MOLECULAR EVOLUTION OF VIRUSES; ‘TREES’,...

Preview:

Citation preview

J. Cell Sci. Suppl. 7, 319-337 (1987)Printed in Great Britain © The Company of Biologists Limited 1987

319

MOLECULAR EVOLUTION OF VIRUSES; ‘TREES’ ,

‘CLOCKS’ AND ‘MODULES’

A D R IA N G IB B S

Research School o f Biological Sciences, Australian National University, Canberra,A.C.T., 2601, Australia

S U M M A R Y

Comparisons of the nucleotide sequences of viral genomes, and derived amino acid sequences, mostly confirm the traditional taxonomic groupings of viruses. These comparisons have also shown unexpected homologies between genes of viruses from different groups previously thought to be unrelated, and between some viral and non-viral genes. Comparisons of the three-dimensional structures of the particle proteins of some viruses have also revealed unexpected relationships, and, together with the sequence homologies, suggest that some ancestral viruses had ‘modular’ origins.

Some of the sequence differences have been used to construct phylogenies. However, there is evidence that viral gene ‘molecular clocks’ do not always keep time consistently over very long or very short evolutionary time periods. Clues on evolution mostly come from comparative studies of living or fossil organisms. Fossils of viruses are not known, and thus clues of the origins and evolution of viruses are obtained by comparing extant forms. For example, by comparing isolates of different viruses, or strains of viruses, one can infer the properties of their ancestors, and by comparing isolates obtained during an epidemic, and sequentially related to one another, one can observe directly the type and timing of evolutionary changes.

T R A D I T I O N A L V I R U S S Y S TEM ATI CS

Virus ‘species’ and virus ‘groups’ are most realistically defined in operational terms; a virus ‘species’ is a collection of strains or isolates whose known properties are so similar that there is no obvious value in giving them separate names, and a virus ‘group’ is a collection of virus ‘species’ that is useful to define by their shared properties because the groupings thus formed help with such problems as identifying newly found viruses and predicting their properties. Over the past quarter of a century most viruses have been placed in one or another of about sixty groups (Matthews, 1982).

A cornucopia of information about the nucleotide sequences and organization of viral genomes and the structure of the molecules they encode, is currently being amassed by the techniques of molecular genetics. These data have mostly confirmed that viruses classified in groups using traditional taxonomic criteria such as particle morphology, replication strategy and serological tests on viral proteins (Matthews, 1982) are phylogenetically related. However, sequence data have a greater infor­mation content and hence a greater potential ‘resolving power’ than traditional criteria, and has indicated that most, but not all, of the currently recognized taxa above the level of group reflect phylogeny. For example, the glycoproteins of vesicular stomatitis and rabies viruses have significantly homologous sequences

320 A. Gibbs

(Rose et al. 1982) indicating that the classification of these viruses as type species of two genera of the Rhabdoviridae probably reflects their phylogeny. By contrast molecular data have shown that alphaviruses and flaviviruses are probably not phylogenetically related and hence it is inappropriate to classify them as genera of the Togaviridae, and, as a result, their ‘official’ taxonomy (Westaway et al. 1985) has recently been revised, a first for molecular taxonomy!

M O L E C U L A R S Y S T E M A T I C S AND T HE O R I G I N S OF V I R U S GR OUP S

Sequence homologies

Gene sequence comparisons have also provided evidence for distant phylogenetic relationships.which traditional taxonomic practices could never have predicted, and indeed which cut right across the major divisions produced by those practices. For example, these comparisons have shown unequivocal gene sequence similarities between viruses with DNA and RNA genomes, between animal and plant viruses, and between viruses with icosahedrally and helically constructed particles. They have also shown unequivocal relationships between some genes of viruses, prokary­otes and eukaryotes, an indication of their common ancestry. These unexpected similarities, which are most clearly shown by the amino acid sequences deduced from nucleotide sequences, include those between the following.

(1) Various proteins of cauliflower mosaic virus, all three types of retroviruses, the hepadnaviruses and the Drosophila copia, gypsy, 412, 17.6 and yeast Ty retrotrans- posons (Toh et al. 1983; Yuki et al. 1986; Covey, 1986; Miller & Robinson, 1986; also see Kingsman & Hull in this volume).

(2) Non-particle proteins (probably RNA polymerases) of cowpea mosaic como- virus and the picornaviruses (poliovirus and foot-and-mouth disease virus) (Argos et al. 1984; Franssen et al. 1984; see also van Kammen in this volume).

(3) Non-particle proteins of Sindbis alphavirus, tobacco mosaic tobamovirus, alfalfa mosaic virus, brome mosaic bromovirus, tobacco streak ilarvirus and tobacco rattle tobravirus (Ahlquist et al. 1985; Boccara et al. 1986; Cornelissen & Bol, 1984; Cornelissen et al. 1984; Cornelissen et al. 1986; see also chapter van Kammen in this volume).

(4) The possible RNA-dependent polymerases of the viruses listed in (2) and (3) above (Kamer & Argos, 1984).

(5) The matrix proteins of influenza orthomyxovirus and vesicular stomatitis vesiculovirus (Rose et al. 1982).

(6) The 3' termini of sunn-hemp mosaic tobamovirus, and that of turnip yellow mosaic virus (Meshi et al. 1981); also parts of the 30 K (K = 103Mr) protein of sunn- hemp mosaic tobamovirus and of the 150 K polypeptide encoded by RNA-2 of tomato black ring nepovirus (Meyer et al. 1986).

(7) A stretch of fourteen amino acid residues centred on an asp-asp doublet in the reverse transcriptases of retroviruses and proteins of MS2 levivirus, influenza

Molecular evolution o f viruses 321

orthomyxovirus, cauliflower mosaic virus and hepatitis virus B (Kamer & Argos,1984).

(8) DNA polymerases of vaccinia orthopoxvirus, Epstein-Barr herpesvirus and, perhaps, adenovirus 2 (Earl et al. 1986).

(9) RNA polymerase of Drosophila, yeast, Escherichia coli and vaccinia orthopox­virus (Broyles & Moss, 1986).

(10) Thymidine kinases of man, chicken, fowlpox avipoxvirus, and three ortho­poxviruses (vaccinia, variola, monkeypox) (Kwoh & Engler, 1984; Boyle et al. 1987).

(11) Protein kinases of yeast, three alphaherpesviruses (herpes simplex viruses I and II and varicella-zoster virus) and the one genes of four retroviruses (v-mos, v-src, v-erbS and v-abl) (McGeoch & Davison, 1986; see also McGeoch in this volume).

(12) Reovirus type 3 haemagglutinin and nematode myosin and rabbit tropomyo­sin (Bassel-Duby et al. 1985).

(13) Vaccinia poxvirus 19 K early protein and mammalian epidermal growth factor (Reisner, 1985).

The authors of all these reports conclude, with greater or lesser conviction, that the homologies indicate that the members of each gene group have a common ancestor though some, like Kamer & Argos (1984), express reservations and point out the possibility that the similarity of short sequences may have resulted from convergence.

Several of the observed sequence homologies listed above have been used to estimate the relative or absolute time of separation of the members of the group, namely to assess their phylogenies. An underlying assumption of such calculations is that, for each set of related sequences, there is a relationship between the estimated differences between sequences and their times of separation, namely that there is a ‘molecular clock’ that functions consistently in all branches of each phylogeny. There are precedents for these assumptions from studies of proteins (Wilson et al. 1977) and nucleic acids. For example, Sibley & Ahlquist (1984) stated that the ‘same average rate of DNA sequence evolution occurs in all lineages’ of ‘birds, and we assume that it is also true for mammals, and probably for other eukaryotes’. However this has subsequently been convincingly challenged by Britten (1986), who, using a broader set of data, showed that there are five fold differences in the rate of accumulation of neutral mutations in coding DNA in different groups of animals.

There is unfortunately much less evidence of the rates of change of viral genes; indeed it is unlikely that comparably direct evidence can be obtained because virus fossils, that could be dated, are not known. Nonetheless there is some indirect evidence that the viral gene ‘clock’ is not stable. For example, comparisons of influenza virus genes, discussed below, indicate that mutation rates obtained from studies of epidemics can not be extrapolated to obtain estimates of the timing of more distant relationships. There is also an indication from comparisons of the thymidine kinases (TK s) of poxviruses and their hosts that homologous genes may evolve at different rates, and I will discuss this evidence briefly.

322 A. Gibbs

There are unequivocal sequence similarities between the T K s of man, chicken, and fowlpox, vaccinia, variola and monkeypox viruses but not that of herpes simplex virus (Kwoh & Engler, 1984; Boyle et al. 1987). When aligned (Fig. 1), it can be seen that ‘core’ regions of the vertebrate enzymes and the full sequences of the poxvirus enzymes are homologous (> 4 9 % ); the vertebrate TK s differ most noticeably from the poxvirus T K s in that they have additional sequences at both termini. The genomic sequence of the chicken T K includes six introns (Fig. 1), but their positions show no relationship to the regions of greatest homology with the other TK s, nor to places where insertions or deletions might have occurred.

1 10 2 0 30 40Fowlpox MS----- ------SGSIHVITGPMFSGKTSELVRRIKRFMLVariola MN----- ------GGHIQLIIGPMFSGKSTELIRRVRRYQIVaccinia MN----- ------GGHIQLIIGPMFSGKSTELIRRVRRYQIMonkeypox MN----- ------GGHIQLIIGPMFSGKSTELIRRVRRYQIHuman MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIChicken MNCLTVPGVHPGSPGRPRGQIQVIFGPMFSGKSTELMRRVRRFQL

+ + ++ + +++++++++++ +++++ +A A

50 60 70 80 90 1 0 0 1 1 0SNFKCIIIKHCGDNRYNEDDINKVYTHDLLFMEATASSNLSVLVPTLLNDGVQVIGIDEAQFFLDAQYKCVTIKYSNDNRY---- GTGLWTHDKNNFEALEATKLCDVL-EAI-TDFSVIGIDEGQFFPDAQYKCVTIKYSNDNRY----GTGLWTHDKNNFEALEATKLCDVL-ESI-TDFSVIGIDEGQFFPDAQYKCVTIKYSNDNRY---- GTGLWTHDKNNFAALEVTKLCDVL-EAI-TDFSVIGIDEGQFFPDAQYKCLVIKYAKDTRY----SSSFCTHDRNTMEALPACLLRDVAQEAL— GVAVXGIDEGQFFPDAQYRCLLVKYAKDTRY---CTTGVSTHDRNTMEARPACALQDVYQEAL— GSAVIGIDEGQFFPD+++++ +++ + ++ +++ + ++ + ++ + ++++++++++++

A A

12 0 1 30 1 40 1 5 0 1 6 0 170IVEFSESMANLGKTVIVAALNGDFKRELFGNVYKLLSLAETVSSLTAICVKCYCDASFSKRVTEN WEFCERMANEGKIVIVAALDGTFQRKPFNNILDLIPLSEMWKLTAVCMKCFKEASFSKRLGTE IVEFCERMANEGKIVIVAALDGTFQRKPFNNILNLIPLSEMWKLTAVCMKCFKEASFSKRLGEE WEFCERMANEGKIVIVAALDGTFQRRPFNNILNLIPLSEMWKLTAVCMKCFKEASFSKRLGTE IMEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESWKLTAVCMECFREAAYTKRLGTE IVEFCEKMANTGKTVIVAALDGTFQRKAFGSILNLVPLAESWKLNAVCMECYREASYTKRLGAE +++++ +++ ++ ++++++++++++ + + + + + + + +++++++++ + +++ ++++ +

A

1 8 0 1 9 0 2 0 0 2 1 0 2 2 0 2 3 0 2 4 0KEVMDIGGKDKYIAVCRKCFFSN-------------------------------------------------TKIEIIGGNDMYQSVCRKCYIDS-------------------------------------------------TEIEIIGGNDMYQSVCRKCYIDS-------------------------------------------------TEIEIIGGNDMYQSVCRKCYIDS-------------------------------------------------KEVEVIGGADKYHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPANREVEVIGGADKYHSVCRACYFQK-RPQQLGSENKENVPMGVKQLDMPASRKIFAS-----------

+ + +++ + + ++++ ++A

Fig. 1. Amino acid sequences derived from the nucleotide sequences of the thymidine kinases of four poxviruses and two vertebrates aligned using the miminum number of spaces ( - ) to maximize their homology; an asterisk has been placed under each column where five or more of the six residues in that position are the same, and inverted slashes indicate the positions of the introns in the chicken genomic gene.

Molecular evolution o f viruses 323

Fig. 2. Dendrograms illustrating the relatedness, and hence the possible phylogeny, of the thymidine kinases of four poxviruses and two vertebrates: (A) calculated from the homologies of the ‘core’ regions of the enzymes, disregarding any comparisons involving inserted spaces; (B) calculated from the homologies of the entire aligned sequences (Fig. 3) treating inserted spaces ( - ) as though each was a 21st amino acid.

Broyles & Moss (1986) reported similar but more distant homologies between seven regions of the RNA polymerases of vaccinia virus, Escherichia coli, yeast and Drosophila. They concluded from an analysis of the ‘homologous domains’ that

‘The degree of relatedness among the four types of RNA polymerases has implications for the evolution of the vaccinia virus enzyme. In all regions of the polypeptide, the vaccinia 147 K subunit more closely resembles the eukaryotic large subunits than the prokaryotic large subunit. Some regions of the vaccinia 147 K subunit are more closely related to the yeast RNA polymerase II , while others more closely resemble RNA polymerase I I I . It is difficult to ascertain, therefore, whether the vaccinia virus polymerase evolved from RNA polymerase II,RNA polymerase I II , or their ancestor.’

Thus, in summary, Broyles and Moss have concluded from comparisons of partial sequences, aligned using multiple gaps, that the vaccinia enzyme is evolutionarily closer to the eukaryote enzymes than that of the prokaryote. In many of the other reports of distant sequence homologies listed above, numerical analyses also ignored non-homologous regions.

When this strategy is used for the thymidine kinase data in Fig. 1, the dendrogram shown in Fig. 2(A) is obtained. This dendrogram confirms the close homology between the three vertebrate poxvirus enzymes (ca 97 %), and also between the two vertebrate enzymes (81% ). However, it also shows, surprisingly, but quite unequivocally, that the sequences of the two vertebrate enzymes are more closely related to those of the mammalian poxvirus enzymes than to that of fowlpox virus; the two branch points involved are at homologies of 67-3 % and 50-8 % with standard

324 A. Gibbs

errors of 0 -43 % and 0-92% respectively. This branching pattern suggests that the ancestral enzyme was poxvirus-like, and gave rise to the fowlpox enzyme before producing both the mammalian poxvirus enzymes and the vertebrate enzymes with additional terminal portions. This phylogeny is most unexpected because the poxviruses are a prime example of a group of viruses whose taxonomy correlates with the relationships of their natural hosts (Matthews, 1982), implying that they co­evolved with their hosts.

An alternative and more intuitively acceptable interpretation of the unexpected relationships of the T K s is that the ‘core’ portion of the enzyme has evolved in vertebrates more slowly than in poxviruses. One way to ‘correct’ for the possible slower rate of evolution of the vertebrate T K ‘core’, when assessing homologies, is to include in the calculations all the amino acid residues of the enzymes that might have been deleted or acquired, the inserted gaps required for alignment being treated as though they were a 21st amino acid. A dendrogram (Fig. 2B), calculated from data treated in this way, shows the branching pattern one would have expected from the taxonomy of poxviruses and their hosts, namely, all the poxvirus enzymes in one primary division, and the two vertebrate enzymes in another. If this interpretation is correct, then: (a) the rate of evolutionary change of the poxvirus T K enzyme is about four times that of the homologous ‘core’ of the vertebrate T K s; (b) it is unwise to attempt to quantify distant relationships from numerical comparisons of partial sequences or selected parts of them.

A third more complex explanation for the unexpected T K phylogeny shown in Fig. 2(A) is that T K genes from early mammal poxviruses displaced those in the genomes of vertebrate progenitors by a non-Mendelian (‘horizontal transmission’) mechanism such as gene conversion (Smithies & Powers, 1986) or molecular drive (Dover & Tautz, 1986).

I favour the second alternative given above, as it is the simplest. Moreover the proposed difference in rate of evolutionary change of the T K cores, required to explain their unexpected taxonomy, is close to that reported by Soeda et al. (1980) for the difference between the rate of change of the proteins of three papovaviruses and their co-evolving hosts, and also close to that reported by Britten (1986) for differences in the ‘silent’ mutation rate in DNA in different lineages.

Some of the sequence homologies listed above stretch over several genes of each virus. One ‘gene module’ of this sort is that represented in the retroviruses by the gag1 and pol genes. The gag-pol module has been found in a wide range of viruses and virus-like transposable elements, all of which transfer their genetic information alternately through complete DNA and RNA transcripts. Different members of this group of viruses and elements have different additional genes, which adapt them to their particular life-style, for example, the transmissible viruses have env or other particle protein genes, whereas the congenitally transmitted ones do not, similarly the episome-like viruses (hepadnaviruses and caulimoviruses) have circular genomes, whereas those that insert into the host genome have terminal repeats. Details of this group of viruses and elements are discussed in other Chapters of this book.

Molecular evolution o f viruses 325

Two other gene modules of interest are the ‘polymerase modules’ of: (1) the picornaviruses of animals and comoviruses of plants; this group probably includes most of those with ‘positive-strand’ RNA genomes that have a 5'-terminal ‘VpG’ protein, notably the potyviruses (Domier et al. 1986; R. E. Rhoads, personal communication); (2) The tricornaviruses, tobamoviruses and tobraviruses of plants, and the alphaviruses of vertebrates and mosquitoes; a group of viruses also with ‘positive-strand’ RNA genomes but with a 5'-terminal cap.

It is noteworthy that these modules cut across the traditional groupings of viruses, and the significance of this will be discussed below.

M acrom olecular structural homologiesThe three dimensional structures of many proteins have now been determined by

X-ray crystallographic and associated methods, and these data include an increasing number of reports on the structures of viral particle proteins. Such information is of great value as it has become clear that, during evolution, homology of higher order molecular structure is conserved longer than primary gene sequence homology (Rossmann & Argos, 1981). Thus comparisons of the molecular structure of encoded proteins can provide clues of relationships between genes that have been separated by such long periods of relative evolutionary time that they have no sequence homology.

So far all the structural studies of virus proteins have been of coat proteins, mostly those of viruses with ‘positive strand’ RNA genomes and isometric particles. The surprising result of these studies is that all the coat proteins in these isometric particles contain a similar characteristic structure or ‘motif’, which is an eight- stranded anti-parallel /3-barrel (Swiss roll). When these are compared objectively by several methods, they are found to be so similar as to leave ‘little doubt as to their divergence from a common ancestor’ (Rossmannet al. 19836; Rossmann et al. 1985). The particle proteins in which the /3-barrel have been found include alfalfa mosaic virus (Fukuyama et al. 1983), black beetle nodavirus and cowpea mosaic comovirus (Hosur et al. 1986), poliovirus (Hogle et al. 1985), rhinovirus 14 (Rossmann et al.1985), southern bean mosaic sobemovirus (Erickson et al. 1985; Rossmann et al. 1983a), tobacco necrosis satellite virus (Alwyn Jones & Liljas, 1984), and tomato bushy stunt tombusvirus (Olson et al. 1983; Hopper et al. 1984).

Tobacco necrosis satellite virus has one copy of the /3-barrel gene in its genome, and sixty copies of the protein it encodes form the T = 1 icosahedral shell of its particles, whereas southern bean mosaic and tomato bushy stunt viruses have a single copy of the gene but use 180 copies of the protein in quasi-equivalent positions to form their T = 3 shells. However some of the viruses have more than one copy of the /3-barrel gene in their genomes. The ‘protomer’ particle proteins of poliovirus and rhinovirus 14, of which 60 form each T = 1 icosahedral shell, are post-translationally cleaved into four polypeptides, one small one and three larger, which form the surface of the particle and which, though quite distinct from one another, contain a single /3-barrel; thus the picornavirus genome contains three ‘descendants’ of the ancestral /3-barrel gene. The genome of cowpea mosaic virus also contains three descendants of the gene though, during post-translational processing, one of the /3-

326 A. Gibbs

barrel domains is cleaved from the other two, and thus the particles contain one large and one small protein. The structure of the particles of black beetle nodavirus represent yet another variant; each particle has a T = 3 shell of 180 protein subunits, each of which contains one /3-barrel together with another prominent surface domain constructed from sequences ‘inserted’ into the /3-barrel sequences.

The ¡3-barrel structure has also been found in a few other proteins including one domain of the influenza haemagglutinin (Wilson et al. 1981) and two of the adenovirus hexon protein (Roberts et al. 1986).

Much less is known of the structure of viral particle proteins from helically constructed particles, and that of tobacco mosaic tobamovirus (TM V) is the only one to have been investigated in detail (Namba & Stubbs, 1986), though unpublished studies of that of tobacco rattle tobravirus are said to have found it to be closely similar (D. Zimmern, personal communication). The structure of TM V particle protein is quite unlike the /3-barrel proteins discussed above; its main structural domain consists of four ar-helical rods, whose orientation suggests that it originated by duplication of a two helix structure (McLachlan et al. 1980). It is possible that the particle proteins of many, if not all, of the other plant viruses with filamentous or rod­shaped particles will be found to be structurally related to that of TM V.

M odular origins

Botstein (1980) summarized the evidence of functional and genetic relationships of the temperate enteric phages including X and P22. He concluded that these phages ‘are related in ways not easily accounted for by standard ideas of evolution along branching trees of linear descent’. He suggested instead that these and other phages were the products of ‘modular evolution’, which he defined as ‘the joint evolution of sets of functionally and genetically interchangeable elements... each of which carries out a particular biological function’. Thus ‘each virus encountered in nature is a favourable combination of modules (one for each viral function) selected to work optimally individually and together to fill a particular niche’.

Botstein also suggested that ‘modular evolution’ would also be found to apply to viruses of higher organisms, and indeed the sequence and structural studies summarized above indicate that he was correct. For example, the ‘polymerase module’ of the tricornaviruses is found in particles constructed from a /3-barrel protein in viruses such as alfalfa mosaic, brome mosaic, cucumber mosaic and Sindbis alphavirus, but is also found in the genome of tobacco mosaic virus, which has a totally different particle protein gene. Similarly the ‘polymerase module’ of the picornaviruses and comoviruses is found, in these viruses, associated with a /6-barrel protein, but is also found in the potyviruses, which have helically constructed filamentous particles that are more likely to be constructed from a protein related in structure to that of TM V.

The origins of viruses, and the events that led genes to take up the viral ‘life-style’ will probably never be known, even though the distant sequence homologies listed

Molecular evolution o f viruses 327

above stimulate speculation. Whether all the gene modules described above assembled into viable viruses at one time or sequentially is not known, but it is important to realize that at all the linkage points of viral evolution there were shared hosts.

T H E G E N O M E S OF V I R U S ‘ S P E C I E S ’

Recent work has shown how much the genomes of related viruses may differ in size and organization. The data have also indicated that all the processes that result in genetic change in other organisms, such as mutation, selection, deletion, recombi­nation and pseudo-recombination (reassortment) occur with all groups of viruses where they have been sought, both with those viruses that have DNA genomes and with those that have RNA genomes.

The genomes of quite closely related viruses may differ greatly. For example the genomes of individual herpesviruses and poxviruses differ in size over a two-fold range and there is considerable variation in the sequence arrangement, especially of their terminal regions (Roizman & Batterson, 1985; Davison & McGeoch, 1986; Mackett & Archard, 1979; see also McGeoch in this volume). Genome variability is not confined to viruses with large DNA genomes, even those with small multipartite and unipartite RNA genomes vary (Cornelissen et al. 1986; Angenent et al. 1986; Faragher & Dalgarno, 1986). Some of these differences, found among viruses with homologous uni- and multipartite RNA genomes, imply that evolutionary processes may not follow the patterns predicted by information theory (Reanney, 1984).

It is now also becoming clear that the nucleotide sequences of viral genomes are exposed to a great range of selective pressures in addition to that which produces the non-random useage of synonymous codons. For example, recent reports include evidence that:-

(a) in the short repeat region of the genome of herpes simplex virus both coding an d non-coding regions have the unusual nucleotide composition of about 80% G + C (McGeoch et al. 1986). This indicates that, at least for this virus, nucleotide useage is not determined by the tRNA suite of the host;

(b) when the nucleotide sequences of the genomes of 20 RNA-genome viruses were used to predict the extent of the secondary structure of those genomes, it was found that the ‘folding probability’ of all was greater than that of random sequences of the same composition, but was much greater for those with icosahedrally constructed particles than those with helically constructed particles (or nucleocap- sids) (Yamamoto & Yoshikura, 1986). This indicates that among the factors affecting genome sequence are the requirements for particle assembly;

(c) the genomes of many bacteriophages, but not of eukaryote viruses or mitochondria, contain significantly fewer of the palindromic sequences known to be recognized by the restriction endonucleases of enterobacteria, than would be expected by chance (Sharp, 1986).

328 A. Gibbs

V I R U S P O P U L A T I O N S

Much interesting information about short term evolutionary changes in virus populations is being obtained from molecular studies of viruses with RNA genomes as the leviviruses, orthomyxoviruses and picornaviruses.

The seminal paper of these studies was that of Domingo et al. (1978). They studied a stock of Q/3 levivirus, a virus with a RNA genome, which had been repeatedly passaged at high multiplicity for more than 50 generations over several years and had always given ‘reproducible fingerprints’. Nonetheless, the amount of variation they found when they examined individual clones from that stock, indicated that, on averge, every viable genome in the stock differed from the ‘average’ population genomic sequence at 1-6 sites. In competition experiments, five variants were each tested by mixing with the parental population and repeatedly passaging the mixture. The variants all disappeared after 10-20 generations. Thus Domingo et al. (1978) concluded that the parental population, though heterogeneous, appeared stable because it was ‘in a dynamic equilibrium, with viable mutants arising at a high rate on the one hand, and being strongly selected against on the other’.

Not all viruses maintain genetically unchanging populations, and during epi­demics of viruses in animals there may be large and sequential changes. The studies of recent epidemics of acute haemorrhagic conjunctivitis caused by enterovirus 70 (Tanimura et al. 1985; Miyamura et al. 1986) have indicated how quickly a range of variants can arise by a branching genealogy and persist in an epidemic population. A similar rate of nucleotide change (c a . 1 % /annum) has been reported for influenza A viruses in the human population (Both et al. 1983; Buonagurio et al. 1986a; Gibbs et al. 1982; Hayashida et al. 1985) and, by contrast with the structure of enterovirus 70 populations, that of the influenza A viruses is of a tree with strong apical dominance and short branches.

Influenza is an epidemic disease of man caused by influenza orthomyxovirus infection. Similar diseases caused by related viruses also occur in other domesticated animals, such as pigs, horses and fowls, and orthomyxoviruses are widespread in wild birds, particularly water birds, usually as asymptomatic gut infections. The orthomyxovirus genome is RNA, about 15 kb in size and divided into 8 segments. The orthomyxoviruses fall into three subgroups, A, B and C, which are dis­tinguished serologically by the nucleoprotein and matrix protein antigens within their particles. Isolates within each subgroup are then distinguished by two antigenic proteins that comprise the surface of the particles, these are the haemagglutinin (HA) and neuraminidase (NA). Thirteen distinct groups, or ‘subtypes’, of HA are known in influenza A viruses, only three of which are ever found in man, and there are nine distinct subtypes of NA.

Changes in the HA and NA occur during and between epidemics of influenza A viruses. In human populations these antigens are clearly under strong selective pressure (Webster et al. 1982; Air & Laver, 1986) and this leads to cumulative amino acid changes in their antigenic sites which involve about 20 % of the HA gene (Both

Molecular evolution o f viruses 329

et al. 1983); this type of change is called antigenic ‘drift’. In addition there are occasional major epidemics associated with changes called antigenic ‘shift’; a new subtype of HA or NA appears and the existing HA or NA disappears. Shift probably results from pseudo-recombination of the HA and NA genes when a person is mixedly infected with the current field strain and an orthomyxovirus from another animal species.

Many orthomyxovirus genes, especially those encoding the HA and NA proteins, have been fully or partially sequenced and constitute a most important database for evolutionary analyses, such as those of:

(1) Hayashida et al. (1985), who made a comparative study of the known nucleotide sequences of all eight genes of 14 isolates of subgroup A of either the H I, H2 or H3 and N1 or N2 subtypes, mostly isolates obtained from human beings between 1934 and 1978. They concluded that nucleotide changes occur in all the influenza genes in a clock-like manner. The rate of ‘silent’ nucleotide change was similar in all genes, about IT X 10-2 substitutions per nucleotide per year, which is more than a million times faster than the rate for nuclear genes. The fraction of nucleotide mutations that resulted in amino acid changes varied from about one third of the rate for ‘silent’ changes for the HA and NA genes, to one twentieth for other genes; this resulted in a rate of accumulation of amino acid changes that is also about a million times faster than that of nuclear DNA genes (Wilson et al. 1977).

(2) Buonagurio et al. (1986a), who compared the sequences of the NS protein gene of 15 human influenza A viruses isolated over 53 years (1933-1985). They showed that this gene has evolved over this period at a rate of 1-94 ± 0-09X10-3 substitutions per nucleotide per year in a very regular clock-like manner. They also constructed an evolutionary ‘tree’ from the data by the ‘maximumi parsimony method’, and showed that the positions of the gene isolates correlated with the year in which they were obtained, though those in the current H1N1 lineage had a period of ‘suspended evolution’ between 1950 and 1977! This sequence analysis confirmed serological evidence that the internal proteins of the particles of influenza viruses infecting human beings are sequentially related over the period 1933 to 1985, even though one or other or both of their surface antigenic proteins changed completely at times of antigenic shift.

(3) Saitou & Nei (1986), who compared the sequences of isolates of four influenza subtypes and constructed phylogenetic ‘trees’ for four of their genes. The position of each gene isolate in the tree mostly correlated with the year of isolation, confirming similar analyses of subtype H3 HA genes from human beings by Gibbs et al. (1982) and Both et al. (1983). Saitou & Nei (1986) noted that those genes whose position did not correlate well with time of isolation were mostly from non-human isolates, and remarked that ‘the rate of nucleotide substitution is lower in nonhuman viral strains than in human strains’ but offered no explanation for, or estimate of, this difference. Nonetheless, from the estimated mutation rate of influenza genes and from the extent of the differences between subtypes of the HA and NA sequences, they concluded ‘that most polymorphic sequences within a subtype or a gene appeared during the last

330 A. Gibbs

80 years and that the divergence among the subtypes of haemagglutinin genes might have occurred during the last 300 years’.

An alternative explanation to that of Saitou & Nei (1986) has been proposed by Gibbs et al. (1982) and Gibbs (1984). For this explanation it is important to realize that the influenza virus isolates used in these sequence studies are of two fundamentally different sorts. Firstly there are those from epidemics in the human population over the period 1933 to 1986. These have been shown by sequencing and serological studies of the proteins in their particles to be directly serially related, and hence comparisons of homologous proteins of these isolates (i.e. the internal particle proteins and the HAs and NAs of the same subtype) provides unequivocal evidence of mutation rates. The other isolates were obtained from other animals, mostly birds, and, in contrast with the human isolates, there is no evidence that these are directly serially related and hence it is not known whether the time of their isolation bears any relationship at all to the time of their phylogenetic separation. Gibbs et al. (1982) showed that these two types of isolates differed also in another respect. They compared the 3' (/V-terminal) 300—350 nucleotides of the HA gene of 39 isolates from all 13 HA subtypes. Classifications computed from both the nucleotide and deduced amino acid differences between these sequences (Air, 1981; Gibbs & Fenner, 1984)

80 • •• •

• r wv? -

20

i ----------- i ----------------------------------------------1

20 40 60 80% nucleotide difference

Fig. 3. Graph showing the relationship between nucleotide and derived amino acid sequence differences for all pairwise comparisons of the partial 3 ' (TV-) terminal sequences of 39 influenza A orthomyoxovirus haemagglutinin genes.

Molecular evolution o f viruses 3312 0 '

1 0 -

« • t • • •

10 20

% nucleotide difference30

Fig. 4. Enlarged portion of Fig. 1 indicating the comparisons between pairs of bird isolates (triangles) and between pairs of human isolates (large disks) of the same subtype; all the small disks are the results of human/bird comparisons.

unequivocally placed the isolates into the 13 known serological subtypes. However, significantly, when the nucleotide and deduced amino acid differences between all pairs of sequences were plotted against one another, those comparing human isolates fell near a line with a slope of about 1 • 1 amino acid differences/nucleotide difference, whereas those comparing pairs of bird isolates fell near a line with an initial slope of about 0-2 amino acid differences/nucleotide difference (Figs 3 and 4 ). In other words, in human infections a much greater proportion of mutational changes of the HA gene resulted in amino acid changes than in bird infections; in human infections, nucleotide changes in the 1st and 2nd positions of each codon were accepted almost as frequently as third position changes. T h e trend of the points representing bird/bird com parisons in Figs 3 and 4 is confluent with the trend of comparisons with dissim ilarities greater than 20 %, which represent subtype (‘sh ift’) comparisons. T h is relationship is what one would expect if mutations are random but there is selection against amino acid changes. ‘T h is trend most likely represents main stream H A evolution, and its rate clearly cannot be deduced from the rate of change observed during human epidemics, when a different set of constraints seems to operate’ (G ibbs et al. 1982).

T h e population structure of influenza A viruses infecting the human population probably results from strong and sequential selection for antigenic novelty of the HA protein, the other genes acquire their similar slender genealogy by ‘hitch-hiking’ with the HA gene. Antigenic selection of the HA of influenza A viruses seems to be strong in human populations, probably because individual human beings are relatively long- lived and the im mune responses of their lungs incom plete. By contrast, in pigs, antigenic drift is much slower (M eier-Ew ert et al. 1970), and there is no evidence of

332 A. Gibbs

antigenic selection of influenza A viruses in birds. The structure of influenza C virus populations infecting human beings resembles that of influenza A viruses in birds (Buonagurio et al. 19866); there is no correlation between the homologies of the HA or the NS genes of any two isolates, and the period between their times of isolation, thus it seems that many different HA and NS genes are co-circulating and reassorting.

The population structure of influenza A viruses during epidemics in the human population is not unique and similar genetic changes have been observed in poliovirus during epidemics both in an unvaccinated community (Nottay et al. 1981) and in a single vaccinated child (Minor et al. 1986), and also during epidemics of human immunodeficiency virus, both within the human population and in individual human beings (Hahn et al. 1986). However, common to all these examples is the likely influence of selection by the host for the antigenic novelty of the virus, but there is, as yet, no direct evidence that the selected viruses, or viral genes, can compete in the long term with the parental stock, or whether they are out-competed and disappear like the variants in the Q/? levivirus experiments of Domingo et al. (1978).

Viruses from several different groups, mostly those with RNA genomes, have been shown to have mutation rates similar to those o f Q/ 3 and influenza virus (see Holland et al. 1982; Buonagurio et al. 1986a). Nonetheless most of these viruses or close relatives of them maintain stable populations in the wild. This is shown, for example, by the fact that the effective commercial vaccines prepared against all three poliovirus subtypes and yellow fever flavivirus are prepared from isolates obtained half a century ago, and the isolate of rabies currently used for vaccines is from Pasteur’s time (Holland et al. 1982)! It is also indicated by the close similarity of isolates of turnip yellow mosaic tymovirus (TYM V) from an endemic perennial brassica, Cardam ine lilacina, that is confined to high glacial cirques of the Kosciusko alpine area of south-east Australia (Guy & Gibbs, 1985) to isolates of ‘type strain’ TYM V from Europe; TYM V had previously only been found in north-west Europe. Studies of the biogeography and ecology of these Australian TYM Vs indicate that they have probably been present in the area at least since the end of the last Ice Age, 15 000-12000 years ago, yet restriction endonuclease mapping of their genomes and partial nucleotide sequences of the 3' terminus of their particle protein mRNAs show that their nucleotide sequences differ from those of European ‘type strain’ isolates by no more than 1 % (Blok, Gibbs & Mackenzie, unpublished data).

It is possible that competition between variants, as in the Q/3 levivirus experiments of Domingo et al. (1982), but on a somewhat grander ecological and time scale, may explain how all of these viruses of plants and animals maintain stable populations. Furthermore, although most of the evidence of fast mutation rates of viruses have come from those with RNA genomes, there are no comparable data for sequential isolates of viruses with DNA genomes, so we do not know whether, in the long term, viruses with RNA genomes evolve faster in nature than those with DNA genomes as implied by Holland et al. (1982), and now widely accepted.

Molecular evolution o f viruses 333

E V O L U T I O N A R Y M O D E L S

For several decades the study of evolution by biologists has been dominated by the ‘neo-Darwinian gradualists’, most of whom are population geneticists. They have sought clues from studies of the effects of selection, or lack of it, on chromosome and allozyme variation in extant populations of animals and plants to support the suggestion of Darwin (1859) that organisms mostly evolve at a relatively uniform rate by the serial acquisition of minor mutational changes. Their work has produced much discussion (Dobzhansky, 1970; Lewontin, 1974; White, 1978; Kimura, 1979), but little direct evidence to support the hypothesis. An alternative view proposed by Gould & Eldredge (1977) is that evolution proceeds mostly by ‘punctuated equilibria’; rushes of evolution interspersed with periods of relative stasis.

The rapid appearance of populations of variants of influenza A or enterovirus 70 viruses may correspond to the ‘punctuations’ of Gould and Eldridge’s theory or, in a longer term process, may constitute nothing more than the evolutionary ‘noise’ of the ‘equilibrium’ phase. In a longer time frame, the ‘punctuations’ may be when alliances are formed between gene modules to produce viruses with quite different biochemi­cal and ecological life cycles, or when different tissue specificities are acquired, as occurred early in the evolution of the herpesviruses (Roizman & Batterson, 1985)

It is clear that viruses, like other organisms, evolve at various levels of complexity. Phenotypically neutral evolutionary ‘noise’ seems to dominate the changes that are revealed by comparative studies of closely related viral genes, though there is clear evidence that selective forces at various levels dictate which changes survive at particular sites. At a higher level, there are subtle evolutionary changes analogous to the adaptive changes of development and behaviour of higher organisms, which affect the ecological life cycles of viruses. Those which change most readily are the antigenicity of the particle proteins (as described above for the influenza viruses) and also the virulence of the virus, and both these characters may be modified by single amino acid changes. It has, for example, been shown for several animal viruses, that amino acid changes in the proteins forming the surface of virus particles greatly alter their virulence (Seif et al. 1985; Webster et al. 1986; Meek, 1986). This ability may be a most important ecological attribute, as it has been convincingly shown, for example, that a rapid partial loss of virulence was crucial for the establishment of epidemic myxomatosis when myxoma leporipoxvirus was liberated in Australia to control the rabbit plague (Fenner, 1983).

However, the molecular basis of most of the ecologically important phenotypiccharacters, which have affected the evolution of viruses past and present is unknown. It is becoming an increasingly active area of research at present for it is clear that there is much of practical and intellectual value to learn about the ways in which parasites, such as viruses, engage in an ‘incessant evolutionary dance’ (Haldane,1949; Clarke, 1979) with their hosts and neighbours.

I thank D r Peter Stockley and Dr Peter Colman for very helpful discussions of the protein structure data.

334 A. Gibbs

R E F E R E N C E S

A h l q u i s t , P ., S t r a u s s , E . G ., R ic e , C. M ., S t r a u s s , J . H ., H a s e l o f f , J . & Z im m e rn , D . (1985). Sindbis virus protein nsPl and nsP2 contain homology to nonstructural proteins from several RNA plant viruses. J . Virol. 53, 536-542 .

A i r , G. M. (1981). Sequence relationships among the haemagglutinin genes of 12 subtypes of influenza A virus. Proc. natn. Acad. Set. U .SA . 78, 7639-7643 .

A i r , G. M. & L a v e r , W. G. (1986). The molecular basis of antigenic variation in influenza virus. Adv. Virus Res. (in press).

A lw y n J o n e s , T . & L i l j a s , L . (1984). Structure of satellite tobacco necrosis virus after crystallographic refinements at 2 .5 A resolution. .7. molec. Biol. 177, 7 3 5 -7 6 7 .

A n g e n e n t , G. C ., L i n t h o r s t , H. J . M ., v a n B e lk u m , A . F ., C o r n e l i s s e n , B . J . C. & B o l , J . F . (1986). RN A 2 of tobacco rattle virus strain T C M encodes an unexpected gene. Nucl. Acid Res. 14, 4673-4682 .

A r g o s , P ., K a m e r , G ., N i c k l i n , M. J . H. & W im m er, E . (1984). Similarity in gene organization and homology between proteins of animal picornaviruses and a plant comovirus suggest a common ancestry of these virus families. Nucl. Acid Res. 12, 7251-7267.

B a s s e l - D u b y , R ., J a y a s u r i y a , A ., C h a t t e r j e e , D . , S o n n e n b e r g , N ., M a i z e l , J . V. & F i e l d s , B. N. (1985). Sequence of reovirus haemagglutinin predicts a coiled-coil structure. Nature, Lond. 315, 4 21-423 .

B o c c a r a , M . , H a m i l t o n , W . D . O . & B a u lc o m b e , D . C . (1986). The organization and interviral homologies of genes at the 3' end of tobacco rattle virus RNA 1. EMBO J . 5, 223-229 .

B o t h , G . W ., S l e i g h , M. J . , C ox, N . J . & K e n d a l , A. P . (1983). Antigenic drift in influenza virus H3 hemagglutinin from 1968 to 1980: multiple evolutionary pathways and sequential amino acid changes at key antigenic sites. J. Virol. 48, 5 2 -6 0 .

B o t s t e i n , D . (1980). A theory of modular evolution for bacteriophages. Ann. N . Y. Acad. Sci. 354, 4 8 4 -4 9 1 .

B o y l e , D . B . , C o u p a r , B . E . H ., G ib b s , A. J . , S e ig m a n , L . J . & B o t h , G . W . (1987). Fowlpox virus thymidine kinase: nucleotide sequences and relationships to other thymidine kinases. Virology 156, 355-367 .

B r i t t e n , R. J . (1 9 8 6 ) . Rates of DNA sequence evolution differ between taxonomic groups. Science 231, 1 3 9 3 - 1 3 9 8 .

B r o y l e s , S. S. & M oss, B . (1986). Homology between RNA polymerases of poxviruses, prokaryotes, and eukaryotes: nucleotide sequence and transcriptional analysis of vaccinia virus genes encoding 147-kDa and 22-kDa subunits. Proc. natn. Acad. Sci. U .SA . 83, 3141-3145 .

B u o n a g u r io , D . A ., N a k a d a , S . , P a r v in , J . D . , K r y s t a l , M . , P a l e s e , P . & F it c h , W . M . (1986a). Evolution of human influenza A viruses over 50 years: rapid, uniform rate of change in N S gene. Science 232, 980-982 .

B u o n a g u r i o , D . A ., N a k a d a , S ., F i t c h , W . M. & P a l e s e , P . (1986ft). Epidemiology of influenza C virus in man: multiple evolutionary lineages and low rate of change. Virology 153, 12 -2 1 .

C l a r k e , B. C . (1979). T he evolution of genetic diversity. Proc. R. Soc. B 205, 453-474 .C o r n e l i s s e n , B . J . C . & B o l , J . F . (1984). Homology between the proteins encoded by tobacco

mosaic virus and two tricornaviruses. Plant, mol. Biol. 3, 379-384 .C o r n e l i s s e n , B . J . C . , J a n s s e n , H ., Z u id e m a , D . & B o l , J . F . (1984). C o m p le te n u c le o tid e

s e q u e n c e s o f to b a c c o strea k v iru s RNA 3. Nucl. Acid Res. 12, 2427-2437 .C o r n e l i s s e n , B . J . C . , L i n t h o r s t , H. J . M ., B r e d e r o d e , F . T . & B o l , J. F . (1986). Analysis of

the genome structure of tobacco rattle virus strain PSG . Nucl. Acid. Res. 14, 2157-2169 .Covey, S . N . (1986). Amino acid sequence homology in gag region of reverse transcribing

elements and the coat protein gene of cauliflower mosaic virus. Nucl. Acid Res. 14, 6 23-633D a r w in , C . (1 8 5 9 ) . On the Origin of Species as a Means of N atural Selection. London: John

Murray.D a v is o n , A . J . & M c G e o c h , D . J . (1986). Evolutionary comparisons of the S segments in the

genomes of herpes simplex virus type 1 and varicella-zoster virus. J. gen. Virol. 61, 597-611D o b z h a n s k y , T . (1970). Genetics o f the evolutionary process. New York, London: Colombia

University Press.

Molecular evolution o f viruses 335

D o m ie r , L . L . , F r a n k l i n , K . M ., S h a h a b u d d in , M ., H e l l m a n , G. M ., O v e r m e y e r , J . H ., H ir e m a t h , S . T ., S ia w , M. F . E ., L o m o n o s o f f , G. P ., S h a w , J . G. & R h o a d s , R . E . (1986). T he nucleotide sequence of tobacco vein mottling virus. Nucl. Acid Res. 14, 5417-5430 .

D o m in g o , E . , S a b o , D . , T a n a g u c h i , T . & W e is s m a n n , C. (1978). Nucleotide sequence heterogeneity of an RNA phage population. Cell 13 , 735-744 .

D o v e r , G . A. & T a u t z , D . (1986). Conservation and divergence in multigene families: alternatives to selection and drift. Phil. Trans. R. Soc. Ser. B 312, 275-289 .

E a r l , P. L ., J o n e s , E . V. & M oss, B. (1986). Homology between D N A polymerases of poxviruses, herpesviruses, and adenoviruses: nucleotide sequence of the vaccinia virus DNA polymerase gene. Proc. natn. Acad. Sci. U.S.A. 83, 3659-3663.

E r i c k s o n , J . W ., S i l v a , A . M . , M u r t h y , M . R . N . , F i t a , I. & R o s s m a n n , M . G. (1985). The structure of a T = 1 icosahedral particle from southern bean mosaic virus. Science 229, 625-629 .

F a r a g h e r , S . G. & D a l g a r n o , L . (1986). Regions of conservation and divergence in the 3' untranslated sequences of genomic RNA from Ross River virus isolates. J. molec. Biol. 190, 141-148.

F e n n e r , F . (1983). Biological control, as exemplified by smallpox eradication and myxomatosis. Proc. R. Soc. B 218 , 2 59-285 .

F r a n s s e n , H ., L e u n is s e n , J . , G o l d b a c h , R ., L o m o n o s s o f f , G. & Z im m e rn , D. (1984). Homologous sequences in non-structural proteins from cowpea mosaic virus and picornaviruses. EMBO J . 3, 8 55-861 .

F u k u y a m a , K ., A b d e l - M e g u id , S. S ., J o h n s o n , J . E . & R o s s m a n n , M . G. (1983). Structure of a T = 1 aggregate of alfalfa mosaic virus coat protein seen at 4 ’5 A resolution. .J. molec. Biol. 167, 87 3 -8 9 4 .

G i b b s , A. (1984). Plant viruses; their mode and rate of evolution. Abstr. 6th. Int. Cong. Virol. Sendai, Japan. S 5 -3 .

G i b b s , A . , A i r , G . & L a v e r , G . (1982). Analysis of variation among haemagglutinin genes of influenza A viruses. In Viral Diseases in South-East Asia and the Western Pacific (ed. J . S. Mackenzie), pp. 3 23-327 . Sydney: Academic Press.

G i b b s , A . & F e n n e r , F . (1 9 8 4 ) . M e th o d s fo r co m p a rin g se q u e n ce d ata su ch as re s tr ic tio n en d o n u c le a se m a p s o r n u c le o tid e se q u e n ce s o f v ira l n u c le ic ac id m o le cu le s . J ' . virol. Meth. 9 , 3 1 7 - 3 2 4 . •

G u y , P . L . & G ib b s , A. J . (1985). Further studies on turnip yellow mosaic isolates from an endemic Australian Cardamine. PI. Path. 34, 532-544 .

G o u l d , S. J . & E l d r e d g e , N. (1977). Punctuated equilibria: the tempo and mode of evolution reconsidered. Paleobiology 3, 115-151.

H a h n , B. H ., S h a w , G . M ., T a y l o r , M . E ., R e d f i e l d , R . R . , M a r k h a m , P. D ., S a l a h u d d in ,S . Z . , W o n g - S t a a l , F . , G a l l o , R . C ., P a r k s , E. S . & P a r k s , W . P . (1986). Genetic variation in H L T V -III/L A V over time in patients with AID S or at risk for A ID S. Science 232, 1548-1553. ’

H a l d a n e , J . B. S . (1949). Disease and evolution. Ricerca scient. Suppl. 19, 6 8 -7 6 .H a y a s h id a , H . , T o h , H . , K ik u n o , R. & M iy a t a , T . (1985). E v o lu tio n o f in flu en za v iru s g e n e s.

Molec. Biol. Evol. 2, 289—303.H o g l e , J . M ., C h o w , M. & F i lm a n , D . J . (1985). Three-dimensional structure of poliovirus at

2 -9 Á resolution. Science 229, 1358-1365.H o l l a n d , J . , S p i n d l e r , K ., H o r o d y s k i , F . , G r a b a u , E ., N i c h o l , S . & V a n d e p o l , S . (1982).

R a p id e v o lu tio n o f R N A g e n o m es. Science 215, 1577-1585.H o p p e r , P ., H a r r i s o n , S. C. & S a u e r , R. T . (1984). Structure of tomato bushy stunt virus. V.

Coat protein sequence determination and its structural implications. J . molec. Biol. 177, 70 1 -7 1 3 .

H o s u r , M. V ., S t a u f f a c h e r , C. V., U s h a , R ., S c h m id t , T . , H a r r in g t o n , M ., T u c k e r , R. C. & J o h n s o n , J . E . (1986). The structures of cowpea mosaic virus and black beetle virus determined by single crystal X -ray diffraction methods. Abstr. of the EMBO Workshop: Molecular Plant Virology, Wageningen, The Netherlands; July 1986. p. 22.

K a m e r , G. & A r g o s , P. (1984). Primary structural comparisons of RNA-dependent polymerases from plant animal and bacterial viruses. Nucl. Acid Res. 12, 7269-7282 .

K im u r a , M. (1979). The neutral theory of molecular evolution. Scient. Am. 241, 9 8 -1 2 6 .

336 A. Gibbs

K w o h , T . J . & E n g l e r , J . A . (1 9 8 4 ) . T h e n u c le o tid e se q u e n ce o f th e ch ic k e n th y m id in e k in a se g e n e an d th e re la tio n sh ip o f its p re d ic te d p o ly p e p tid e to th a t o f th e v a cc in ia v iru s th y m id in e k in a se . Nucl. Acid. Res. 12, 3 9 5 9 - 3 9 7 1 .

L e w o n t i n , R . C. (1974). The genetic basis of evolutionary change, pp. 289. New York, London: Columbia University Press.

M a c k e t t , M . & A r c h a r d , L . C. (1979). Conservation and variation in Orthopoxvirus genome structure. J . gen. Virol. 45, 683—701.

M a t t h e w s , R . E . F . (1982). Classification and nomenclature of viruses. Intervirology 17, 1-2 0 0 .M c G e o c h , D . J. & D a v is o n , A. J . (1 9 8 6 ) . Alphaviruses possess a gene homologous to the protein

kinase gene family of eukaryotes and retroviruses. Nucl. Acid Res. 14, 1 7 6 5 - 1 7 7 7 .M c G e o c h , D . J ., D o l a n , A ., D o n a l d , S . & B r a u e r , D . H. K . (1986). Complete D N A sequence

of the short repeat region in the genome of herpes simplex virus type 1. Nucl. Acid Res. 14, 1727-1745.

M c L a c h l a n , A. D ., B lo o m e r , A. C. & B u t l e r , P. J . G. (1980). Structural repeats and evolution of tobacco mosaic virus coat protein and RNA. J . mol. Biol. 136, 2 03-224 .

M e e k , A. D. J . (1986). Genetic and Phenotypic Studies on Virulence variants of Ross River virus. Ph.D . thesis, Australian National University, Canberra.

M e i e r - E w e r t , H ., G i b b s , A. J. & D im m o c k , N. J. (1970). Studies on antigenic variations of the haemagglutinin and neuraminidase of swine influenza virus isolates. J. gen. Virol. 6, 40 9 -4 1 9 .

M e s h i , T ., O h n o , T ., Ib a , H. & O k a d a , T . (1981). Nucleotide sequence of a cloned cD N A copy of TM V (cowpea strain) RNA, including the assembly origin, the coat protein, and the 3' non­coding region. Molec. Gen. Genet. 184, 2 0 -2 8 .

M e y e r , M . , H e m m e r, O . , M a y o , M . A. & F r i t s c h , C . (1986). T h e n u c le o tid e s e q u e n ce o f to m a to b la c k r in g v iru s RN A -2. J. gen. Virol. 67, 1257—1271.

M i l l e r , R . H . & R o b in s o n , W . S . (1 9 8 6 ) . C o m m o n ev o lu tio n a ry o rig in o f h e p a tit is B v iru s an d re tro v iru se s . Proc. natn. Acad. Sci. U .SA. 8 3 , 2 5 3 1 - 2 5 3 5 .

M in o r , P. D ., J o h n , A ., F e r g u s o n , M . & I c e n o g l e , J . P. (1986). Antigenic and molecular evolution of the vaccine strain of type 3 poliovirus during the period of excretion by a primary vacinee. J . gen. Virol. 67, 693-706 .

M iy a m u r a , K . , T a n i m u r a , M . , T a k e d a , N ., K o n o , R. & Y a m a z a k i , S. (1986). Evolution of enterovirus 70 in nature: all isolates were recently derived from a common ancestor. Arch. Virol. 89, 1 -1 4 . ^

N a m b a , K . & S t u b b s , G. (1986). Structure of tobacco mosaic virus at 3■ 6 A resolution: implications for assembly. Science 231, 1401-1406.

N o t t a y , B. K ., K e w , O . M ., H a t c h , M. H ., H e y w a r d , J. T . & O b i je s k i , J. F . (1981). Molecular variation of tvpe 1 vaccine related and wild polioviruses during replication in humans. Virology 108, 40 5 -4 2 3 .

O l s o n , A. J . , B r i c o g n e , G. & H a r r i s o n , S. C. (1983). Structure of tomato bushy stunt virus. IV. T he virus particle at 2-9 A resolution. J. molec. Biol. 171, 6 1 -9 3 .

R e a n n e y , D. (1984). The molecular evolution of viruses. In The Microbe:part 1. The Viruses, (ed.B. W . J. Mahy & J. R. Pattison), pp. 175-196. Cambridge: Cambridge University Press.

R e i s n e r , A . H . (1985). Similarity between the vaccinia virus 19k early protein and epidermal growth factor. Nature, Lond. 313, 801-802 .

R o b e r t s , M. M ., W h it e , J . L ., G r u t t e r , M. G . & B u r n e t t , R . M. (1986). Three-dimensional structure of the adenovirus major coat protein hexon. Science 232, 1148-1151.

R o iz m a n , B . & B a t t e r s o n , W. (1985). Herpesviruses and their replication. In Virology (ed. B . N. Fields), pp. 4 9 7 -5 2 6 . New York: Raven.

R o s e , J . K ., D o o l i t t l e , R . F ., A n i l io n i s , A . , C u r t i s , P. J . & W u n n e r , W . H. (1982). Homology between the glycoproteins of vesicular stomatitis virus and rabies virus. J. Virol. 43, 361-364 .

R o s s m a n , M. G ., A b a d - Z a p a t e r o , C ., H e r m o d s o n , M. A . & E r i c k s o n , J. W . (1983a). Subunit interactions in southern bean mosaic virus. J . molec. Biol. 166, 37 -8 3 .

R o s s m a n n , M . G ., A b a d - Z a p a t e r o , C ., M u r t h y , M . R . N ., L i l j a s , L . , A lw y n J o n e s , T . & S t r a n d b e r g , B . (1 9 8 3 6 ) . S tr u c tu r a l co m p a riso n s o f so m e sm all sp h e r ic a l p la n t v iru se s . J . molec. Biol. 165, 7 1 1 - 7 3 6 .

R o s s m a n n , M. G. & A r g o s , P. (1981). Protein folding. A. Rev. Biochem. 50, 497-532 .R o s s m a n n , M . G . , A r n o l d , E . , E r ic k s o n , J. W ., F r a n k e n b e r g e r , E . A . , G r i f f it h , J . P .,

H e c h t , H . - J . , J o h n s o n , J . E . , K a m e r , G . , L u o , M ., M o s s e r , A . G . , R u e c k e r t , R . R . ,

Molecular evolution o f viruses 337

S h e r r y , B. & V r i e n d , G. (1985). Structure of a common cold virus and functional relationships to other picornaviruses. Nature, ljond. 317, 145-153.

S a i t o u , N . & N e i , M . (1 9 8 6 ) . P o ly m o rp h ism an d ev o lu tio n o f in flu en za v iru s g e n e s. Molec. Biol. Ei'ol. 3, 5 7 -7 4 .

S f. i f , I., C o u l o n , P ., R o l l i n , P. E . & F l a m a n d , A . (1985). Rabies virulence: effect on pathogenicity and sequence characterization of rabies virus mutations affecting antigenic site III of the glycoprotein. J . Virol. 53, 9 26-934 .

S h a r p , P. M. (1 9 8 6 ) . Molecular evidence of bacteriophages: evidence of selection against the recognition sites of host restriction enzymes. Molec. Biol. Evol. 3, 7 5 - 8 3 .

S i b l e y , C. G. & A h l q u i s t , J. E . (1984). The phylogeny of the hominoid primates, as indicated by D NA-DNA hybridization. J. molec. Evol. 20, 2 -1 5 .

SMITHIES, O. & POWERS, P . A. (1986). Gene conversions and their relation to homologous chromosome pairing. Phil. Trans. R. Soc. Ser. B 312, 291-302 .

S o e d a , E ., M a r u y a m a , T ., A r r a n d , J . R. & G r i f f i n , B. (1980). Host-dependent evolution of three papovaviruses. Nature, Land. 285, 165-167.

T a n i m u r a , M . , M i y a m u r a , K . & T a k e d a , N. (1985). Construction of a phylogenetic tree of enterovirus 70. Ja p . J . Genet. 60, 137-150.

T o h , H . , H a y a s h i d a , H . & M i y a t a , T . (1983). Sequence homology between retroviral reverse transcriptase and putative polymerases of hepatitis B virus and cauliflower mosaic virus. Nature, bond. 305, 8 27-829 .

W e b s t e r , R. G ., K a w a o k a , Y . & B e a n , W . J . J r . (1986). Molecular changes in A/chicken/Penn- svlvania/83 (H 5N 2) influenza virus associated with the acquisition of virulence. Virology 149, 165-173. '

W e b s t e r , R. G ., L a v e r , W. G ., A i r , G. M. & S c h i l d , G. C. (1982). Molecular mechanisms of variation in influenza viruses. Nature, Land. 296, 115-121.

W e s t a w a y , E . G . , B r in t o n , M. A ., G a id a m o v ic h , S. Y ., H o r z in e k , M. C ., I g a r s h i , A., K a a r ia in e n , L . , L v o v , D . K . , P o r t e r f ie l d , J . S ., R u s s e l l , P . K . & T r e n t , D . W . (1 9 8 5 ) . T o g a v ir id a e . Intervirology 2 4 , 1 2 5 -1 3 9 .

W h i t e , M. J . D. (1978). Modes of Speciation, pp. 465. Freeman: San Francisco.W i l s o n , A. C . , C a r l s o n , S. S. & W h i t e , T . J. (1977). Biochemical evolution. A. Rev. Biochem.

46, 5 73-639 .W i l s o n , I. A ., S k e h e l , J . J . & W i l e y , D. C . (1981). Structure of the haemagglutinin membrane

glycoprotein of influenza virus at 3 A resoltion. Nature, Lond. 289, 366-373 .Y a m a m o t o , K . & Y o s h i k u r a , H. (1986). Relation between genomic and capsid structures in RNA

viruses. Nucl. Acid Res. 14, 389-396 .Y u k i , S . , I s h im a r u , S . , In o u y e , S . & S a ig o , K . (1986). Id e n tif ica t io n o f g e n e s fo r re v erse

tr a n s cr ip ta se - lik e en z y m es in tw o Drosophila re tro tra n sp o so n s , 412 , an d g y p s y ; a rap id d e te c tio n m eth o d o f re v e rse tr a n s cr ip ta se g en es u sin g Y X D D b o x p ro b e s . Nucl. Acid Res. 14, 3017-3030.