetes, thyroid disorders, autoimmunity and heart disease. Dr. Saxenareferstoitasthewalkingunwell.“Manypeople live their lives not feeling well, but don’t realizethesearesignsofillness.Wehelpfindthereason for not feeling well then implement diet, nutrition, exercise and other lifestyle changes”, Dr.Saxenaadds. “I was astounded to learn that my fatigue was just a sign of a brewing health issue. I thought I was tired all the time because I’m a business owner, active in the community and an energetic family guy. I never considered myself to be unhealthy and am thankful to address the root

cause of my problem.” says long-time member, Jonathan Moore. Unlike a traditional doctorsoffice,thelobbyserves as a ‘teaching kitchen’ and meeting space where anyone in the community can go to experience ‘hands-on’ healthy living and learn together. They offer a variety of classes includ-ing cooking, nutrition, new trends in medicine and advanced technolo-gies. It is clear that this team walks the walk and

excels at making wellness a one-stop shop offering all you need for a healthy lifestyle under just one roof.There’salsoagroupfitnesscenterwheredaily small group personal training sessions and yoga round out the optimal lifestyle. The patient rooms are warm and comfortable without a ster-ile,doctor’sofficefeel.Infact,youcouldeasilymistake some of the rooms for a spa or resort. TheSevaMedInstituteacceptsinsurancefordoctorvisits,labsandtesting.Alladditionalservices related to their integrative and functional expertise are covered as part of the practice’s membership-based plan that includes extended appointment times, innovative technol-ogytesting,Skypeandphone visits, nutrition andfitnesscoachingaswell as member only events.•SevaMed is located at 19105 US Hwy 41 N Suite, Lutz FL 33549. They can be reached at 813-269-2700. They welcome you to come check out their beauti-ful facility, meet their friendly, knowledge-able staff and perhaps even attend one of the many community events offered monthly. Learn more at www.SevaMedInstitute.com.☺ ☺

Dr. Shilpa P. Sexana, M.D.

Jeanne Lufkin, A.R.N.P.


drenal Fatigue (“AF”)issomewhatundiagnosed by physician and is considereda21stcentury syndrome. Whenoneendo-

crine gland is taxed, the entire endocrine system can be off causing thyroid and sex hormones (estrogen, progesterone, testosterone) to also be low. This is how AFoftengetsmisdiagnosed.Symptomsare treated instead of the underlying cause.Adrenalsglandsaretaxedwhenstress is a constant factor, through lack of sleepand/orlackofnutrients.Welivein a world of no rest is best and the more youcan“do”thebetteryouare.Wenolonger get support from our families or tribes and try to do it all within our ownfamilyunit.Overexercisingmaymake symptoms worse. Instead, try yoga,walkingandbreathing/meditationexercises. The adrenals are most known as the stress busters who regulate the flight or fightresponse.However,theadrenalsalso regulate blood pressure, blood sugar and take over for the ovaries after meno-pause. Mothers and fathers most often sufferfromAFastheydoalotoflatenight parenting and their body begins to run in reverse (awake during night and sleepyduringtheday).MostoftenAFisa dis-ease that you can self diagnose and heal through a certain protocol. You may however want to get saliva testing to truly check them. Remember it took years to deplete your adrenals and it may take time to bring them back. Getting sound, solid sleep is a high priority. Alsomostofusliveinafear-basedworld, which is a fear of the future. This can also trigger insomnia and restless sleep while your mind spins at night. Whenwehave“faith”thateverythingwill be okay, we live in the moment and aren’t on guard all the time. Encourag-ing a spiritual practice and belief in something greater than ourselves looking out for us is most helpful. If you suffer from sleepless nights--maybe you wake between 1am and 3am--this could also be because your blood sugar levels are low. This is often the case if you have panic attacks, night-maresorsleepfitfullybetween1-4am.Eat a high-protein snack before bed. Both too high and too low nighttime cortisol levels can cause sleep distur-bances.

WHAT IS ADRENAL FATIGUE?By Rev. Maggie Batt • www.wheelsoflight.org

SIGNS OF ADRENAL FATIGUE 1.Difficultygettingupinthemorning.Can’tliftheadoffofpillow. 2.Continuefatiguenotrelieve by sleep. 3.Cravingforsaltorsaltyfoods. 4.Lethargy(lackofenergy). Everythingseemslikeachore. 5. Increased effort to do every da tasks.Seems10xharder. 6.Decreasedsexdrive. 7.Decreasedabilitytohandlestress. 8. Increased time to recover from illness,injuryortrauma. 9.Light-headedwhenstandingup quickly. 10.IncreasedPMS. 11.Symptomsincreaseifmeals areskippedorinadequate. 12.Thoughtslessfocused, more fuzzy. 13.Memorylessaccurate. 14.Decreasedtolerance. Peopleseemmoreirritating. 15.Don’treallywakeupuntil10am. 16.Afternoonlowbetween3-4pm. 17.Feelbetteraftereveningmeal. 18.Decreasedproductivity.

HEALING ADRENAL FATIGUE• Be in bed before 10pm.

• Sleep in until 9am whenever possible.

• Look for things that make you laugh.• Eliminate the energy robbers

(people, situation & things)• Make your lifestyle a healing one.

• Do something pleasurable every day.• Whenever you are not enjoying your life,

go back and make lists of what may be draining to you.

• Be grateful everyday for some small thing.

• Take your dietary supplements regularly - B complex (with panthothenic acid), adrenal glandular, magnesium, Vit C.

EFA’s, D3).• Move your body and breathe deeply.

• Believe in your ability to recover.• Use your mind as a powerful healing tool.

• Keep a journal each day.• Eat the foods your body needs: protein,

fat and good carb at each meal.• Learn which foods make you feel bad and

keep a list.• Get the Adrenal Fatigue book.

• Drink in the am, ½ tsp of good sea salt in warm water each morning. *

• Salt your food, salt your water.• No fruit, unless you have something with

salt before or after the fruit and chew very well. **

• Eat whole foods close to nature (unprocessed).

• Eat lots of colored vegetables.• Chew your food well.

• Take your health into your own hands.• Laugh several times per day.

• Enjoy your recovery.• For deep sleep, consider melatonin or

another natural sleep aid.

• Avoid exercising or taking awake vita-mins (B’s, glandular) in the evening. You

want to wind down at this time.• Take 1,000 mg. of Vitamin C with 200

mg. magnesium and pantothenic acid at approx. 2pm every day along with a small

snack in order to help avoid the 3-4pm low.

* If the salt is making you feel better, continue to do it. On mornings when you exercise fully, you may not want as much salt. Be mindful of your cravings for salt and potassium containing foods during the day. These desires may serve as indicators of adrenal function during the day. Use only a good quality sea salt. ** Most who suffer from hypoadrenia (adrenal fatigue) are also hypoglycemic. High glycemic foods like fruits and sugars may exacer-bate your symptoms. Eat frequent meals to keep blood sugar level.

THINGS TO AVOID •Gettingovertired• Caffeine,sugar,alcoholand white flour products• Coffee,evendecaf• Stayinguppast11pm• Pushingyourself• Energysuckers• Beingharshornegative with yourself

• Foodsyouareaddictedto• Foodsyoususpectanallergy or sensitivity• Feelingsorryforyourself• Foodsthatmakeyoufeelworse, cloud your thinking or pull you down in any way• Neverskipbreakfast• Avoidfruitinthemorning• Nevereatstarchycarbsby themselves• Donoteatfoodsthatadversely affect you in any way, no matter how good they taste or how much you crave them.

Source: Adrenal Fatigue: The 21st Century Stress Syndrome by James L. Wilson

Maggie Batt is an Earth Momma of three homeschooled children. She teaches workshops and yoga in Tampa, Florida and offers online training & FREE newsletters,

healing requests and articles. Learn more about her at www.wheelsoflight.org.

A


ourage is our guide to help us move throughdifficultyandchallengesthat

wefacethatbringupfearwithinus.WEmaybeafraid to speak, express ourselves in every way. . Selfexpressioncomesinavarietyofformsbeyondspeaking such as body language, gestures, and eye movements, how we are being and acting also suggests communication. The courage to com-municate who and where we are in the moment brings up trigger points such as fear in the form of thoughts and feelings. OneofmycourageousexperienceswhenIheart began to beat harder and faster, I let courage guide me through the fear of the moment as it arose. I knew I had to verbally express myself and my truths. I also knew that with every action there isareaction.ASthereismeaningineverything,so there is a price. I needed to let myself go, move in self expression, and not withhold regardless of my fears. Regardless of the response and reaction, I would be okay with it. I released the expectation of any outcome. I cannot control the response of others. I can make my own powerful choices to express my thoughts and feelings. I can feel the fear and do it anyway. I can hold the hand of courage and let it guide me any circumstance and situation in my life. Witheachexpressionofmyselfinwhat-

ever form it takes, I know that I grow stronger. Courage leads the way as it dances with fear and moves beyond it! Enjoy the desire, to be fully self-expressed that lies deep within the heart of all human beings. The formation of fear comes when we believe what we have concluded in ourselves. Ourfearsdonotcomefromanythingweknowthattruthof.Assoonaswebegintomovearehonest in what we know about our fears, they disappear and goodness and love appears.

JournalWritingSuggestionsWrite your responses as quickly as you can to each of the following:

HONEsTy: Be honest and truthful with ourselves. Let you heart guide you to heart of the matter and what you know the truth of about it. Inside your heart is your deepest knowing that every-thing is okay exactly the way it is.

CLARITy: Beclearaboutyourfears.Whatwasthesourceortriggerofthefear?Whatthoughtsandfeelingsare coming up?

POWER: The only power fear has is the one you give to it!Whateverwefeedandgiveenergyto,grows. For example, the more we worry or dwell or

talkaboutasituation,thebiggeritgets.Whatarewe giving or power to with this fear?

Past Is the source of the fear triggered by an unre-solved unhealed issue from the past?

Let Go Quietly take a deep breath, take a moment to renew and let go of fear. The only way out of fear is through. Let yourself evolve with grace and ease through the fear!

Courage Let fear dance as it walks beside you, be open and soft as you just let it be there with you. The only way out of fear is through. Let yourself movewithgraceandeasethroughthefear!Howcan you be courageous and let courage help you tomovethroughthefearand/orwithit?

Dance Dance with your fear as move you forward. If you are afraid to do something because you have never done it before, do it anyway!

Goodness Know that within every experience is a golden nugget of goodness, a lesson in love and truth withinit!•

“The greatest gift that I know is to follow what I know with courage confidence and trust.” Following one’s passion means being fearless, having faith and creative intel-ligence, an awesome combination for living life to the fullest! Passion comes from a zest and vigor for loving oneself and a willingness to pay the price!

Arielle’s passions include dance, psychology, philosophy, writing and the creative arts. She dances through life as an international and inspirational author, dancer, choreographer, teacher, painter, and facilitator and inspires her audience. Arielle has a Masters of Arts in Counselor Education, and a Masters in Educational Leadership.

As faculty member and Lead Faculty Area Chairperson for the College of Humanities, History and the Arts at the University of Phoenix, she inspires students with her profound knowledge of Humanities, Art, Psychology and Philosophy. She is a published author of several books and magazine articles. In 2014, she published her 4th

book, an Instructor’s Manual for Barlow Abnormal Psychology 4th ed.In 2013, she wrote Psychology, A Journey 3rd.ed. Study guide published by Nelson Education, Toronto, ON. Arielle has been a featured guest on radio and television, in newspapers, and the media across the US and Canada. She offers dance classes, dancing for

emotional release workshops and creative expression seminars, and psychology and art for children and adults.Website: dancingfromtheinsideout.com

Email: [email protected] contact: 813-545-7173

FAMILY AND COSMETIC DENTISTRY, P.A.LUZ ELENA CABRERA, D.M.D.

224 E. Bullard Pkwy | Temple Terrace | 813.988.2729www.familyandcosmeticdentistryoftampa.comPROCEDURES OFFERED:Porcelain Whitening Crowns Mini Implants Lumineers Traditional Implants Veneers Dentures Fillings Partials Cleanings Bridges...and more

NEW PATIENT SPECIAL!

$65 FOR COMPLETE ORAL EXAM with any necessary X-rays at NO ADDITIONAL CHARGE!

most insurances accepted

financing available

bilingual staff

same day treatment

same day appointments

Escape the stress of everyday life... relax and enjoy the Great Smokey

Mountains National Park of North Carolina

Blevins Vacation CabinsThe Mountains Are Calling You...

WEEKLY RATES AS LOW AS $400 813.789.1135

Have the courage to dance with your fears!by Arielle GiordanoC


Shinai A. Schindler is a Meditation instructor and Intuitive medium, and the Director of Mind of Light Studios

in Saint Petersburg. She teaches and writes about meditation,

imagery in healing and intuitive de-velopment. Shinai offers individual

sessions, and public workshops and classes; she can be reached at

[email protected]. Workshops on generating mandalas, as both a spiritual and artistic self-reflective

practice, are offered at Mind of Light. www.MindofLight.net

The BRIDGE is a non-profit organization that promotes eco-centric living, social justice, personal development, creativity and the vibrant interplay between these inter-dependent aspects of life.

www.thebridgetampa.org

e often think about what life can give to us.Wewonderhowtomanifestwhatwewant, how to create our own personal dream, and how to arrive at whatever destination we’ve related to as the pur-

poseoflife.“HowdoIgetwhatIwant?”hastransitionedfrom being a materialistic mantra to a spiritual one. It is even projected at times as if there is no point to spiritual practice, unless it offers some practical good. But are there ways within personal practice to make it an offering for others or to be a part of manifesting the greater Good? Isometimesfindmeditationstudentslookingverycon-fused when I mention using meditation as a tool to give backtolife.Onapersonallevel,meditationcancertainlybring greater focus, lower blood pressure and expand the capacity to observe the self in a way that improves mental health. Finding silence in practice offers many gifts that can’t be fully appreciated without having the experience. Life slows, the mind sees its own nature, and the body becomesfilledwithinvigoratingprana.Beyondtheselfhowever, there is the threshold of how we relate to others.

In Tibetan Buddhist practice, there is a tradition called offering the mandala, a method of giving back in practice. The mandala represents all of what makes us who we are, and the meditation is meant to elicit a generosity of spiritthatoffersourselfforthebenefitofothers.Thatlevel of bodhicitta or compassion toward all beings lends something miraculous to both the recipient and the sender. It elevates both reciprocally. By choosing to give to the whole within meditation, there is a different level ofexternalengagementthatcanoccur.“Peacebeginswithme,” as Gandhi said, but that doesn’t mean it ends with me.“Iamaninstrumentofpeace,”saidSt.Francis;Ihavethecapacitytoextendpeacefrommyselfforthebenefitofall. Constructing the mandala is practiced through imagin-ing every gift we have ever been given, whether from our family, from mentors or strangers along the way; and every good thing we have personally cultivated through experiences of blessing or hardship; that all the positive signs, totems, personal miracles and milestones that have happened to us, all coalesce into being the backdrop of who we are today. They exist behind and around us like

a halo or an aura of what we have become. By bringing awareness to all the good that has been offered to us, we are better able to project good and blessing to others. The technique is meant to cultivate a deep gratitude and interconnection with what has come before us to shape our path. The Tibetan Buddhist view is that we benefitfromseeingallbeingsasourMothers—thatweareinter-related and have the capacity for compassion on that deep level. “May all Mother sentient beings boundless as the sky, have happiness and the causes of happiness,” the Four Immeasurables prayer begins. The practice of gener-ating the mandala is designed to invoke this immeasurable good will within meditation. The root concept of offering the mandala is to aspire beyond what we want or think we need for survival. It is to sever the habit of grasping this life as if it is ours to cre-ate or destroy. Yet in the process of focusing compassion on others and re-directing our attention away from per-sonal goals, fears or indulgences, we transform ourselves. Aswetapintothevastnessoftheweboflifethatgivesus sustenance, the support of all the ancestors that have

come before us, the charity of those who have gifted us inthislife,andtheinfinitecapacitywehaveinourselvesto choose the good, we cannot help but see a beautiful, interdependent wholeness that is also present within the nature of who we are. Outofthiscultivatedcapacitytoseeeverythingaswhole, including ourselves, there is a gift we can offer to others. Beyond the everyday mind we can observe all that hascollaboratedforourbenefit,anddecidetobeapartofthehighestbenefitforallbeings.TheTibetanviewisthatonly by generating this selfless compassion (bodhicitta) canwefindourwaytotheultimate,orenlightenedstate.The path is to relinquish the self ’s endless grasping for its own needs, to pave a way toward understanding our deep interdependence.AllbeingsmayhavebeenourMothers;thus any limited goals of personal attainment would be best weighed against the good of all. Ihavebenefitedfrompracticesthathavechallengedmeto consider all the good that has existed in my life, even the good that comes through the darkest moments or that hasbeencultivatedbymyowndrivetoimprove.Ourconditions, our past experiences are not always rosy. They

may contain things that have pushed us to rise above, or to be a better version of ourselves. Those too have contributed to the greater aspects of our being and have given us the commitment to face challenges, to arise from the ashes, to ride the crest of the wave. That part of my mandala may incorporate times of fear or tragedy, viola-tion or great loss, but I know what I have gained from those experiences. By letting our minds fall over the worst periods of our lives as well as the best, we are propelled to claim the gifts of awareness that inevitably come from these obstacles. I am made better by all of life’s complica-tions not just its blessings and accomplishments. If this is true for me, it is also true for the many beings to which I inter-relate, and to whom I can project my intentofcompassion.Whatlooksfromtheoutsidelikea wasted life or a life lost in struggle, may in fact be the journey of someone with great lessons who deserves my infinitecompassion.Weneverknowhowothers’experi-ences relate to our own; we never know what aspects of their being are manifested in the deepest parts of our own shadow. They may be our Mother, or teacher or have

wisdom that could guide our journey of understanding. Allmeditationpracticehasthecapacitytoilluminate;however, when we take that next step toward generating a practice that acknowledges our interdependent relation-shipwithallthings—makingitnotjustforourselves,then the reciprocal good is truly vast. I receive and give back great value from my choice to meditate, and I intend that this good be exponentially multiplied. For the welfare of the Earth, the insects, plants, the marine animals, land animals, humans and the spirits of those departed, we can dedicateourpracticetoallLife.Mayallbeingsbenefit.•

The Whole Mandala of SelfW

“All the practices… have but one goal: the welfare of all living creatures throughout space.” (Words of My Perfect Teacher, Patrul Rinpoche, trans. 1994).



horoscopes

ARIESMotives relative to work and relationships situations may need to be dealt with. Even if you do not admit it to anyone else, your need is to see your own desires more clearly. Sometimesitisamatteroffindingthe answers that are not particularly welcome. Gain deeper insight and it will serve you well over the long run.

TAURUSIf you have been knocking on door that no one seems to answer it is time to step back and search for other doors. There are meaning-ful new opportunities that await if only you can rear your gaze away from the old and look up, even if just a bit!

GEMINI You can feel restricted and closed in by forces that are not readily visible. This is a preparation time designed so you can separate the wheat from the chaff. Clear the desk of your life and get down to what really matters to you!

CANCER The need is to deeper within you so that you may tap into a deeper wisdom. For this purpose, talking to a trusted someone may get the ball rolling.Althoughweareattimesledto believe that everything we need is within us, a person holding up a mirror can catalyse a new leap in awareness!

LEO Sometimesstandingupforyourrights may mean you become a tad unpopular. That is the least of your concerns now as you stand poised to move into a new level of growth—andtodothatsuccessfullyit demands a shakeup or two!

VIRGO Get ready to spend some enjoyable time as you engage with others more frequently and share a com-mon focus. Material concerns are to be pursued while you also tend more to the matters of the heart. Sharinghonestlywithotherswillliftyour spirits!

LIBRAAfteroneortwostrugglesyoucanfeelthatthetrafficiseasingandyour road is clearer. Take some time out to enjoy what you have accomplished while you imbibe in a bit of refreshment via lazy ideas and daydream doodling. You will start climbing again soon enough!

SCORPIONew spontaneity is called for as well as a friendly and spirited exchange ofnewideas.Soonyouwillbereconnecting with a few elements of what you thought was past. Failing to take notice of the abundance in your life, in many other forms other than money, would be an error. Get going with open arms and a song in your heart!

SAGITTARIUSYou may be applying too much rational thinking to issues that are really in need of your intuitive side. Stepasidefromyourownthoughtprocess and just keep focused on your long-range goals and desires. Things will move in a more natural way without all the fuss and worry—soonerthanyouthink.

CAPRICORNBe strong but not overbearing or judgemental. Take note that the only space you have command over isthespacethatyoustandon.Any-thing beyond that circumference is not your concern. Be prepared to take some risk in order to make the changesnecessary. A strongwill isonlyusefulwhenitseeksthebenefitof all.

AQUARIUS

Things can work more harmoniously as long as you gather those that hold equal talents even though it may in different areas. The word enterprise might be useful and it can be focused around any idea you feel can improve the environment or the lives of some off those around you.

PISCESSometimesyoucanfindyourselfin a loop where you keep return-ing to the very same place you had thought you left behind. Repeating the same mistakes boils down to insecurityatsomelevel—whatareyou really afraid to change?

By Imsara

Dr. Imsara is an evolutionary as-trologist, acupuncture physician, teacher and facilitator of journeys to expand and support your evolution. She holds a Doctor of Oriental Medi-

cine and a Master’s in Public Health. Imsara is offering a series of exciting new classes both in St. Petersburg and at Om Gaia in Bradenton and sees clients at her home office in St.

Pete. She is founder of the Alchemi-cal Cosmic Pyramids of Light and is currently writing a book about it. Her website is www.imsara.com.

AuGusT - 2014

Come, My Friends...Tis Newer Worlds to Explore....

Journey to South Africa and the White Lionsseptember 14 – 29th, 2014

Space has come available. Is it your time for new adventures?

Forming - Mt. Shasta Retreat 2015!To reserve your space email me for details.


AuGusT - 2014


wellness calendar

AUGUST 1-7 Psychic Fair: Friday, Aug. 1, 5:30-9:00 PM. Doors open at 4:30 PM. 15 min. sessions are $12 each/3 for $30. Temple of Love and Heal-ing, 3700 40th Ave. N., St. Petersburg;www.templeofloveandhealig.us 727-522-7133

Seagate Chiropractic-Maximized Living Health Center’s opening Day has been changed from July 28th to AUGUST 4th. We are excited to be part of the Carrollwood community. Stop in to visit us at 3602 Madaca Lane Tampa 33618. 813-217-3539

Natural Beauty Workshop | August 5, 6:00-9:00 PM. We hear a lot about reading labels lately when it comes to food, but what about your skin and hair products? Bring your favor-ite product to this workshop and learn what the ingredients are, what they do, and how they may affect your health. Also learn how to feed your skin and hair using natural in-gredients and experience making your own products. Instructors: Deserie Valloreo and Jennifer Andrews, Location: Harmony Eco Spa, 400 4th St N, St Petersburg. Register at herbalwise.net/calendar. $25 in advance, $30 at the door.

How to Get Your Next 10 Clients. Aug 5th 7:00-7:45pm. FREE Tele-seminar for holistic prac-titioners. Create your own programs that solve your clients problems and leave you fulfilled. An interview with Joeel & Natalie Ri-vera. Register at HolisticWorkshopAcademy.com.

Introduction to Yoga, August 5, 12, 19, 26, 7:15pm - 8:30pm, Tuesday nights (4 sessions) In this 4 week Introduction to Yoga you will learn the basic postures of yoga. The teacher, Val Spies, gives opportunities for questions in each session, making sure that each stu-dent receives helpful information about how yoga can benefit your life. Call (813)961-3160 or find us online at www.lotuspondyoga.com The Lotus Pond Center for Yoga & Health 6201 Lynn rd. Tampa, FL 33625

Magical Thinking, Native American Medicine & Shamanic Book Study Group. This month: “Cave and Cosmos” by Michael Harner. August 7, 6:30-9:00pm $15/person. 1200 66th St North, Saint Petersburg. Info and RSVP atwww.Meetup.com/Sacred-Rites-Ritual

Work It Out with Chay Prieto and DJ Menscha | August 7 | 9:30 - 11:00 am | $15 | We will be linking postures we’ve worked on in the previous month to flow through the practice without so much fine detail and more room to

play. Yogani Studios, 813.251.9668, 1112 W Platt St, Tampa, FL 33606.

FREE HEALTH SEMINAR: Treating Depression, Anxiety, and Stress Naturally –Dr. Carrie J. Graves, DOM, AP from WellnessByCarrie will teach how to treat and reverse the effects of neurotransmitter and hormone imbalances naturally through diet, life-style changes and alternative medicine. Please join us on Thursday, August 7th at 6:30pm. Na-ture’s Food Patch, 1225 Cleveland St, Clearwater, FL 33755 more info @ www.naturesfoodpatch.com.

Women with Spiritual Gifts, a Women’s Group for In-tuitive Development. Sundays, through August 17. 6:00-8:00pm. $10/person. Mind of Light Studios, 1200 66th St North, Saint Petersburg. Info and RSVP atwww.Meetup.com/Women-with-Spiritu-al-Gifts. Email [email protected]

AUGUST 8-14Grow Your Business with Intention. August 12th 7:00-7:45pm . FREE Tele-seminar for holistic practitioners. Discover an authentic way to make a name for yourself and learn a system to mind-fully turn prospects into paying clients. An inter-view with Cindy Bartz. Register at HolisticWork-shopAcademy.com

Free Cooking Class. Modern Paleo | Wed August 13th 6:30pm. Emily Drews, Mindful Meals Personal Chef. MENU: Paleo cuisine! No one lives in a cave anymore! Hunter-Gatherer inspired recipes that nourish and satisfy the modern palate. Nature’s Food Patch, 1225 Cleveland St, Clearwater, FL 33755 more info @ www.naturesfoodpatch.com.

FREE HEALTH SEMINAR: Leg Vein Techniques – Leg veins can be unsightly and uncomfortable. Robin Quigg of Free Health Resources will introduce new advanced procedures to “strip” away spider veins and other concerning vein issues in ways that are covered by insurances for both men and women. Please join us with on Thursday August 14th at 6:30pm. Nature’s Food Patch, 1225 Cleve-land St, Clearwater, FL 33755 more info @ www.naturesfoodpatch.com.

AUGUST 15-21Ashtanga InDepth with Jessica Lynne Moore | Au-gust 16 | 2:00 - 4:00 pm. August 17 | 2:00 - 4:00 pm. $25 each. We will demystify the Primary Se-ries and introduce you to the Intermediate Series of Ashtanga Yoga. Yogani Studios, 813.251.9668, 1112 W Platt St, Tampa, FL 33606.

FREE COOKING CLASS: Modern Paleo –No one lives in a cave anymore! Mindful Meals Personal Chef Emily Drews demonstrates how to make hunter-gatherer recipes that satisfy and nour-ish the modern plate. Please join us Wednes-day, August 16th at 6:30pm. Nature’s Food Patch, 1225 Cleveland St, Clearwater, FL 33755 more info @ www.naturesfoodpatch.com.

Reflexology Training Program Weekend at Massage Redefined. Saturday August 16th & Sunday Au-gust 17th. This is one weekend of a 12-month program where Massage Therapists learn the art and science of Reflexology to become Cer-tified Reflexologists. www.massageredefined.com/reflexology_training. Sam Belyea a.k.a. The Foot Whisperer, Nationally Certified Re-flexologisT. Massage Redefined, LLC. 4707 Gandy Blvd. Suite 6. Tampa, FL 33611.

How to Attract Loyal Clients. August 19th 7:00-7:45pm. FREE Tele-seminar for holistic prac-titioners. Leverage your passion to help others to create amazing content that gives pros-pects and clients incredible value and keeps them coming back for more. An interview with Topher Morrison. Register at HolisticWork-shopAcademy.com

FREE COOKING CLASS: No Noodle Vegan Lasagna – The Vegabond Chef Brad Myers will show how to make noodle free lasagna with homemade vegan “cheese.” Please join us on Wednesday, August 20th at 6:30pm. Nature’s Food Patch, 1225 Cleveland St, Clearwater, FL 33755 more info @ www.naturesfoodpatch.com.

Elevated Cholesterol? High Blood Pressure? Too Many Prescriptions? – with Dr. George Springer of LifeWorks Wellness Center. Dr. Springer will discuss many natural alternatives available. Thursday, Aug 21 | 6:30pm, Free, Nature’s Food Patch, 1225 Cleveland St, Clearwater, 727-443-6703.

AUGUST 22-31iRest Yoga Nidra | August 24 | 4:30 - 5:30 pm. $15 Donation. Come experience authentic, deep relaxation through “yogic sleep with awareness.” Yogani Studios, 813.251.9668, 1112 W Platt St, Tampa, FL 33606.

Blood Drive | Thursday Aug 28th 10am - 2:00pm. One Blood, oneblood.org. Free Gift with Do-nation!* Must Sign-Up with Customer Care. *While Supplies Last. Nature’s Food Patch, 1225 Cleveland St, Clearwater, FL 33755 more info @ www.naturesfoodpatch.com.


AuGusT - 2014

ON-GOING EVENTS

RITUAL POSTURE MEDITATION DIVINATION trances take us into closer alignment with Truth. We can see more clearly, sometimes beyond the constrictions of time, sometimes seeing what is perpetually in front of us but out of focus. The purpose is to dis-cover what is hidden. For beginners we suggest asking simple questions, perhaps seeking a simple “yes” or “no” answer, then progressing to ask for clarification. The more precise the question is, the more meaningful the response will be. This work-shop is facilitated by Karen Brooks and the cost is $15 per person. Plan on an hour and a half for this event. Crystal Corner 38925 County Road 54, Zeph-yrhills, FL 33542. You must register/pay in advance for classes to reserve your seat as class sizes are limited. (813) 788-4999. FULL MOON DRUM CIRCLE Every month on the Full Moon, we have a drum circle to help raise the heal-ing vibration for all people and Mother Earth. It be-gins at 7pm in our Body, Mind and Spirit suit (38919 over door) (next to Crystal Corner store). Everyone is welcomed to join in. A love offering is appreci-ated. MEET YOUR SPIRIT GUIDE This class explains what spirit guides are and gives information about our guides. A relaxation meditation followed by a guided imagery meditation leads us to meet our guide and learn more about ourselves. Always on the last Friday of each month at 7pm. Crystal Cor-ner 38925 County Road 54, Zephyrhills, FL 33542. Class space is limited so make your reservations

early. You must register/pay in advance for classes to reserve your seat as class sizes are limited. (813) 788-4999.

Guided Meditation Evenings with Sean $5 Love Dona-tion Suggested | 7:00 PM - 8:00 PM Tuesdays in 2014. Please RSVP for all classes by calling the store at 727-724-4193 as classes are subject to cancellation due to low enrollment. Location: Hav-en & Earth Spiritual Center 1316 Alt 19 North, Palm Harbor, FL 34683.

Tai Chi’ Chi Gong w/ Nancy $10 | 11:30 AM - 12:30 PM Thursdays in 2014. Please RSVP for all classes by calling the store at 727-724-4193 as classes are subject to cancellation due to low enrollment. Lo-cation: Haven & Earth Spiritual Center 1316 Alt 19 North, Palm Harbor, FL 34683.

Kundalini Yoga $12 | 7:00 PM - 8:00 PM Wednes-days in 2014. Please RSVP for all classes by calling the store at 727-724-4193 as classes are subject to cancellation due to low enrollment. Location: Haven & Earth Spiritual Center 1316 Alt 19 North, Palm Harbor, FL 34683.

Mind of Light Studios. Meditation for Everyone, individ-ual practice for all levels. Mondays 5:30-6:45pm. $7/person. Mind of Light Studios, 1200 66th St N, Saint Petersburg. Info and RSVP at www.meetup.com/Meditation-for-Healthy-Body-Mind.

Mind of Light Studios. Magical Thinking, a shamanic book study and practice circle. Thursdays, 6:30-8:30pm. $10/person. Mind of Light Studios, 1200 66th St N, Saint Petersburg. Info and RSVP at www.meetup.com/Sacred-Rites-Ritual.

Mind of Light Studios. Women with Spiritual Gifts, a women’s group for intuitive development. Sundays 6-8pm. $10/person. Mind of Light Studios, 1200 66th St N, Saint Petersburg. Info and RSVP at www.meetup.com/Women-with-Spiritual-Gifts.

Belly Dance Free Class in Classes/Workshops by Jo-hanna Deshazo. Come be introduced to the Art of Belly Dance and the wonderfully supportive dance community at Hip Expressions! Class sometimes fills up so register on-line at www.hip-expressions.com to reserve your spot. Donations are accepted. Bring a friend! 2033 54th Ave. N, Suite B Saint Pe-tersburg, 33714. Location: Hip Expressions Belly Dance Studio. When: Every Friday. Time: 06:00 pm - 07:00 pm. Phone: 727.251.5241

First Free Friday Acupuncture by David Chambers. Acu-puncture for relaxation or pain 7 chairs no waiting. 12360 66th street Suite P Largo. Location: Smart Sixty Six building. When: Every Friday of 1st Week. Time: 10:00 am - 04:00 pm. Phone: 8324837372

Beginning Meditation: Visualization, Affirmation & Ex-ternal Object August 30, 1:30-4:00pm. Facilitated by Shinai A. Schindler. $60/person. Mind of Light Studios, 1200 66th St North, Saint Petersburg. Info and RSVP atwww.Meetup.com/Meditation-for-a-Healthy-Body-Mind

FUTURE EVENTSRestorative Yoga Certification, September 6-7, 2014, Saturday 8:30am-5:30pm, Sunday 8:30am-5:30pm. Restorative classes are in demand and sold out ev-ery month at the Lotus Pond. 16 credit hours CEU’s for all yoga teachers and teachers in training $310 Call (813)961-3160 or find us online at www.lotus-pondyoga.com The Lotus Pond Center for Yoga & Health 6201 Lynn rd. Tampa, FL 33625.

Yoga Teacher Training 200 hour Certification starts Janu-ary 2015. If you have an interest in teaching or would like to dive deeper into your exploration of yoga, go to our website for information about our com-prehensive and joyful programs. call (813) 961-3160 or find us online at www.lotuspondyoga.com The Lotus Pond Center for Yoga & Health 6201 Lynn rd. Tampa, FL 33625

Wisdom Through Action An Esoteric School teaching practical application of the Work of Gurdjieff and Ouspensky. When: Every Saturday. Time: 01:30 pm - 03:00 pm. Phone: 941.266.6905 for more informa-tion.

Basic Integrated Energy Therapy w/Master Instructor Wendy Kreiss-Parkin, LMT. in Certifications/Training by Angel Ministries. You will receive attunements; Conduct the 5 min empowerment self balancing & clearing session; Become familiar w/Energy Anato-my and Cellular Memory Map; “Read” Energy; Con-duct a full Basic-level IET session $180/8CEU/0.5 credits per level. 2269 South Tamiami Trail, Suite 3AVenice, Florida, United States 34293. Location: Angel Ministries College. When: Every Saturday of 1st Week. Time: 10:00 am - 04:00 pm. Phone: 941 492-4995

Exploring the Tarot in Classes/Workshops by Linda Tenney. Participate in discussions & interactions with the cards. Share experiences, techniques & spreads. Do readings for one another. Develop your intuition. Bring your decks. Loaner decks will be available. No experience required! Love Offering $10. 9365 US Highway 19 N, Suite BPinellas Park, Florida, United States 33782. Location: Atman Cen-ter for Transformation. When: Every Sunday of 4th Week. Time: 06:00 pm - 08:00 pm

Healing with the Masters. Join Emily Andrews for an evening of connecting with Ascended Masters, Teachers and Guides as she intuitively shares their Divine messages and serves as a conduit for their healing energy. Price: Love offering. 4500 4th St N St Petersburg. Location: Wings Bookstore. When: Every Monday of 4th Week. Time: 07:00 pm - N/A. Phone: 8137581139

Vibrant Health, Vibrant Solutions With Jessica Crawford Crow. Join us each week to learn the many uses of therapeutic grade essential oils. Topics will include pain, hormone balance, mental/emotional well-being, aligning chakras, weight management, and so much more! 714 Shamrock Blvd Venice, Florida, 34293. When: Every Monday. Time: 06:00 pm - 07:00 pm. Phone: 9852645690

Drum Mediation. [email protected]. 813-843-8887. Free Every 2nd Wednesday of the month from 7 to 8pm. At 11814 N. 56th Street Suite A, Temple Terrace FL. Native American Earth Based Drum Meditation. For more info visit amomen-tinthewoods.com.

Friday Night Swing Dance Largo Community Center. All ages. No partner needed. Lesson included. Good-man Ballroom 7pm - 8pm DJ Dance: $8 400 Alter-nate Keene Road, Largo FL 33771. Savoy South Dance Hall


Dawn Balusik, AP, DOM, LMTAcupuncture, Herbs, Massage, Nutrition (MA36601)

Natural relief from Allergies, Infections, Headaches, Fatigue, Neck/Back/

Knee Pain, Endometriosis, Infertility, Menopause and more.

2431 Estancia Blvd., Ste A-2 Clearwater, FL 33761. (727) 475-4710

www.AcupunctureByDawn.com

ACUPUNCTURE & MOREHealing Touch Oriental Medicine & Acupuncture

Serving Tampa Bay Since 1996

Dr. Mary Riggin, LAc, DAc, DOMClinic Founder & Director

www.HealingTouchOM.comwww.FoodisMedicine.org

FREE Evaluation727-669-6000

Hormone Balancing - NO Bio-identical Hormones! Stubborn Weight - NO HCG! Allergies, Chronic Pain,

Family Health, Difficult Cases

COMPLEMENTARy/INTEGRATIVE HEALTHCARE

Dr Riggin

2 Year Professional

HERBALISTS TRAINING PROGRAMAcupuncture &

Herbal Therapies222 2nd St. N.

St.Petersburg Fl 33701727-551-0857www.acuherbals.com

HERBAL THERAPy TRAINING

INTUITIVE COUNSELOR

Emotional Healing • Business ReadingsCareer Guidance • Relationship Issues

Health Issues • Past Life Regression

Pathways To Awakening

5771 Roosevelt Blvd, #300Clearwater, FL 33760

[email protected]

www.marcellaz.comRev. Marcella ZinnerMMA, ChT.Th. M

Sentient Temple College of Alternative Medicine Drs Dennis and Fern Alexander, DMQ(China)

727-323-2793www.alexanderhealing.com

A healing/teaching facility using energy modalities, natural remedies and disease

prevention. Specializing in Oncology, we have successfully treated extremely

ill patients around the world.

school - AltErNAtIVE MEdIcINE AyURVEDA/yOGA

Balance & Bliss®Certified Ayurvedic Practitioner

and Yoga InstructorDenise O’Dunn, LMT

58502 E-RYT500Blending the ancient traditions of

Ayurveda and Hatha Yogawww.balanceandbliss.com

727-417-4006

FELDENkRAIS METHOD® PLUSImprove Movement, Improve Abilities -Trust in your brain’s

ability to change. Through touch and attention Bonnie guides all ages from infants to mature adults. Individual lessons or

group classes are available.Bonnie Kissam, M.A., LMT,

Feldenkrais® Practitioner since 1983

941.587.4535 Sarasota | St. Petersburg

www.feldenkraisinsarasota.comAnat Baniel’s Method with Children:

www.bonniekissam.com

MyOFASCIAL RELEASE THERAPyCarolyn Puckett, MPT, MSExpert Myofascial Release Practitioner & Physical TherapistGain awareness of what is stuck in the fascia of your physical body & release the blockages which allows you to reconnect with more of your potential, radiant energy. Blocked fascia causes pain, discomfort & lowered energy.Clearwater

727-365-8838www.BlissMyofascialRelease.com

the well tampa bay wellness resource directory

Life is Short, Live it Well! Looking for more satisfaction? Want-ing to achieve the best in your personal relationships, professional or business goals? Try coaching with a certified coach. You will be amazed at the results! Call Coach Dianne M. Kipp, BSN, PCC, CTT - Coaching Courageous Living choices for over 8 years - Illuminat-ing Possibilities & Moving you from Good to Great! Complimentary Personal Values Assessment & session available.

Dianne M. Kipp & Associates, LLC 727-481-1646

[email protected] www.diannekipp.com

COACHING

CAFE

Astrology for Your Soul Aluna Michaels, M.A., Esoteric Astrologer

Dunedin FLSecond-generation astrologer and Soul Evolutionist

practitioner. Over 25 years of experience. Insightful, unique perspective on

goals and issues. “Together we will unveil your soul’s purpose.”

alunamichaels.com727-239-7179

ASTROLOGy

the well


HOLISTIC PSYCHOTHERAPY

Breathwork / E.F.T. Energy Psychology EMdR / Mindfulness Rapid Trauma Resolution Abuse History / Grief / PTsd Anxiety / depression Relationships / Couples divorce / Life Transitions Women’s & Men’s Issues

Therapy With Heart

Lois A. Miller, L.C.S.W., PA238 E. Davis Blvd., Suite 302

Tampa, FL 33606

Gentle Guidance Through the Healing

Journey Transforming Into Self Discovery and

(813) 258-3906

Celebrations of the Heart

LIC # SW0001738

therapist.psychologytoday.com43613

Become a Nutrition/Herbal ConsultantIncrease your knowledgeLearn how to help others

Improve your healthStudy on weekends

CALL 813-445-4202 / VISIT WWW.ASNH.US

EXCEPTIONALMENTAL HEALTH CARE

NOW OPEN!

Serving the Greater Tampa Bay Areas813.333.0000Assessments & Referrals

813.922.3300Main Number

29910 SR 56 • Wesley Chapel, FL 33543www.NorthTampaBehavioralHealth.com

Help is closer than you think.Confidential • Compassionate • Caring

• Depression• Addiction• Anxiety

• Bi-Polar DisorderInpatient / Partial Hospitalization

Intensive Outpatient

Yoga for Athletes Learn poses and stretches to compliment

your training cycle in a safe setting. Gain insight into the basics of yoga and prevent athletic injuries with this class for runners and endurance athletes.

Presale $25; $30 at door

Bella Prana Yoga & Meditation1000 W. Kennedy Blvd, Tampa • www.bellaprana.com 813-508-6009

Saurday, Aug 23rd • 2:00pm - 4:00pm


tampa location3040 W. Cypress Street Suite 103Tampa, FL 33609 • (813) 902-9559

St. pete Beach location7395 Gulf Bvld., Suite 2

St. Pete Beach., Fl. 33706 • (727) 278-3992

St. anthony out patient center900 Carillion Pkwy. Suite 301

Clearwater Fl. 33716 • (727) 278-3992

Anne Hermann, MD

Double board certified in

Internal Medicine

& Nutrition

w w w . d o c t o r h e r m a n n . c o m

HOLISTICPrimary Care

Anti-Aging Cosmetic

Procedures

Food Sensitivity

Testing

Board Certified Internal Medicine Physician, Licensed Acupuncture Physicians, Licensed Massage Therapists, and Holistic Aestheticians

• Saliva Hormone Testing• Natural Thyroid management• Gluten Sensitivity Testing• Vitamin Testing• Menopause Treatments• Natural Pain Management• Fertility Treatments• Weight Loss

Insurance Accepted PIP Cases Accepted

Documents

Tampa Bay Wellness - August, 2014