Upload
others
View
0
Download
0
Embed Size (px)
Citation preview
1
RESEARCH ARTICLE 1
2 The F-box Protein SAGL1 and ECERIFERUM3 Regulate Cuticular Wax 3
Biosynthesis in Response to Changes in Humidity in Arabidopsis 4
5 Hyojin Kima,1, Si-in Yua,1, Seh Hui Jungb, Byeong-ha Leea,2, and Mi Chung Suha,2 6
7 a Department of Life Science, Sogang University, Seoul 04107, Republic of Korea 8 b Department of Bioenergy Science and Technology, Chonnam National University, 9 Gwangju 61186, Republic of Korea 10 1 These authors contributed equally to this work. 11 2 Corresponding Authors: [email protected] and [email protected]. 12
13 Short title: SAGL1-CER3 function in wax biosynthesis 14
15 One-sentence summary: The Arabidopsis F-box protein SAGL1 mediates 16 proteasome-dependent degradation of ECERIFERUM3, thereby negatively regulating 17 cuticular wax biosynthesis in response to changes in humidity. 18
19 The authors responsible for distribution of materials integral to the findings presented in 20 this article in accordance with the policy described in the Instructions for Authors 21 (www.plantcell.org) are: Mi Chung Suh ([email protected]) and Byeong-ha Lee 22 ([email protected]). 23
24 ABSTRACT 25
26 Cuticular waxes, which cover the aboveground parts of land plants, are essential for plant 27 survival in terrestrial environments. However, little is known about the regulatory 28 mechanisms underlying cuticular wax biosynthesis in response to changes in ambient 29 humidity. Here, we report that the Arabidopsis thaliana Kelch repeat F-box protein 30 SMALL AND GLOSSY LEAVES1 (SAGL1) mediates proteasome-dependent 31 degradation of ECERIFERUM3 (CER3), a biosynthetic enzyme involved in the production 32 of very long chain alkanes (the major components of wax), thereby negatively regulating 33 cuticular wax biosynthesis. Disruption of SAGL1 led to severe growth retardation, 34 enhanced drought tolerance, and increased wax accumulation in stems, leaves, and 35 roots. Cytoplasmic SAGL1 physically interacts with CER3 and targets it for degradation. 36 GUS expression was observed in the roots of pSAGL1:GUS plants but was barely 37 detected in aerial organs. High humidity-induced GUS activity and SAGL1 transcript 38 levels were reduced in response to abscisic acid treatment and water deficit. SAGL1 39 levels increase under high humidity, and the stability of this protein is regulated by the 40 26S proteasome. These findings indicate that the SAGL1-CER3 module negatively 41 regulates cuticular wax biosynthesis in Arabidopsis in response to changes to humidity, 42 and they highlight the importance of permeable cuticle formation in terrestrial plants 43 under high-humidity conditions. 44
Plant Cell Advance Publication. Published on July 18, 2019, doi:10.1105/tpc.19.00152
©2019 American Society of Plant Biologists. All Rights Reserved
2
INTRODUCTION 45
During evolution, land plants developed a hydrophobic cuticle that covers the surfaces of 46
their aerial organs. This adaptation is essential for plant survival in the terrestrial 47
environment, where water is scarce and plants are exposed to excess light, including 48
ultraviolet light (Riederer and Schreiber, 2001; Kunst and Samuels, 2003; Pollard et al., 49
2008; Samuels et al., 2008; Nawrath et al., 2013; Li-Beisson et al., 2013; Yeats and Rose, 50
2013). The outermost part of the cuticle is covered with epicuticular wax, which often 51
forms crystals and provides protection by reflecting incident light. The wax molecules 52
(intracuticular waxes) underneath the epicuticular wax layer are embedded in a cutin 53
polyester matrix (Pollard et al., 2008; Li-Beisson et al., 2013; Schuster et al., 2016). Both 54
epi- and intracuticular waxes are mainly composed of very long chain fatty acids (VLCFA, 55
C20 to C34), their modified derivatives (aldehydes, primary and secondary alcohols, 56
ketones), VLC alkanes, and wax esters. In addition to protecting plants from high levels of 57
irradiation and UV light, cuticular waxes minimize non-stomatal water loss. These waxes 58
also contribute to self-cleaning of the aerial surface of the plant by preventing the 59
adhesion of dust and other debris, which is important for efficient photosynthesis (Jetter 60
et al., 2006; Samuels et al., 2008; Li-Beisson et al., 2013; Lee and Suh, 2015; Wang et al., 61
2015). 62
Cuticular wax biosynthesis occurs in epidermal cells (Suh et al., 2005). C16 and 63
C18 fatty acyl groups are synthesized in plastids and activated to become acyl-CoAs (Li- 64
Beisson et al., 2013). These molecules are transported to the endoplasmic reticulum (ER) 65
where they are elongated (up to C28) by a fatty acid elongase (FAE) complex consisting 66
of β-ketoacyl-CoA synthase (KCS), β-ketoacyl-CoA reductase (KCR), 67
β-hydroxyacyl-CoA dehydratase (HCD), and enoyl-CoA reductase (ECR). C28 VLC 68
acyl-CoAs are further elongated (up to C34) in the ER by the combination of a FAE 69
complex and ECERIFERUM2 (CER2) or CER2-like proteins (Haslam and Kunst, 2013; 70
Lee and Suh, 2013; Li-Beisson et al., 2013). The VLCFAs are modified to form VLC 71
aldehydes, VLC alkanes, VLC ketones, and VLC secondary alcohols by an 72
alkane-forming pathway and VLC primary alcohols and wax esters by an alcohol-forming 73
pathway (Domergue et al., 2010; Li et al., 2008; Rowland et al., 2006; Greer et al., 2007). 74
The CER1/CER3/cytochrome b5 (CYTB5) complex mediates the production of VLC 75
alkanes, the major wax components in the aerial organs of Arabidopsis thaliana (Aarts et 76
al., 1995; Chen et al., 2003; Bernard et al., 2012). Cuticular wax molecules produced in 77
the ER are secreted into the extracellular space by ATP-binding cassette (ABC) 78
transporters integrated in the plasma membrane (PM) with the help of 79
3
glycosylphosphatidyl-anchored lipid transfer proteins (LTPGs) anchored in the outer 80
leaflet of the PM (Bird et al., 2007; DeBono et al., 2009; Lee et al., 2009; McFarlane et al., 81
2010; Kim et al., 2012). The wax molecules are then deposited on the outermost surfaces 82
of aboveground plant organs. Total wax loads are differentially deposited in an 83
organ-specific manner and in response to changing environments (Kosma et al., 2009; 84
Seo et al., 2011; Lee and Suh, 2015). In particular, significantly higher levels of cuticular 85
waxes are deposited in the cuticles of plants grown under arid vs. high humidity 86
conditions (Shepherd and Wynne Griffiths, 2006; Wang et al., 2016). However, limited 87
information is available about the regulatory mechanisms underlying cuticular wax 88
biosynthesis in response to changes in ambient humidity. 89
Cuticular wax biosynthesis is regulated at the transcriptional, post-transcriptional, 90
and post-translational levels (Lee and Suh, 2015). Transcriptome analysis of Arabidopsis 91
showed that genes involved in cuticular wax biosynthesis were expressed at significantly 92
higher levels in stem epidermal peels compared to stems (Suh et al., 2005), suggesting 93
that cuticular wax biosynthesis is controlled at the transcriptional level. Consistent with 94
this hypothesis, several transcription factors have been identified that are important for 95
inducing or repressing wax biosynthetic genes in response to drought, pathogen 96
infection, or darkness, including WAX INDUCER1/SHINE1, MYB30 (myeloblastosis), 97
MYB96, MYB94, and Decrease Was biosynthesis (DEWAX) (Aharoni et al., 2004; 98
Raffaele et al., 2008; Seo et al., 2011; Oshima et al., 2013; Go et al., 2014; Lee et al., 99
2016). 100
The upregulation of wax biosynthesis in stems compared to leaves is mediated by 101
the transcription factor WRINKLED4, which is abundantly expressed in the stem 102
epidermis (Park et al., 2016). Hooker et al. (2007) and Lam et al. (2012 and 2015) 103
reported that CER3 transcript levels in epidermal cells are controlled by the ribonuclease 104
CER7, a core subunit of the RNA-degrading exosome complex. In addition, 105
characterization of the cer9 mutant, with increased cuticular lipid levels and drought 106
tolerance, suggested that CER9 (a RING-type E3 ubiquitin ligase) degrades damaged, 107
misfolded, or unfolded proteins involved in cuticular lipid synthesis via the ubiquitin-26S 108
proteasome system (Lü et al., 2012). Chromatin remodeling resulting from the 109
monoubiquitination of histone H2B proteins by the RING-type E3 ligases, HISTONE 110
MONOUBIQUITINATION1 (HUB1) and HUB2, is involved in upregulating cuticular lipid 111
biosynthetic genes ATT1 (for aberrant induction of type three genes), HOTHEAD, Long 112
Chain Acyl-CoA Synthase2 (LACS2), and CER1 (Ménard et al., 2014). Two RING-type 113
E3 ligases, MYB30-INTERACTING E3 LIGASE1 (MIEL1) and DROUGHT 114
4
HYPERSENSITIVE (DHS), negatively regulate cuticular wax accumulation (Lee et al., 115
2017; Wang et al., 2018). Although MIEL1 interacts with both MYB96 and MYB30, the 116
regulation of cuticular wax biosynthesis mainly occurs via the control of MYB96 stability in 117
Arabidopsis inflorescence stems (Lee and Seo, 2016; Lee et al., 2017). Total wax loads 118
decreased in rice (Oryza sativa) plants overexpressing DHS but increased in dhs rice 119
mutants compared to the wild type. DHS shows E3 ubiquitin ligase activity and is involved 120
in the proteasome-mediated degradation of the homeodomain-leucine zipper IV protein 121
ROC4, which positively regulates wax biosynthesis (Wang et al., 2018). 122
The regulation of protein stability via the covalent attachment of ubiquitin protein is a 123
key regulatory mechanism underlying diverse biological processes during plant growth 124
and development or under abiotic stress conditions (Santner and Estelle, 2010; Shu and 125
Yang, 2017). Protein ubiquitination involves three sequential reactions catalyzed by 126
ubiquitin-activating enzyme (E1), ubiquitin-conjugating enzyme (E2), and ubiquitin-ligase 127
(E3). Arabidopsis harbors 2, 37, and 1,500 genes encoding E1, E2, and E3 enzymes 128
(Mazzucotelli et al., 2006; Lee and Kim, 2011), respectively. E3 ubiquitin ligases are 129
present in a single component or multicomponent complex (Cardozo and Pagano, 2004). 130
The Skp1-Cul1-F-box protein (SCF) complex belongs to a multicomponent ubiquitin 131
ligase complex. The F-box proteins in this complex are substrate recognition components 132
whose specificity is determined by C-terminal protein-protein binding domains such as 133
Leucin-Rich Repeat (LRR), Kelch, and WD-40 repeats (Cardozo and Pagano, 2004; 134
Mazzucotelli et al., 2006). Arabidopsis contains more than 100 Kelch repeat F-box 135
proteins (KFBs), which were initially identified in fruitfly (Drosophila melanogaster) (Xue 136
and Cooley, 1993; Sun et al., 2007; Schumann et al., 2011). Many plants also contain 137
proteins with Kelch motifs, including moss (Physcomitrella patens), pine (Pinus taeda), 138
poplar (Populus trichocarpa), Brassica rapa, rice, and maize (Zea mays) (Sun et al., 139
2007). KFBs contain at least one Kelch motif harboring four conserved residues: two 140
adjacent glycines (G) and a pair of tyrosine (Y) and trytophan (W) residues separated by 141
approximately six residues (Adams et al., 2000; Prag and Adams, 2003). To date, only a 142
few KFBs have been characterized in Arabidopsis. These KFBs are involved in flowering 143
time and circadian control, flavonoid biosynthesis, and the brassinosteroid signal 144
transduction pathway (Nelson et al., 2000; Yasuhara et al., 2004; Kim et al., 2007; Sawa 145
et al., 2007; Zhang et al., 2017; Zhu et al., 2017). 146
In the current study, we investigated the negative regulatory mechanisms underlying 147
posttranslational control of cuticular wax biosynthesis. Specifically, we performed 148
genetic, molecular, and biochemical analysis of the Arabidopsis sagl1-1 (small and 149
5
glossy leaves 1-1) and sagl1-2 mutants, with small, waxy leaves and severe dwarf 150
phenotypes. The SAGL1 gene encodes a Kelch-motif containing F-box protein that 151
controls the stability of CER3. SAGL1 is upregulated by relatively high humidity (>90% 152
RH) but downregulated by relatively low humidity (50–60% RH), water deficit, and 153
abscisic acid (ABA) treatment. Furthermore, increased SAGL1 protein levels were 154
observed under relatively high humidity. SAGL1 regulates CER3 protein levels in 155
response to changes in humidity. These observations indicate that the SAGL1-dependent 156
posttranslational regulatory mechanism contributes to the negative regulation of cuticular 157
wax biosynthesis in Arabidopsis. The SAGL1-CER3 module might represent a key 158
regulator that maintains the homeostasis of cuticular wax biosynthesis in terrestrial plants 159
under different moisture conditions. 160
161
162
RESULTS 163
164
Genetic Mapping of sagl1-1 and Candidate Gene Analysis Identify the SAGL1 Gene 165
166
A screen for Arabidopsis mutants showing defective growth and development resulted in 167
the identification of a mutant line with alterations in leaf morphology and development. 168
This mutant had small, thick, glossy leaves and was thus named sagl1-1 (small and 169
glossy leaves 1-1) (Figure 1A to 1D; Supplemental Data Set 1). Compared to its 170
background C24 accession, sagl1-1 plants were smaller, with shiny dark green leaves, 171
glossy stems, abnormal phyllotaxy, and altered root architecture (Figure 1E to 1J). These 172
growth phenotypes became prominent in 3-week-old plants (Figure 1K and Figure 1L). 173
To identify the gene responsible for the sagl1-1 phenotypes, we performed positional 174
cloning using previously reported or newly developed simple sequence length 175
polymorphism (SSLP) markers (Lukowitz et al., 2000). From the F2 progeny derived from 176
a cross between sagl1-1 and wild type Landsberg erecta (Ler) plants, individuals with 177
small, shiny, and dark green leaves were selected for mapping. Initial mapping using 32 178
F2 progenies suggested that the SAGL1 locus is located on the middle of chromosome 1. 179
Fine mapping further narrowed down the mutation to the F7A10 BAC clone in the middle 180
region of chromosome 1 (Figure 2A). We sequenced the genes located in this region and 181
found a putative mutation in the At1g55270 gene in sagl1-1. In sagl1-1, an 11 bp fragment 182
(392th bp to 402th bp from the start codon of the At1g55270 open reading frame [ORF]) 183
was deleted, which would result in premature termination of translation. To confirm that 184
6
we successfully cloned the SAGL1 gene, we subcloned a genomic DNA fragment 185
containing the 2001 bp region upstream of the translation start codon, the 1593 bp of the 186
ORF, and the 573 bp region downstream of the stop codon of At1g55270 into a binary 187
vector and introduced it into the sagl1-1 mutant by Agrobacterium-mediated 188
transformation. The selected transgenic plants (T1) containing the SAGL1 genomic DNA 189
fragment did not display any of the developmental defects of sagl1-1 (Figure 2B to 2E). 190
These results demonstrate that At1g55270 is SAGL1. This gene has two exons and one 191
intron with a 1305 bp coding sequence encoding a 434 amino acid protein with a 192
molecular mass of ~49.2 kD (Figure 2A and 2F). SAGL1 was annotated to encode a 193
Kelch-repeat F-box protein. Protein domain analysis predicted that SAGL1 contains a 194
F-box domain and three Kelch domains. The sagl1-1 mutation would result in the 195
absence of all of these domains (Figure 2F). 196
We also obtained a T-DNA insertion allele (SALK_097761) of sagl1 containing a 197
T-DNA insertion in the SAGL1 intron from the Arabidopsis Biological Resource Center 198
(Figure 2G). We isolated the SALK_097761 homozygote for the T-DNA insertion in 199
SAGL1 and named this allele sagl1-2. We measured SAGL1 transcript levels in sagl1-2 200
by RT-PCR. sagl1-2 failed to accumulate SAGL1 transcripts, suggesting that sagl1-2 is 201
likely a knock-out mutant (Figure 2H). Like sagl1-1, sagl1-2 displayed developmental 202
defects including small, thick, waxy, dark green leaves, a small plant stature, and altered 203
root morphology (Figure 2I to 2L). We crossed sagl1-2 to sagl1-1 and found that all F1 204
seedlings showed the sagl1 phenotypes, further confirming the notion that At1g55270 is 205
SAGL1 (Supplemental Figure 1). 206
207
sagl1 Exhibits Enhanced Drought Tolerance 208
209
One of the distinguishing features of the sagl1 mutants is their shiny but waxy leaf and 210
stem surfaces (Figure 1 and 2; Supplemental Figure 1). This observation suggests that 211
the sagl1 mutants might accumulate more cuticular waxes on their leaves than the wild 212
type (WT). Thus, we reasoned that the sagl1 mutants might exhibit enhanced drought 213
tolerance due to reduced non-stomatal conductance. To test our hypothesis, we stopped 214
supplying water to both WT and sagl1 (sagl1-1 and sagl1-2) plants for 12 days. After 12 215
days, the WT plants turned yellow and died, but the sagl1 mutants survived and still 216
appeared green (Figure 3A). We also compared water loss between WT and both sagl1-1 217
and sagl1-2 alleles after exposing detached rosette leaves of each plant to dry air. The 218
results of water loss measurements also supported our hypothesis; both sagl1 mutant 219
7
alleles showed lower water loss rates than the respective WT (C24 and Col-0) (Figure 3B; 220
Supplemental Data Set 1). To ensure that these results were indeed due to reduced 221
non-stomatal conductance, we compared the stomatal density and stomatal sensitivity to 222
ABA between WT and sagl1. The stomatal densities of the sagl1 mutants were almost 223
indistinguishable from their respective WT; in one square millimeter of leaf epidermis, 224
C24 and sagl1-1 contained 175.6 ± 10.9 and 173.4 ± 10.5 stomata, respectively, whereas 225
Col-0 and sagl1-2 contained 132.5 ± 5.9 and 136.2 ± 8.6 stomata, respectively (Figure 3C; 226
Supplemental Data Set 1). In addition, the stomatal sensitivity results (expressed as 227
relative stomatal aperture size in response to 2 PM ABA) showed that the stomata of WT 228
and sagl1 plants were closing at very similar rates (Figure 3D; Supplemental Data Set 1). 229
Taken together, these results suggest that the improved drought tolerance of the sagl1 230
mutants is likely due to reduced non-stomatal conductance and not to altered stomatal 231
regulation. 232
233
sagl1 Mutations Affect Cuticle and Cell Wall Ultrastructure and Cuticular Wax Load 234
235
The waxy phenotype and drought tolerance of the sagl1 mutants prompted us to examine 236
the ultrastructure of the sagl1 cuticle by scanning and transmission electron microscopy 237
(SEM and TEM, respectively). In the SEM images, typical epicuticular wax crystals, 238
including vertical rods, tubes, longitudinal bundles of rodlets, and horizontal and reticulate 239
platelets, were observed on both WT (C24 and Col-0) and sagl1 (sagl1-1 and sagl1-2) 240
stems (Figure 4A to 4D). The density of wax crystals was higher on sagl1 stems 241
compared to WT, particularly vertical rods (Figure 4A to 4D). TEM analysis of leaf 242
epidermal cells of WT (Col-0) and sagl1-2 revealed that the thickness of the cuticle and 243
adjacent cell walls increased by approximately 2-fold and 1.3-fold, respectively, in sagl1-2 244
compared to WT (Figure 4E to 4H; Supplemental Data Set 1). 245
We further analyzed the differences in epicuticular wax crystal abundance and cuticle 246
thickness in the sagl1 mutants by performing cuticular wax analysis using gas 247
chromatography with flame ionization detection (GC-FID). As expected, total wax loads 248
increased by approximately 2- and 1.6-fold in sagl1-1 and sagl1-2 leaves relative to C24 249
and Col-0 WT, respectively (Figure 5A; Supplemental Figure 2A; Supplemental Data Set 250
1). Similarly, the levels of alkanes (the major wax component in leaves) increased by 251
approximately 2.2-fold and 2-fold in sagl1-1 and sagl1-2 leaves, respectively vs. WT 252
(Figure 5B; Supplemental Figure 2A; Supplemental Data Set 1). In stems, the total wax 253
loads were also greater in sagl1-1 (~1.6 fold) and sagl1-2 (~1.3 fold) relative to their 254
8
respective WT (Figure 5C; Supplemental Figure 2B; Supplemental Data Set 1) due to 255
increased levels of all wax components in the stems of both sagl1 mutants (Figure 5D; 256
Supplemental Figure 2B; Supplemental Data Set 1). In four-week-old roots, total aliphatic 257
wax loads increased by approximately 1.8-fold, but sterols and aromatic wax loads 258
decreased by approximately 1.4-fold, in sagl1-1 compared to the WT. The levels of FAs 259
(C24, C26, and C30), PAs (C22, C26, C28, and C30), and alkanes (C29 and C31) 260
increased by approximately 1.7- to 5.7-fold in sagl1-1 compared to the WT, whereas the 261
levels of C20 and C22 FAs, C22 MAGs, and alkyl coumarates significantly decreased in 262
the mutant. Interestingly, we detected alkyl ferulates and alkyl caffates in the waxes of 263
WT roots but not sagl1-1 (Figure 5E and 5F; Supplemental Figure 2C; Supplemental Data 264
Set 1). 265
We analyzed the levels and compositions of cutin monomers analyzed from the 266
leaves and stems of WT (C24 and Col-0), sagl1-1, and sagl1-2 by GC-FID and GC-mass 267
spectrometry (GC-MS). Compared to WT, the total cutin monomer loads were 268
significantly elevated in the stems and leaves of both sagl1 mutants (Figure 5G and 5H). 269
In particular, a prominent increase in C18:2 dicarboxylic acid levels was observed in the 270
leaves of sagl1-1 and stems of both sagl1 mutants, although minor increases in the levels 271
of other components were also detected (Figure 5I and J; Supplemental Figure 3; 272
Supplemental Data Set 1). 273
274
SAGL1 Decreases CER3 Stability 275
276
The complex altered wax phenotype of the sagl1 mutants, which showed elevated levels 277
of almost all wax components, did not provide clues about the potential targets of the 278
F-box protein, SAGL1, among proteins involved in cuticular wax biosynthesis and 279
deposition. Thus, we generated transgenic Arabidopsis plants overexpressing SAGL1 280
under the control of the cauliflower mosaic virus (CaMV) 35S promoter (Supplemental 281
Figure 4A). Genomic DNA PCR and RT-PCR analyses showed that the SAGL1 gene was 282
successfully introduced and overexpressed in Arabidopsis (Col-0) (Supplemental Figure 283
4B and 4C). We analyzed cuticular wax composition and levels in the stems of 13 284
independent transgenic Arabidopsis lines overexpressing SAGL1. Compared to other 285
wax components, alkane levels were significantly reduced in SAGL1-overexpressing 286
plants (Supplemental Figure 4D), suggesting that CER1, CER3, and CYTB5D, which are 287
involved in the production of VLC alkanes from VLCFAs, are putative targets of SAGL1 288
(Bernard et al., 2012). In a subsequent analysis of cutin monomers, no remarkable 289
9
differences were observed in total cutin monomer composition and levels in stems of WT 290
vs. the SAGL1 OX lines (OX9, OX11, and OX12) (Supplemental Figure 4E; Supplemental 291
Data Set 1). 292
To examine if CER1, CER3, and/or CYTB5D proteins are substrates of SAGL1, we 293
constructed three binary vectors expressing CER1, CER3, or CYTB5D fused with the 294
MYC epitope tag under the control of the CaMV 35S promoter, introduced them into 295
Agrobacterium, and infiltrated them into Nicotiana benthamiana leaves. Total proteins 296
were extracted from N. benthamiana leaves transiently expressing MYC:CER1, 297
MYC:CER3, or MYC:CYTB5D in the presence or absence of eYFP (encoding enhanced 298
yellow fluorescent protein) or SAGL1:eYFP expression. Among the candidate target 299
proteins, the levels of MYC:CER3 were noticeably reduced in leaves co-expressing 300
MYC:CER3 and SAGL1:eYFP relative to those expressing MYC:CER3 and eYFP (Figure 301
6A; Supplemental Figure 5A and 5B). By contrast, no significant decrease in the level of 302
MYC, MYC:CER1, or MYC:CYTB5D was observed when MYC, MYC:CER1, or 303
MYC:CYTB5D was co-expressed with SAGL1:eYFP or eYFP in N. benthamiana leaves 304
(Supplemental Figure 5A and 5B). The degradation of MYC:CER3 was not observed in 305
the presence of MG132, a chemical inhibitor of the 26S proteasome (Figure 6A; 306
Supplemental Figure 5C). In addition, when MYC:CER3 was co-expressed with SAGL1 307
lacking the F-box domain (SAGL1△F), the degradation of MYC:CER3 was inhibited 308
(Figure 6B; Supplemental Figure 5D). These results suggest that SAGL1 is involved in 309
targeting CER3 for degradation by the 26S proteasome. 310
To determine if SAGL1 directly interacts with CER3, we performed 311
coimmunoprecipitation (Co-IP) assays. For this purpose, MYC:CER3 was transiently 312
expressed with or without SAGL1:eYFP in N. benthamiana leaves, and crude proteins 313
were immunoprecipitated using anti-MYC antibody-conjugated agarose beads. 314
MYC:CER1 or MYC:CYTB5D and SAGL1:eYFP were also coexpressed, 315
coimmunoprecipitated, and subjected to immunoblot analysis using anti-MYC and 316
anti-GFP antibodies as a control. When MYC:CER3 was immunoprecipitated, 317
SAGL1:eYFP was immunoprecipitated as well (Figure 6C; Supplemental Figure 5E). 318
However, SAGL1:eYFP was not visibly detected when MYC:CER1 or MYC:CYTB5D was 319
immunoprecipitated using anti-MYC antibody-conjugated agarose beads (Supplemental 320
Figure 5E). In addition, we investigated whether CER3 is ubiquitinated by SAGL1. 321
MYC:CER3 and SAGL1:eYFP were co-expressed in N. benthamiana leaves in the 322
absence or presence of MG132. MYC:CER3 was immunoprecipitated using anti-MYC 323
antibody-conjugated agarose beads and subjected to immunoblot analysis using 324
10
anti-ubiquitin antibodies. When SAGL1:eYFP was expressed, ubiquitinated MYC:CER3 325
was more clearly detected in the presence of MG132 than in its absence (Figure 6D), 326
indicating that SAGL1 is involved in the ubiquitination of CER3. In MYC:CER3-expressing 327
WT (C24) and sagl1-1 seedlings, which were generated by cross-pollination between 328
sagl1-1 and transgenic WT plants expressing MYC:CER3 under the control of the CaMV 329
35S promoter, the MYC:CER3 protein level was higher in the sagl1-1 mutant background 330
than in the WT background, but no significant differences in MYC:CER3 transcript levels 331
were observed between the two types of seedlings (Figure 6E; Supplemental Figure 5F). 332
333
SAGL1:eYFP Localizes to the Cytoplasm and Nucleus 334
335
To examine the subcellular localization of SAGL1, we translationally fused the SAGL1 336
coding sequence (CDS) to the N-terminus of eYFP in the pPZP212-eYFP vector. The 337
pPZP212-mRFP (monomeric red fluorescent protein) vector containing the mRFP gene 338
instead of eYFP was used as a cytoplasmic and nuclear protein marker (Goodin et al., 339
2002). When SAGL1:eYFP and mRFP were transiently co-expressed in N. benthamiana 340
leaves, yellow fluorescent signals were merged with blue fluorescent signals but did not 341
overlap with blue autofluorescence from chloroplasts (Figure 7A). Fluorescent signals 342
were also observed in the cytoplasm and nuclei of the cortex and endodermal cells of 343
10-day-old transgenic roots expressing SAGL1:eYFP under the control of the CaMV 35S 344
promoter (Supplemental Figure 6). These results indicate that SAGL1 is localized to the 345
cytosol and nucleus. 346
347
SAGL1 is Downregulated under Low Humidity, High ABA, or High-Salt Conditions 348
349
To measure SAGL1 transcript levels in various organs of Arabidopsis plants grown under 350
50% to 60% relative humidity (RH) conditions, we isolated total RNA from seven-day-old 351
seedlings (YS); the rosette leaves of three-week-old (R1), four-week-old (R2), and six- to 352
seven-week-old (R3) plants; and the roots (Ro), stems (St), floral buds (Bu), flowers (Fl), 353
and siliques (Si) of six- to seven-week-old plants and subjected it to qRT-PCR analysis. 354
SAGL1 transcript levels in R1, Bu, and Fl were approximately 1.5- to 1.8-fold higher than 355
those in YS and Si (Figure 7B). To investigate the temporal and spatial expression 356
patterns of SAGL1, we generated transgenic Arabidopsis plants transformed with the 357
GUS reporter gene driven by the SAGL1 5’ promoter fragment (pSAGL1:GUS). When the 358
plants were grown under 50% to 60% RH conditions, GUS expression was detected in 359
11
10-day-old seedlings and in the rosette leaves of three-week-old plants, as well as the 360
leaf hydathodes, root, nodes, anthers, and developing seeds of four to seven-week-old 361
plants. However, little or no GUS expression was detected in the aerial organs (including 362
leaves, stems, sepals, petals, and silique walls) of four to seven-week-old plants (Figure 363
7C to 7I; Supplemental Data Set 1). 364
To examine whether SAGL1 expression is regulated by changes in ambient humidity, 365
6-week-old pSAGL1:GUS plants grown in culture bottles were stained before and 32 h 366
after removing the bottle cap. GUS expression was observed in all organs including the 367
aerial parts of pSAGL1:GUS plants before removing the bottle cap but was substantially 368
reduced in the aerial parts of pSAGL1:GUS plants after removing the bottle cap (Figure 369
7J vs 7K). In 5-week-old pSAGL1:GUS plants grown in soil, GUS staining was also 370
observed in leaves wrapped with plastic sheets, but not in unwrapped leaves (Figure 7L), 371
indicating that SAGL1 is upregulated under relatively high (>90% RH) humidity conditions 372
and downregulated under low (approximately 50–60% RH) humidity conditions. In 373
addition, SAGL1 transcript levels increased by approximately 35% 15 to 30 min after 374
wrapping the leaves in plastic sheets compared to unwrapped leaves (Figure 7M; 375
Supplemental Figure 7A). 376
We then investigated whether SAGL1 expression is regulated by exogenous ABA 377
treatment, osmotic stress, or salt stress. The detached leaves of 4-week-old 378
pSAGL1:GUS plants grown in soil were incubated with 1/2 MS liquid medium or the same 379
medium supplemented with 100 μM ABA, 200 mM mannitol, or 200 mM NaCl for 24 h. 380
GUS staining and activity increased markedly in leaves floated on 1/2 MS liquid medium 381
(MOCK) compared to non-treated leaves taken directly from soil-grown plants (Non). The 382
intense GUS staining and high activity decreased to a great extent in leaves of 383
pSAGL1:GUS plants in response to ABA treatment, salt, and osmotic stress relative to 384
MOCK (Figure 7N and 7O) but were still higher than in the non-treated leaves (Non). 385
qRT-PCR analysis of SAGL1 steady-state transcript accumulation confirmed these 386
trends (Supplemental Figure 7B; Supplemental Data Set 1). These results indicate that 387
the expression of SAGL1 is negatively regulated by ABA treatment, salt, and osmotic 388
stress. 389
390
SAGL1 Stability Increases under Relatively High Humidity Conditions, and SAGL1 391
Regulates MYC:CER3 Protein Levels in Response to Changes in Humidity 392
393
12
To investigate SAGL1 protein levels in response to different ambient humidity levels, we 394
generated transgenic Arabidopsis plants expressing SAGL1:eYFP driven by the CaMV 395
35S promoter. Seven-day-old WT and transgenic Arabidopsis seedlings overexpressing 396
SAGL1:eYFP were grown in Petri dishes and transferred to soil under 50–60% humidity 397
conditions. The seedlings were then covered with an opaque plastic lid for 1 day, 398
uncovered for 0, 12, 24, and 48 h, and subjected to immunoblot analysis. SAGL1:eYFP 399
protein levels significantly decreased in transgenic seedlings 24 and 48 h after being 400
uncovered (50–60% RH) relative to covered (>90% RH) transgenic seedlings (Figure 401
8A). 402
To examine if the stability of SAGL1 is regulated by the 26S proteasome complex, we 403
incubated 4-day-old WT (Col-0) and transgenic seedlings expressing SAGL1:eYFP in 1/2 404
Murashige and Skoog (MS) liquid medium supplemented with the inhibitor MG132 or 405
dimethyl sulfoxide (DMSO) for 4 h, followed by incubation in 1/2 MS liquid medium 406
supplemented with cycloheximide (CHX) after removing the MG132. The intensity of the 407
SAGL1:eYFP bands was stronger in the presence of MG132 than in the presence of 408
DMSO but gradually decreased in response to CHX treatment (Figure 8B), suggesting 409
that the stability of SAGL1:eYFP is controlled by the 26S proteasome complex. 410
Next, we examined the relationship between CER3 and SAGL1 in Arabidopsis under 411
different humidity conditions. Seven-day-old MYC:CER3-expressing WT (C24) and 412
sagl1-1 seedlings grown in Petri dishes (>90% RH) were exposed to 50–60% humidity 413
conditions for 0 and 12 h, followed by immunoblot analysis. MYC:CER3 protein levels 414
significantly increased in WT seedlings exposed to 50–60% humidity conditions 415
compared to WT seedlings grown under >90% humidity conditions, but no noticeable 416
differences were observed in MYC:CER3 protein levels between sagl1-1 seedlings 417
exposed to relatively high and low humidity conditions (Figure 8C). These results indicate 418
that SAGL1 regulates MYC:CER3 protein levels in response to changes in humidity. 419
Finally, we grew WT (Col-0) and sagl1-2 plants under 50%–60% RH and >90% RH 420
conditions and stained the leaves of 4-week-old plants with 0.05% toluidine blue (TB) 421
solution. Under relatively low humidity conditions, no TB staining (indicative of cuticle 422
permeability) was observed in WT or sagl1-2 leaves (Figure 8D). By contrast, strong TB 423
staining was clearly visible in WT leaves, but not in sagl1-2 leaves, in plants grown under 424
relatively high humidity conditions (Figure 8D), revealing that WT leaves possess a more 425
permeable cuticle than sagl1-2 leaves. These findings demonstrate that the presence of 426
SAGL1 results in the formation of a permeable cuticle under high humidity conditions. In 427
13
addition, the phenotype of the sagl1-1 mutant was more severe under 50%–60% humidity 428
than under <30% humidity conditions (Supplemental Figure 8). 429
430
431
DISCUSSION 432
The cuticle covers the primary aerial surfaces of land plants and serves as a defensive 433
barrier against various abiotic and biotic stresses (Kunst and Samuels, 2003; Pollard et 434
al., 2008; Samuels et al., 2008; Yeats and Rose, 2013; Serrano et al., 2014). Thus, the 435
regulation of cuticle formation is essential for the optimal growth and development of 436
plants under various environmental conditions (Kosma et al., 2009; Go et al., 2014; Kim 437
et al., 2017). Recent advances in our understanding of the molecular mechanisms 438
underlying cuticle biosynthesis underscore the importance and complexity of its 439
regulatory networks. One long-standing question in cuticle biology is how land plants 440
differentially control cuticular wax biosynthesis in response to changes in ambient 441
humidity. In this study, we showed that the Kelch repeat F-box protein, SAGL1, negatively 442
regulates cuticular wax biosynthesis by modulating the stability of CER3, a biosynthetic 443
enzyme involved in the production of VLC alkanes; these compounds account for 444
approximately 60 to 75% of total wax loads in the cuticles Arabidopsis leaves and stems 445
(Bernard et al., 2012; Li-Beisson et al., 2013). The presence of E3 ubiquitin ligases, which 446
are evolutionarily conserved and function as highly diverse key regulators (Chen and 447
Hellmann, 2013) in plants, suggests that regulatory mechanisms similar to that employing 448
the SAGL1-CER3 module might also be involved in regulating cuticular wax biosynthesis 449
in other plants including rapeseed (Brassica napus) and tomato (Solanum lycopersicum), 450
whose major wax components are VLC alkanes (Supplemental Figure 9, Supplemental 451
Data Set 2; Lee and Suh, 2015). 452
Even though cuticular wax biosynthesis is known to be regulated by transcriptional, 453
post-transcriptional, and post-translational regulatory mechanisms, to date, the 454
post-translational mechanism of wax deposition has not been studied in much detail 455
(Hooker et al., 2007; Lam et al., 2012, 2015; Lü et al., 2012; Lee and Suh, 2013, 2015; 456
Ménard et al., 2014; Marino et al., 2013; Lee and Seo, 2016; Wang et al., 2018). The 457
discovery of the E3 ubiquitin ligase, CER9, whose defects result in increased levels of 458
cutin monomers, pointed to the possible post-translational regulation of cuticular wax 459
biosynthesis (Lü et al., 2012). More recently, four RING-containing E3 ubiquitin ligases, 460
HUB1, HUB2, MIEL1, and DHS, were shown to be involved in cuticular wax biosynthesis; 461
HUB1 and HUB2 alter the stability of histone proteins involved in the formation of the 462
14
chromatin structure of cuticular lipid biosynthesis genes (Ménard et al., 2014), MIEL1 463
targets two cuticular wax biosynthesis regulators (the transcription factors MYB96 and 464
MYB30) (Marino et al., 2013; Lee and Seo, 2016), and DHS promotes the degradation of 465
the transcription factor ROC4, which positively regulates wax biosynthesis (Wang et al., 466
2018). Our characterization of the role of the F-box protein SAGL1 in the degradation of 467
CER3 by the 26S proteasome further contributes to our understanding of 468
post-translational regulation of cuticular wax biosynthesis. 469
GUS expression was detected in the roots and rosette leaves of 3-week-old 470
pSAGL1:GUS plants but was barely detected in the aerial organs, whose surfaces are 471
covered with cuticular waxes. In addition, we observed the humidity-dependent 472
expression of GUS driven by the SAGL1 5’ promoter fragment; high humidity (i.e., 473
belowground or wrapped conditions, >90% RH) induced GUS expression, whereas low 474
humidity (i.e., aboveground or unwrapped conditions, 50–60% RH) diminished the 475
increase in GUS expression, in pSAGL1:GUS plants. Furthermore, SAGL1 was more 476
stable under relatively high humidity conditions (>90% RH) and was degraded by the 26 477
proteasome under relatively low humidity conditions (Figure 8A and 8B). Co-expression 478
and Co-IP analyses of SAGL1 and CER3 clearly showed that SAGL1 mediates the 479
breakdown of CER3 by the 26S proteasome complex. Therefore, we speculate that the 480
SAGL1-CER3 module is a key determinant of total wax loads on the surfaces of above- 481
and belowground organs of Arabidopsis in response to changes in ambient humidity. 482
Interestingly, no differences in growth or development were observed between WT and 483
the SAGL1 overexpressing lines, indicating that alkane biosynthesis is not severely 484
impaired in the stems of the SAGL1 overexpressing plants. Indeed, VLC alkane levels in 485
the stems of SAGL1 overexpressing plants were reduced by only approximately 15% 486
compared to WT under relatively low humidity conditions (50–60% RH; Supplemental 487
Figure 4D), suggesting that CER3 is only partially degraded in these organs due to the 488
instability of SAGL1. Computational analysis (Supplemental Figure 10) using an 489
open-source tool for visualization of proteoforms (http://topcons.net/; 490
http://wlab.ethz.ch/protter/start/) predicted that cytoplasm-localized SAGL1 might interact 491
with two cytoplasmic loop domains or the cytoplasmic C-terminal region of CER3, an ER 492
membrane-localized protein (Kamigaki et al., 2009). Forty-two Lys residues in the 493
cytoplasmic regions of CER3 are putative target sites for ubiquitination (Bernard et al., 494
2012), further supporting the idea that CER3 is the target of the E3 ubiquitin ligase 495
SAGL1. This hypothesis is also supported by the finding that two cytoplasm-localized 496
F-box proteins, EIN2-TARGETING PROTEIN1 (ETP1) and ETP2, interact with the 497
15
C-terminus of ER-localized EIN2 and target it for proteasome-mediated degradation in 498
the absence of ethylene (Qiao et al., 2009). 499
Changes in endogenous ABA levels are regulated by the balance of ABA 500
biosynthesis and catabolism (Dong et al., 2015). Under drought conditions, ABA 501
accumulation is mediated by the enhanced expression of the 9-cis-epoxycarotenoid 502
dioxygenase 3 gene and an increase in its protein stability (Luchi et al., 2001; Endo et al., 503
2008). Conversely, high humidity activates the expression of CYP707A, encoding ABA 504
8c-hydroxylase, a key enzyme in ABA catabolism (Okamoto et al., 2009). ABA treatment 505
and water deficit result in an increase in total wax loads in Arabidopsis leaves, including a 506
significant increase in alkane levels (Kosma et al., 2009; Seo et al., 2011). By contrast, 507
the density of epicuticular wax crystals, total wax loads, and alkane and secondary 508
alcohol levels significantly decrease in Brassica oleracea leaves exposed to high air 509
humidity (Koch et al., 2006). Arabidopsis mutants with defects in the core ABA signaling 510
pathway, including pyrabacin resistance1 (pyr1) pyr1-like1 (pyl1) pyl2 pyl4 pyl5 pyl8 and 511
snf1-related protein kinase2.2 snrk2,3 snrk2,6, with permeable cuticles, are better 512
adapted to water-saturated conditions than the WT, suggesting that the core ABA 513
signaling pathway plays a negative role in regulating plant responses to increased 514
humidity (Cui et al., 2016). In the current study, GUS activity in pSAGL1:GUS plants and 515
SAGL1 transcript levels increased under high humidity conditions (>90% RH) but 516
decreased under low humidity conditions (50–60% RH) and ABA treatment, indicating 517
that the regulation of SAGL1 expression is dependent on humidity levels, which is 518
inversely correlated with endogenous ABA levels (Waadt et al., 2014). In addition, SAGL1 519
protein levels increased under high humidity conditions (>90% RH). Therefore, the 520
SAGL1-dependent posttranslational regulatory mechanism plays a key role in regulating 521
cuticular wax biosynthesis in terrestrial plants in response to different humidity levels. 522
The leaf plasticity of terrestrial plants is critical for increasing oxygen uptake and 523
preventing the depletion of carbohydrates, which function as substrates for respiration 524
under flooding conditions (Mommer and Visser, 2005). Amphibious plants, which are able 525
to survive in both aquatic and terrestrial environments, show a change in the thickness of 526
their cuticular membranes when exposed to aquatic or aerial conditions. Indeed, aquatic 527
cuticular membranes have lower resistance to O2 or CO2 diffusion than aerial cuticular 528
membranes (Frost-Christensen et al., 2003; Frost-Christensen and Floto, 2007), 529
suggesting that this change facilitates gas exchange under submergence or flooding 530
conditions. Therefore, the SAGL1-mediated formation of a permeable cuticle may be 531
important for plant acclimation to humid environments. 532
16
The sagl1-1 and sagl1-2 mutants exhibit the overaccumulation of wax and 533
dwarfism. Because the balanced distribution of VLCFAs (common metabolic precursors 534
used for cuticular wax and sphingolipid biosynthesis) is essential for optimal plant growth, 535
the dwarf phenotype of the sagl1-1 and sagl1-2 mutants may be a consequence of 536
excessive wax production (Zheng et al., 2005; Bach et al., 2008; Beaudoin et al., 2009; 537
Bourdenx et al., 2011; Seo et al., 2011). However, the phenotypes of sagl1-2 cer3-6 538
double mutants were similar to the dwarf phenotype of sagl1-2 and the wax-deficient 539
phenotype of cer3-6 (Rowland et al., 2007; Supplemental Figure 11), indicating that 540
SAGL1 has additional targets. Yu et al. (2019) recently reported that both sagl1-1 and 541
sagl1-2 plants show enhanced accumulation of anthocyanins and lignin derived from the 542
phenylpropanoid pathway. Phenylalanine ammonia lyase activity is increased in both 543
sagl1-1 and sagl1-2 leaves but reduced in SAGL1 OX leaves compared to the WT. When 544
SAGL1 and PHENYLALANINE AMMONIA LYASE1 (PAL1):GFP were co-expressed in 545
N. benthamiana leaves, PAL1:GFP levels decreased, suggesting that PAL1 is another 546
target of SAGL1. However, it is still unclear if the growth retardation of the sagl1 mutants 547
is related to the enhanced activity of PAL1. 548
In conclusion, we demonstrated that the Kelch-domain containing F-box protein, 549
SAGL1, negatively regulates cuticular wax biosynthesis by promoting the degradation of 550
CER3. SAGL1 transcript and protein levels increased under high ambient humidity (>90% 551
RH), whereas the high humidity-induced expression of SAGL1 was repressed by 552
exposure to ABA or low humidity, suggesting that the SAGL1-CER3 module plays a key 553
role in regulating cuticular wax biosynthesis in Arabidopsis in response to different 554
humidity conditions, e.g., drought and flooding. 555
556
557
METHODS 558
Plant Materials and Growth Conditions 559
Arabidopsis thaliana seeds were surface sterilized in bleach solution and sown directly in 560
soil (SunGro Mix #5) or half-strength MS agar medium [MS salts (Caisson Laboratories) 561
containing 0.3% Gelrite (Duchefa), 1% sucrose, pH 5.8]. After 2-3 day stratification at 562
4qC, the plants were grown at 22–23qC under long-day conditions (16-h light/8-h dark 563
cycles) in white fluorescent light (100 µmol photons/m2/s). Seeds of the sagl1-2 T-DNA 564
mutant (SALK_097761) were obtained from the Arabidopsis Biological Resource Center 565
(http://www.arabidopsis.org). Wild tobacco plants (N. benthamiana) were grown at 22–566
23qC under the above-mentioned long-day conditions. 567
17
568
Positional Cloning 569
For genetic mapping of the sagl1-1 mutation, the mapping population was derived from F1 570
plants obtained from a cross between sagl1-1 (in the C24 accession background) and WT 571
Landsberg erecta. F2 seedlings with the sagl1-1 phenotypes (small, thick, waxy, dark 572
green leaves) were selected and their genomic DNA was extracted. SSLP markers were 573
used for mapping. When necessary, new SSLP markers were developed using the 1001 574
Genomes project sequence database (http://1001genomes.org). The newly developed 575
SSLP markers are listed in Supplemental Table 1. 576
577
Gene Expression and gDNA Analysis 578
For RNA analysis, total RNA was extracted from 2-week-old plants using the RNAiso Plus 579
reagent (Takara) and an RNeasy Plant Mini Kit (Qiagen). Genomic DNA contamination 580
was removed by DNase I treatment (NEB). Reverse transcription was performed using 581
PrimeScript® RT Master Mix (Takara), and the resulting cDNA was used for RT-PCR 582
analysis. qRT-PCR was carried out using KAPA SYBR FAST qPCR Kit Master Mix (2X) 583
Universal (KAPA Biosystems) on a CFX96 Real-Time PCR system (Bio-Rad). The 584
reaction mixture (total volume of 20 µL) consisted of 1 µL cDNA, 10 PL KAPA SYBR 585
master mix, 7 µL of H2O, and 2 µL of 10 pmol gene-specific primer set listed in 586
Supplemental Table 1. PP2A (At1g13320) was used as a reference gene (Czechowski et 587
al., 2005). The qRT-PCR cycle was as follows: preincubation at 95qC for 10 min, 45 588
cycles of 2 step amplification at 95qC for 20 sec and 60qC for 20 sec. For genomic DNA 589
(gDNA) analysis, gDNA was isolated using extraction buffer (200 mM Tris-HCl, pH 7.5, 590
250 mM NaCl, 25 mM EDTA and 0.5% SDS) from mutants or 2-week-old leaves of T1 591
generation transgenic plants expressing SAGL1. Insertion of T-DNA was confirmed by 592
PCR using gene- and vector-sequence specific primer sets listed in Supplemental Table 593
1. 594
595
Plasmid Construction and Plant Transformation 596
To complement the sagl1-1 mutant, a 4,167 bp genomic DNA fragment of SAGL1 597
including 2,001 bp upstream of the start codon was amplified using ExTaq polymerase 598
(Takara). C24 genomic DNA was used as a template with the primer pair 599
F7A10_58.5K_SacIFg and F7A10_60K_KpnIRg. The amplified DNA fragment was 600
cloned into pCAMBIA1200 between the SacI and KpnI sites, resulting in the 601
pCAM1200-SAGL1g construct. To generate the SAGL1:eYFP fusion construct, the 602
18
SAGL1 CDS without the stop codon was amplified by PCR with the following primers: 603
SAGL1_SacF and SAGL1_SmaR. The SAGL1 CDS fragment was cloned into the 604
pPZP212 binary vector harboring a CaMV 35S promoter, enhanced yellow fluorescent 605
protein (eYFP), and Rubisco small subunit terminator (Hajdukiewicz et al., 1994; Go et al. 606
2014) between the SacI and SmaI sites. To generate the F-box-deleted SAGL1, the two 607
parts of the SAGL1 CDS were amplified by PCR with the primer pairs 608
At1g55270_cXbaIF/SAGL1(-Fbox)-R and SAGL1(-Fbox)-F/At1g55270_cKpnIR. The two 609
PCR products were ligated by overlap PCR with the primer pair At1g55270_cXbaIF and 610
At1g55270_cKpnIR. The resulting F-box-deleted SAGL1 CDS fragment was cloned into 611
the pBIB superbinary vector. The F-box-deleted SAGL1 CDS without the stop codon was 612
then amplified by PCR using the SAGL1_SacF and SAGL1_SmaR primers. The DNA 613
fragments were inserted into the pPZP212 binary vector between the SacI and SmaI sites, 614
resulting in SAGL1'F:eYFP. To generate the MYC:CER3 (At5g57800) fusion construct, 615
the CER3 CDS was amplified by PCR with the CER3_smF and CER3_scR primers. The 616
CDS of CER3 was cloned into the pBA002 binary vector harboring the CaMV 35S 617
promoter, 6xMYC, and nopaline synthase (Nos) terminator between the SmaI and SacI 618
sites. To generate the MYC:CER1 and MYC:CYTB5D fusion constructs, the CER1 and 619
CYTB5D CDS regions were amplified by PCR with the CER1_XmaF and CER1_SacR 620
primers and CYTB5_smF and CYTB5_scR primers, respectively. Each CDS region of 621
CER1 and CYTB5D was cloned into the pBA002 binary vector harboring the CaMV 35S 622
promoter, 6xMYC, and nopaline synthase (Nos) terminator between the SmaI or XmaI 623
and SacI sites. For the SAGL1 promoter-driven GUS construct, a 1,493 bp fragment 624
upstream of the SAGL1 start codon was amplified by PCR using C24 genomic DNA and 625
the primer pair F7A10(SAGL1g)pBamHI-F and F7A10(SAGL1g)pNcoI-R. The SAGL1 626
promoter fragment was subcloned into pCAMBIA1381 between the BamHI and NcoI 627
sites, resulting in pCAM1381-SAGL1p-GUS. The binary constructs were transformed into 628
Agrobacterium tumefaciens GV3101:pMP90 and the transformed Agrobacterium was 629
used for plant transformation by the floral dip method for Arabidopsis (Col-0, C24, or 630
sagl1-1) or leaf infiltration for N. benthamiana (Bent, 2006; Li, 2011). 631
632
Drought Treatment and Water Loss Measurements 633
Three-week-old C24 and sagl1-1 plants and 2-week-old Col-0 and sagl1-2 634
(Salk_097761) plants grown under the above-mentioned conditions were subjected to 635
drought stress by withholding water for 12 days. To ensure that both WT and sagl1 plants 636
experienced equal drought stress, the same amount of soil per pot was used and the pots 637
19
were soaked fully with water just before withholding water. Rosette leaves of 25-day-old 638
WT and sagl1 mutants were detached and placed under room conditions. The fresh 639
weights of the leaves were measured at the indicated time points (0, 1, 2, 3 and 4 h).640
641
Stomatal Sensitivity Assay 642
Stomatal sensitivity was measured as previously described (Guo et al., 2002). To 643
examine the stomatal response to ABA, seedlings grown under long-day conditions were 644
placed under high humidity in the light for 12 to16 h immediately before the assay. The 645
epidermal layers from leaves were incubated in stomatal opening solution [10 mM 646
MES-Tris (pH 6.15), 50 mM KCl] for 2 h. Using the epidermal layer from the leaves, 647
stomatal apertures were measured under a light microscope (Leica ICC50 HD) after 648
treatment with 2 μM ABA. For a proper comparison, relative values were used, with 649
stomatal apertures of the respective wild type at 0 μM ABA serving as a reference value. 650
651
SEM and TEM Analysis 652
WT and sagl1 plants grown in soil under the above-mentioned conditions for 6 weeks 653
were used for SEM and 4-week-old plants were used for TEM analysis. For SEM analysis, 654
live WT and mutant stems and leaves were coated with platinum particles using a sputter 655
coater for 10 min on a round grid. The samples were loaded and directly observed by 656
SEM (Hitachi S2400 FE-SEM) (Kim et al., 2017). Wax crystals on stem and leaf surfaces 657
were observed under 2,000x and 3,000x magnification. For TEM analysis, leaves were 658
fixed in 2% paraformaldehyde and 2.5% glutaraldehyde in 0.1 M sodium cacodylate 659
buffer (pH 7.4). The samples were dehydrated in an ethanol series (10 to 100%) and 660
embedded in Spurr’s epoxy resin (ERL 4206; TedPella Inc.) for 2 d. Thin sections were 661
prepared using an ultramicrotome (RMC MT X) after staining with uranyl acetate and lead 662
citrate. 663
664
Cuticular Wax Analysis 665
Ten-day-old WT, sagl1, and SAGL1 overexpressing plants grown on half-strength MS 666
plates containing 1% sucrose and 0.7% agar were transplanted to soil. After 6 weeks, 667
inflorescence stems, rosette leaves, and primary roots were used to measure wax 668
content and composition. Waxes from stems and rosette leaves were extracted by 669
dipping in chloroform for 30 s, and three internal standards (20 µg n-octacosane, 10 µg 670
docosanoic acid, and 10 µg 1-tricosanol per 0.1 g fresh weight for stem waxes; 2 µg 671
n-octacosane, 1 µg docosanoic acid, and 1 µg 1-tricosanol per 0.1 g fresh weight for672
20
rosette leaf wax) were added to the wax extracts. After evaporating the wax extracts 673
under nitrogen gas, 100 µL of pyridine and N,O-Bis(trimethylsilyl)trifluoroacetamide were 674
added to the samples, followed by incubation at 95°C for 30 min. The reactants were 675
evaporated again and dissolved in heptane:toluene (1:1, v/v) solvent. Wax load and 676
composition analyses were performed using GC-FID and GC-MS as described previously 677
(Seo et al., 2011). 678
679
Cutin Analysis 680
For cutin polymer analysis, NaOMe depolymerization and acetylation of monomers were 681
performed as described previously (Li-Beisson et al. 2013), with slight modifications. 682
Six-week-old inflorescence stems and rosette leaves were used to measure cutin content 683
and composition. Arabidopsis tissues were immersed in boiling (85°C) isopropanol for 10 684
min, and soluble lipids were extracted using chloroform/methanol and methanol. The 685
residues were dried under nitrogen gas, depolymerized using NaOMe, and acetylated. 686
Methyl heptadecanoate and a ω-pentadecalactone were used as internal standards (100 687
µg per 0.1 g dry residues). Polyester monomers were identified and quantified by GC-FID 688
and GC-MS as described previously (Seo et al., 2011). 689
690
In vitro Immunoblot Assay 691
Agrobacterium cells harboring the pPZP212 construct (for the control), the MYC:CER3, 692
MYC:CER1 or MYC:CYTB5D construct, and the SAGL1 or SAGL1ΔF construct were 693
co-infiltrated into the abaxial sides of N. benthamiana leaves with expression buffer [10 694
mM MES (pH 5.7), 10 mM MgCl2, 0.5 mM acetosyringone]. Plant tissues were harvested 695
1.5 d after Agrobacterium infiltration. Plant tissues pretreated with 100 µM MG132 were 696
treated with infiltration medium 12 h before sampling. Harvested plant materials were 697
ground in liquid nitrogen and dissolved in extraction buffer [125 mM Tris (pH 6.8), 4% 698
SDS, 2% DTT, 20% glycerol, and proteinase inhibitors including PMSF, pepstain A, 699
aprotinin, leupeptin, and MG132]. The total cellular extracts were analysed by 700
SDS-PAGE (10% gels) and blotted onto polyvinylidene difluoride membranes. 701
Epitope-tagged proteins were immunologically hybridized using anti-MYC (1:2,000 702
dilution; Millipore) and anti-GFP (1:8,000 dilution; Clontech) antibodies. All images were 703
developed using Thermo Scientific Pierce ECL Western Blotting Substrate and the AI600 704
chemidoc imaging system (GE Healthcare). 705
For the Co-IP and ubiquitination assays, Agrobacterium cells carrying the 706
SAGL1:eYFP and MYC:CER3, MYC:CER1 or MYC:CYTB5D construct were 707
21
co-infiltrated into N. benthamiana leaves. At 24 h after Agrobacterium infiltration, the N.708
benthamiana leaves were treated with 100 µM MG132 or DMSO using a syringe. After an 709
additional 12 h, the leaves were harvested and ground using a mortar and pestle under 710
liquid nitrogen. Total proteins were extracted with extraction buffer [RIPA buffer: 50 mM 711
Tris-HCl (pH 7.5); 150 mM NaCl; 0.1% sodium dodecyl sulfate (SDS); 0.5% 712
deoxycholate; 1% Triton X-100; and proteinase inhibitors including phenylmethane 713
sulfonyl fluoride (PMSF), pepstain A, aprotinin, leupeptin, and MG132]. Anti-c-MYC 714
conjugated agarose beads (A7470, Sigma) were added to the protein extracts (total 715
amount 1.5 mg) and incubated on an orbital shaker for 2 h at 4 °C. After centrifugation, 716
the anti-c-MYC conjugated agarose beads were thoroughly washed with RIPA buffer. 717
The washed beads were resuspended in sample buffer [125 mM Tris-HCl (pH 6.8), 4% 718
SDS, 2% dithiothreitol, 20% glycerol, and 0.025% bromophenol blue]. The protein 719
samples were subjected to an immunoblot assay as described above. eYFP-tagged 720
proteins and ubiquitinated proteins were immunologically detected using anti-GFP 721
(1:8,000 dilution; Clontech) and anti-Ub (1:2,000 dilution; SantaCruz) antibodies, 722
respectively. 723
For the SAGL1 protein stability assay, four-day-old transgenic Arabidopsis seedlings 724
overexpressing SAGL1:eYFP driven by the CaMV 35S promoter were collected and 725
incubated in 1/2 MS liquid medium containing 100 PM MG132 or DMSO on a rocker for 4 726
h. The seedlings were washed with 1/2 MS liquid medium to remove the MG132 or727
DMSO and incubated in 1/2 MS liquid medium containing 100 PM CHX on a rocker for 728
0.5, 1, and 2 h. The protein stability of SAGL1:eYFP under different humidity conditions 729
was examined in the rosette leaves of three- to four-week-old transgenic Arabidopsis 730
overexpressing SAGL1:eYFP that were unwrapped or wrapped with plastic sheets for 12, 731
24, or 36 h. To measure CER3 proteins levels in WT (C24) and sagl1-1 Arabidopsis 732
overexpressing MYC:CER3, the rosette leaves of three- to four-week-old plants were 733
unwrapped or wrapped with plastic sheets for 24 h. Immunoblot analysis for 734
SAGL1:eYFP and MYC:CER3 was carried out as described above. 735
736
Subcellular Localization 737
Agrobacterium cells harboring SAGL1:eYFP or mRFP in the pPZP212 vector were 738
inoculated into N. benthamiana leaf epidermal cells with expression buffer [50 mM MES 739
(pH 5.7), 10 mM MgSO4, 5% D-glucose and 0.1 mM acetosyringone] to a final 740
concentration of OD600=0.5. After 24 h of incubation, N. benthamiana leaf protoplasts 741
were isolated as previously described (Abel and Theologis, 1998). The protoplasts were 742
22
visualized under a TCS SP5 AOBS/Tandem confocal laser-scanning microscope (Leica). 743
The excitation wavelength was 500 nm and the emission wavelength was 535 nm for YFP 744
signals. The excitation range was 494 to 540 nm and the emission range was 570 to 620 745
nm for RFP signals. Auto-fluorescence from chloroplasts was detected at 514 nm 746
excitation and 561 nm emission wavelengths. 747
748
Histochemical and Toluidine Blue O Staining and Histological Analysis 749
Transgenic plants were selected via the application of 30 µg/mL hygromycin B. The T2 750
generation plants were used to observe GUS expression. For the high humidity test, 751
seeds were germinated on half-strength MS agar medium in a covered container for 3 to 752
6 weeks. The container cover was removed for 32 h and the samples were stained. Some 753
of the seedlings were transplanted to soil and grown for 2 weeks. All tissues were stained 754
with GUS staining solution with 100 mM X-Gluc at 37qC overnight as previously described 755
(Jefferson et al., 1987). After overnight staining, chlorophyll was removed with 75% 756
ethanol and the samples were examined under a microscope. 757
Rosette leaves from 6-week-old pSAGL1:GUS transgenic plants were detached 758
and floated on half-strength MS (pH 5.7) solution with or without ABA (100 μM), mannitol 759
(200 mM), or NaCl (200 mM) for 24 h. The leaves were washed with distilled water and 760
subjected to GUS assays as described above. To quantify GUS activity, total protein was 761
extracted from ground rosette leaves using extraction buffer [50 mM sodium phosphate 762
buffer (pH 7.0), 10 mM EDTA, 0.1% Triton X-100, 0.1% SDS, and 10 mM 763
β-mercaptoethanol]. Ten μg of protein was used to catalyze the 764
4-methylumbelliferyl-β-D-glucuronide (MUG) reaction. After incubation at 37qC for 1 h,765
the samples were analyzed using a luminescence reader (GLOMAX-20/20). 766
For Toluidine blue O staining, 4-week-old Arabidopsis plants were immersed in 767
Toluidine blue solution (0.05% with 0.01% Tween-20) for 10 min, washed with distilled 768
water, and photographed.769
770
Phylogenetic Analysis of SAGL1 771
The deduced amino acid sequences of Arabidopsis thaliana SAGL1 (At1g55270; 772
GenBank, NP_001320632.1) and its homologues from Brachypodium distachyon773
(Bradi1G73860.2; GenBank, XP_003562030.2), Brassica rapa (Brara.H00068.1; 774
GenBank: RID49257.1), Glycine max (Glyma.08G112900.1; GenBank, KRH42810.1), 775
Oryza sativa (LOC Os10G26990.1; GenBank, XP_015614781.1), Medicago truncatula776
(Medtr8G085600.1; GenBank, AET04178.1), Populus trichocarpa (Potri.003G217700.1; 777
23
GenBank, XP_002304010.2), Ricinus communis (29835.m000632; GenBank, 778
XP_002527061.1), Sorghum bicolor (Sobic.001G251800.1; GenBank, XP_002464634.1),779
Vitis vinifera (GSVIVT01025417001; GenBank, CBI16496.3), and Zea mays780
(GRMZM2G147402T01; GenBank, ACN32130.1) were obtained from Phytozome (v12.1; 781
https://phytozome.jgi.doe.gov/) and National Center for Biotechnology Information (NCBI; 782
https://www.ncbi.nlm.nih.gov/). Phylogenetic analysis was generated using MEGA6 by 783
ClustalW alignment and the neighbor-joining method based on the JTT matrix-based 784
model with bootstrap value percentages of 500 replicates (Tamura et al., 2013). The 785
scanning of F-box domain was performed using SMART (Simple Modular Architecture 786
Research Tool, http://smart.embl-heidelberg.de) (Letunic and Bork, 2018). 787
788
Accession Numbers 789
Sequence data in this article can be found in the TAIR (http://www.arabidopsis.org/) or 790
Phytozome 12 database (https://phytozome.jgi.doe.gov/) under the following accession 791
numbers: SAGL1 (AT1G55270), CER3 (AT5G57800), CER1 (At1g02205), CYTB5D 792
(At5g48810), PP2A (AT1G13320). 793
794
Supplemental Data 795
Supplemental Figure 1. Allelsm test between sagl1 mutants. 796
Supplemental Figure 2. Cuticular wax compositions and loads on the leaves, stems and 797
roots of WT and sagl1 plants. 798
Supplemental Figure 3. Cutin monomer compositions and levels in the leaves and 799
stems of WT and sagl1 plants. 800
Supplemental Figure 4. Cuticular wax and cutin compositions and loads on the stems of 801
WT (Col-0) and transgenic plants overexpressing SAGL1.802
Supplemental Figure 5. Immunoblot and Co-IP analysis of CER1 or CYTB5D 803
associated with SAGL1:eYFP protein. 804
Supplemental Figure 6. Subcellular localization of SAGL1:eYFP in 10-day-old 805
transgenic Arabidopsis roots overexpressing SAGL1:eYFP under the control of the 806
CaMV 35S promoter. 807
Supplemental Figure 7. Quantitative RT-PCR analysis of SAGL1 expression. 808
Supplemental Figure 8. Growth phenotypes of C24 and sagl1-1 under different humidity 809
conditions. 810
Supplemental Figure 9. Phylogenetic analysis and amino acid sequence alignment of 811
SAGL1 from various plant species. 812
24
Supplemental Figure 10. Topology of the CER3 protein. 813
Supplemental Figure 11. Phenotypes of the sagl1-2 cer3-6 double mutant. 814
Supplemental Table 1. List of DNA primers used in this study. 815
Supplemental Data Set 1. ANOVA tables. 816
Supplemental Data Set 2. Alignment of sequences used for neighbor-joining method. 817
818
ACKNOWLEDGEMENTS 819
820
We thank Su Bin Lee, Juyoung Kim, Reo Jin Kim, and Saet Buyl Lee for experimental 821
assistance, Young Woo Seo (Korea Basic Science Institute, Gwangju) for confocal 822
imaging, and Ljerka Kunst (University of British Columbia, Canada) for critical reading of 823
the manuscript. 824
825
AUTHOR CONTRIBUTIONS 826
827
B.-h.L. and M.C.S. conceived and designed the experiments. H.K., S.-i.Y., and S.H.J. 828
conducted experiments. B.-h.L. and M.C.S. wrote the paper with the help of H.K., S.-i.Y., 829
and S.H.J. 830
831
REFERENCES 832
833
Aarts, M.G., Keijzer, C.J., Stiekema, W.J., and Pereira, A. (1995). Molecular 834
characterization of the CER1 gene of Arabidopsis involved in epicuticular wax 835
biosynthesis and pollen fertility. Plant Cell 7: 2115-2127. 836
Abel, S., and Theologis, A. (1998). Transient gene expression in protoplasts of 837
Arabidopsis thaliana. Methods Mol. Biol. 82: 209-217. 838
Adams, J., Kelso, R., and Cooley, L. (2000). The kelch repeat superfamily of proteins, 839
propellers of cell function. Trends Cell Biol. 10: 17-24. 840
Aharoni, A., Dixit, S., Jetter, R., Thoenes, E., van Arke, l.G., and Pereira, A. (2004). The 841
SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters 842
cuticle properties, and confers drought tolerance when overexpressed in 843
Arabidopsis. Plant Cell 16: 2463-2480. 844
Bach, L., Michaelson, L.V., Haslam, R., Bellec, Y., Gissot, L., Marion, J., Da Costa, M., 845
Boutin, J.P., Miquel, M., Tellier, F., Domergue, F., Markham, J.E., Beaudoin, F., 846
Napier, J.A., and Faure, J.D. (2008). The very-long-chain hydroxy fatty acyl-CoA 847
25
dehydratase PASTICCINO2 is essential and limiting for plant development. Proc. 848
Natl. Acad. Sci. USA 105: 14727-1431. 849
Beaudoin, F., Wu, X., Li, F., Haslam, R.P., Markham, J.E., Zheng, H., Napier, J.A., and 850
Kunst L. (2009). Functional characterization of the Arabidopsis 851
beta-ketoacyl-coenzyme A reductase candidates of the fatty acid elongase. Plant 852
Physiol. 150: 1174-1191. 853
Bent, A. (2006) Arabidopsis thaliana floral dip transformation method. Methods Mol Biol. 854
343: 87-103. 855
Bernard, A., Domergue, F., Pascal, S., Jetter, R., Renne, C., Faure, J.D., Haslam, R.P., 856
Napier, J.A., Lessire, R., and Joubès, J. (2012). Reconstitution of plant alkane 857
biosynthesis in yeast demonstrates that Arabidopsis ECERIFERUM1 and 858
ECERIFERUM3 are core components of a very-long-chain alkane synthesis 859
complex. Plant Cell 24: 3106-3118. 860
Bird, D., Beisson, F., Brigham, A., Shin, J., Greer, S., Jetter, R., Kunst, L., Wu, X., 861
Yephremov, A., and Samuels, L. (2007). Characterization of Arabidopsis 862
ABCG11/WBC11, an ATP binding cassette (ABC) transporter that is required for 863
cuticular lipid secretion. Plant J. 52: 485-498. 864
Bourdenx, B., Bernard, A., Domergue, F., Pascal, S., Léger, A., Roby, D., Pervent, M., 865
Vile, D., Haslam, R.P., Napier, J.A., Lessire, R., and Joubès, J. (2011). 866
Overexpression of Arabidopsis ECERIFERUM1 promotes wax very-long-chain 867
alkane biosynthesis and influences plant response to biotic and abiotic stresses. 868
Plant Physiol. 156: 29-45. 869
Cardozo, T., and Pagano, M. (2004). The SCF ubiquitin ligase: insights into a molecular 870
machine. Nat. Rev. Mol. Cell Biol. 5: 739-751. 871
Chen, L., and Hellmann, H. (2013). Plant E3 ligases: Flexible enzymes in a sessile world. 872
Mol. Plant. 6: 1388-1404. 873
Chen, X., Goodwin, S.M., Boroff, V.L., Liu, X., and Jenks, M.A. (2003). Cloning and 874
characterization of the WAX2 gene of Arabidopsis involved in cuticle membrane and 875
wax production. Plant Cell 15: 1170-1185. 876
Cui, F., Brosché, M., Lehtonen, M.T., Amiryousefi, A., Xu, E., Punkkinen, M., Valkonen, 877
J.P., Fujii, H., and Overmyer, K. (2016). Dissecting abscisic acid signaling pathways878
involved in cuticle formation. Mol. Plant 9: 926-938.879
Czechowski, T., Stitt, M., Altmann, T., Udvardi, M.K., and Scheible, W.R. (2005). 880
Genome-wide identification and testing of superior reference genes for transcript 881
normalization in Arabidopsis. Plant Physiol. 139: 5-17. 882
26
DeBono, A., Yeats, T.H., Rose, J.K., Bird, D., Jetter, R., Kunst, L., and Samuels, L. 883
(2009). Arabidopsis LTPG is a glycosylphosphatidylinositol-anchored lipid transfer 884
protein required for export of lipids to the plant surface. Plant Cell 21: 1230-1238. 885
Domergue, F., Vishwanath, S.J., Joubes, J., Ono, J., Lee, J.A., Bourdon, M., Alhattab, R., 886
Lowe, C., Pascal, S., Lessire, R., and Rowland, O. (2010). Three Arabidopsis fatty 887
acyl-coenzyme A reductases, FAR1, FAR4, and FAR5, generate primary fatty 888
alcohols associated with suberin deposition. Plant Physiol. 153: 1539-1554. 889
Dong, T., Park, Y., and Hwang, I. (2015). Abscisic acid, biosynthesis, inactivation, 890
homoeostasis and signaling. Essays Biochem. 58: 29-48. 891
Endo, A., Sawada, Y., Takahashi, H., Okamoto, M., Ikegami, K., Koiwai, H., Seo, M., 892
Toyomasu, T., Mitsuhashi, W., Shinozaki, K., Nakazono, M., Kamiya, Y., Koshiba, T., 893
and Nambara, E. (2008). Drought induction of Arabidopsis 9-cis-epoxycarotenoid 894
dioxygenase occurs in vascular parenchyma cells. Plant Physiol. 147: 1984-1993. 895
Frost-Christensen, H., and Floto, F. (2003) Resistance to CO2 diffusion in cuticular 896
membranes of amphiious plants and the implication for CO2 acquisition. Plant Cell 897
Environ. 30: 12-18. 898
Frost-Christensen, H., Jørgensen, L.B., and Floto, F. (2003) Species specificity of 899
resistance to oxygen diffusion in thin cuticular membranes from amphibious plants. 900
Plant Cell Environ. 26: 561-569. 901
Go, Y.S., Kim, H., Kim, H.J., and Suh, M.C. (2014). Arabidopsis cuticular wax 902
biosynthesis is negatively regulated by the DEWAX gene encoding an AP2/ERF-type 903
transcription factor. Plant Cell 26: 1666-1680. 904
Goodin, M.M., Dietzgen, R.G., Schichnes, D., Ruzin, S., and Jackson, A.O. (2002). pGD 905
vectors: versatile tools for the expression of green and red fluorescent protein fusions 906
in agroinfiltrated plant leaves. Plant J. 31: 375-383. 907
Greer, S., Wen, M., Bird, D., Wu, X., Samuels, L., Kunst, L., and Jetter, R. (2007). The 908
cytochrome P450 enzyme CYP96A15 is the midchain alkane hydroxylase 909
responsible for formation of secondary alcohols and ketones in stem cuticular wax of 910
Arabidopsis. Plant Physiol. 145: 653-667. 911
Guo, Y., Xiong, L., Song, C.P., Gong, D., Halfter, U., and Zhu, J.K. (2002). A calcium 912
sensor and its interacting protein kinase are global regulators of abscisic acid 913
signaling in Arabidopsis. Dev. Cell 3: 233-244. 914
Hajdukiewicz, P., Svab, Z., and Maliga, P. (1994). The small, versatile pPZP family of 915
Agrobacterium binary vectors for plant transformation. Plant Mol. Biol. 25: 989-994. 916
27
Haslam, T.M., and Kunst, L. (2013). Extending the story of very-long-chain fatty acid 917
elongation. Plant Sci. 210: 93-107. 918
Hooker, T.S., Lam, P., Zheng, H., and Kunst, L. (2007). A core subunit of the 919
RNA-processing/degrading exosome specifically influences cuticular wax 920
biosynthesis in Arabidopsis. Plant Cell. 19: 904-913. 921
Iuchi, S., Kobayashi, M., Taji, T., Naramoto, M., Seki, M., Kato, T., Tabata, S., Kakubari, 922
Y., Yamaguchi-Shinozaki, K., and Shinozaki, K. (2001). Regulation of drought 923
tolerance by gene manipulation of 9-cis-epoxycarotenoid dioxygenase, a key enzyme 924
in abscisic acid biosynthesis in Arabidopsis. Plant J. 27: 325-333. 925
Jefferson, R.A., Kavanagh, T.A., and Bevan, M.W. (1987). GUS fusions, β-glucuronidase 926
as a sensitive and versatile gene fusion marker in higher plants. EMBO J. 6: 927
3901-3907. 928
Jetter, R., Kunst, L., and Samuels, A.L. (2006). Composition of plant cuticular waxes. In 929
Biology of the Plant cuticle, M. Riederer and C. Muller, eds (Oxford, UK: Blackwell 930
Publishing), pp. 145-181. 931
Kamigaki, A., Kondo, M., Mano, S., Hayashi, M., and Nishimura, M. (2009). Suppression 932
of peroxisome biogenesis factor 10 reduces cuticular wax accumulation by disrupting 933
the ER network in Arabidopsis thaliana. Plant Cell Physiol. 50: 2034-2046. 934
Kim, H., Choi, D., and Suh, M.C. (2017). Cuticle ultrastructure, cuticular lipid composition, 935
and gene expression in hypoxia-stressed Arabidopsis stems and leaves. Plant Cell 936
Rep. 36: 815-827. 937
Kim, H., Lee, S.B., Kim, H.J., Min, M.K., Hwang, I., and Suh, M.C. (2012). 938
Characterization of glycosylphosphatidylinositol-anchored lipid transfer protein 2 939
(LTPG2) and overlapping function between LTPG/LTPG1 and LTPG2 in cuticular 940
wax export or accumulation in Arabidopsis thaliana. Plant Cell Physiol. 53: 941
1391-1403. 942
Kim, W. Y., Fujiwara, S., Suh, S.S., Kim, J., Kim, Y., Han, L., David, K., Putterill, J., Nam, 943
H.G., and Somers, D.E. (2007). ZEITLUPE is a circadian photoreceptor stabilized by944
GIGANTEA in blue light. Nature 449: 356-360.945
Koch, K., Hartmann, K.D., Schreiber, L., Barthlott, W., and Neinhuis, C. (2006). 946
Influences of air humidity during the cultivation of plants on wax chemical 947
composition, morphology and leaf surface wettability. Environ. Exp. Bot. 56: 1-9. 948
Kosma, D.K., Bourdenx, B., Bernard, A., Parsons, E.P., Lü, S., Joubès, J., and Jenks, 949
M.A. (2009). The impact of water deficiency on leaf cuticle lipids of Arabidopsis. Plant950
Physiol. 151: 1918-1929.951
28
Kunst, L., and Samuels, A.L. (2003). Biosynthesis and secretion of plant cuticular wax. 952
Prog. Lipid Res. 42: 51-80. 953
Lam, P., Zhao, L., McFarlane, H.E., Aiga, M., Lam, V., Hooker, T.S., and Kunst, L. (2012). 954
RDR1 and SGS3, components of RNA-mediated gene silencing, are required for the 955
regulation of cuticular wax biosynthesis in developing inflorescence stems of 956
Arabidopsis. Plant Physiol. 159: 1385–1395. 957
Lam, P., Zhao, L., Eveleigh, N., Yu, Y., Chen, X., and Kunst, L. (2015). The exosome and 958
trans-acting small interfering RNAs regulate cuticular wax biosynthesis during 959
Arabidopsis inflorescence stem development. Plant Physiol. 167: 323-336. 960
Lee, H.G., and Seo, P.J. (2016). The Arabidopsis MIEL1 E3 ligase negatively regulates 961
ABA signalling by promoting protein turnover of MYB96. Nat. Commun. 7: 12525. 962
Lee, H.G., Kim, J., Suh, M.C., and Seo, P.J. (2017) The MIEL1 E3 ubiquitin ligase 963
negatively regulates cuticular wax biosythesis in Arabidopsis stems. Plant Cell 964
Physiol. 58: 1249-1259. 965
Lee, J.H., and Kim, W.T. (2011). Regulation of abiotic stress signal transduction by E3 966
ubiquitin ligases in Arabidopsis. Mol. Cells 31: 201-208. 967
Lee, S.B., Kim, H.U., and Suh, M.C. (2016) MYB94 and MYB96 additively activate 968
cuticular wax biosynthesis in Arabidopsis. Plant Cell Physiol. 57: 2300-2311. 969
Lee, S.B., Go, Y.S., Bae, H.J., Park, J.H., Cho, S.H., Cho, H.J., Lee, D.S., Park, O.K., 970
Hwang, I., and Suh, M.C. (2009). Disruption of glycosylphosphatidylinositol-anchored 971
lipid transfer protein gene altered cuticular lipid composition, increased 972
plastoglobules, and enhanced susceptibility to infection by the fungal pathogen 973
Alternaria brassicicola. Plant Physiol. 150: 42-54. 974
Lee, S.B., and Suh, M.C. (2013) Recent advances in cuticular wax biosynthesis and its 975
regulation in Arabidopsis. Mol. Plant 6: 246-249. 976
Lee, S.B., and Suh, M.C. (2015). Advances in the understanding of cuticular waxes in 977
Arabidopsis thaliana and crop species. Plant Cell Rep. 34: 557-572. 978
Letunic, I., and Bork, P. (2018) 20 years of the SMART protein domain annotation 979
resource. Nucleic Acids Res. 46: D493-D496. 980
Li-Beisson, Y., et al. (2013). Acyl-lipid metabolism. The Arabidopsis Book 11: e0161. 981
Li, F., Wu, X., Lam, P., Bird, D., Zheng, H., Samuels, L., Jetter, R., and Kunst, L. (2008). 982
(2008). Identification of the wax ester synthase/acyl-coenzyme A: diacylglycerol 983
acyltransferase WSD1 required for stem wax ester biosynthesis in Arabidopsis. Plant 984
Physiol. 148: 97-107. 985
29
Li, X (2011) Infiltration of Nicotiana benthamiana protocol for transient expression via 986
Agrobacterium. Bio-101: e95. 987
Livak, K.J., and Shmittgen, T.D. (2001) Analysis of relative gene expression data using 988
real-time quantitative PCR and the 2-'CT method. Methods 25: 402-408. 989
Lü, S., Zhao, H., Des Marais, D.L., Parsons, E.P., Wen, X., Xu, X., Bangarusamy, D.K., 990
Wang, G., Rowland, O., Juenger, T., Bressan, R.A., and Jenks, M.A. (2012). 991
Arabidopsis ECERIFERUM9 involvement in cuticle formation and maintenance of 992
plant water status. Plant Physiol. 159: 930-944. 993
Lukowitz W., Gillmor C.S., and Scheible W. (2000). Positional cloning in Arabidopsis. 994
Why it feels good to have a genome initiative working for you. Plant Physiol. 123: 995
796-805.996
Marino, D., Froidure, S., Canonne, J., Ben Khaled, S., Khafif, M., Pouzet, C., Jauneau, A., 997
Roby, D., and Rivas, S. (2013). Arabidopsis ubiquitin ligase MIEL1 mediates 998
degradation of the transcription factor MYB30 weakening plant defence. Nat 999
Commun. 4: 1476. 1000
Mazzucotelli, E., Belloni, S., Marone, D., De Leonardis, A.M., Guerra, D., Di Fonzo, N., 1001
Cattivelli. L., and Mastrangelo, A.M. (2006). The e3 ubiquitin ligase gene family in 1002
plants, regulation by degradation. Curr. Genomics 7: 509-522. 1003
McFarlane, H.E., Shin, J.J., Bird, D.A., and Samuels, A.L. (2010). Arabidopsis ABCG 1004
transporters, which are required for export of diverse cuticular lipids, dimerize in 1005
different combinations. Plant Cell 22: 3066-3075. 1006
Ménard, R., Verdier, G., Ors, M., Erhardt, M., Beisson, F., and Shen, W.H. (2014). 1007
Histone H2B monoubiquitination is involved in the regulation of cutin and wax 1008
composition in Arabidopsis thaliana. Plant Cell Physiol. 55: 455-466. 1009
Mommer, L., and Visser, E.J. (2005) Underwater photosynthesis in flooded terrestrial 1010
plants: a matter of leaf plasticity. Ann. Bot. 96: 581-589. 1011
Nawrath, C. et al. (2013). Apoplastic diffusion barriers in Arabidopsis. The Arabidopsis 1012
Book 11: e0167. 1013
Nelson, D.C., Lasswell, J., Rogg, L.E., Cohen, M.A., and Bartel, B. (2000). FKF1, a 1014
clock-controlled gene that regulates the transition to flowering in Arabidopsis. Cell 1015
101: 331-340 (2000). 1016
Okamoto, M., Tanaka, Y., Abrams, S.R., Kamiya, Y., Seki, M., and Nambara, E. (2009). 1017
High humidity induces abscisic acid 8′-hydroxylase in stomata and vasculature to 1018
regulate local and systemic abscisic acid responses in Arabidopsis. Plant Physiol. 1019
149: 825-834. 1020
30
Oshima, Y., Shikata, M., Koyama, T., Ohtsubo, N., Mitsuda, N., and Ohme-Takagi, M. 1021
(2013). MIXTA-like transcription factors and WAX INDUCER1/SHINE1 coordinately 1022
regulate cuticle development in Arabidopsis and Torenia fournieri. Plant Cell. 25: 1023
1609-1624. 1024
Park, C.S., Go, Y.S., and Suh, M.C. (2016). Cuticular wax biosynthesis is positively 1025
regulated by WRINKLED4, an AP2/ERF-type transcription factor, in Arabidopsis 1026
stems. Plant J. 88: 257-270. 1027
Pollard, M., Beisson, F., Li, Y., and Ohlrogge, J.B. (2008) Building lipid barriers: 1028
biosynthesis of cutin and suberin. Trends Plant Sci. 13: 236-246. 1029
Prag, S., and Adams, J.C. (2003). Molecular phylogeny of the kelch-repeat superfamily 1030
reveals an expansion of BTB/kelch proteins in animals. BMC Bioinformatics 4: 42. 1031
Raffaele, S.,Vailleau, F., Léger,A., Joubès, J., Miersch, O., Huard, C., Blée, E., 1032
Mongrand, S., Domergue, F., and Roby, D. (2008). A MYB transcription factor 1033
regulates very-long-chain fatty acid biosynthesis for activation of the hypersensitive 1034
cell death response in Arabidopsis. Plant Cell 20: 752-767. 1035
Riederer, M., and Schreiber, L. (2001). Protecting against water loss: Analysis of the 1036
barrier properties of plant cuticles. J. Exp. Bot. 52: 2023-2032. 1037
Rowland, O., Zheng, H., Hepworth, S. R., Lam, P., Jetter, R. and Kunst, L. (2006). CER4 1038
encodes an alcohol-forming fatty acyl-coenzyme A reductase involved in cuticular 1039
wax production in Arabidopsis. Plant Physiol. 142, 866-877. 1040
Samuels, L., Kunst, L., and Jetter, R. (2008). Sealing plant surfaces: cuticular wax 1041
formation by epidermal cells. Annu. Rev. Plant Biol. 59: 683-707. 1042
Santner, A., and Estelle, M. (2010). The ubiquitin-proteasome system regulates plant 1043
hormone signaling. Plant J. 61,1029-1040. 1044
Sawa, M., Nusinow, D.A., Kay, S.A., and Imaizumi, T. (2007). FKF1 and GIGANTEA 1045
complex formation is required for day-length measurement in Arabidopsis. Science 1046
318: 261-265 1047
Schumann, N., Navarro-Quezada, A., Ullrich, K., Kuhl, C., and Quint, M. (2011). 1048
Molecular evolution and selection patterns of plant F-box proteins with C-terminal 1049
kelch repeats. Plant Physiol. 155: 835-850. 1050
Schuster, A.-C., Burghardt, M., Alfarhan, A., Bueno, A., Hedrich, R., Leide, J., Thomas, 1051
J., Riederer, M. (2016). Effectiveness of cuticular transpiration barriers in a desert 1052
plant at controlling water loss at high temperatures. AoB Plants 8: pii: plw027. 1053
31
Seo, P.J., Lee, S.B., Suh, M.C., Park, M.J., Go, Y.S., and Park, C.M. (2011). The MYB96 1054
transcription factor regulates cuticular wax biosynthesis under drought conditions in 1055
Arabidopsis. Plant Cell 23: 1138-1152. 1056
Serrano, M., Coluccia, F., Torres, M., L’Haridon, F., and Métraux, J.-P. (2014). The 1057
cuticle and plant defense to pathogens. Front. Plant Sci. 5: 274. 1058
Shepherd, T., and Wynne Griffiths, D. (2006). The effects of stress on plant cuticular 1059
waxes. New Phytol. 171: 469-499. 1060
Shu, K., and Yang, W. (2017) E3 ubiquitin ligases, ubiquitous actors in plant development 1061
and abiotic stress responses. Plant Cell Physiol. 58: 1461-1476. 1062
Suh, M.C., Samuels, A.L., Jetter, R., Kunst, L., Pollard, M., Ohlrogge, J., and Beisson, F. 1063
(2005). Cuticular lipid composition, surface structure, and gene expression in 1064
Arabidopsis stem epidermis. Plant Physiol. 139: 1649-1665. 1065
Sun, Y., Zhou, X., and Ma, H. (2007). Genome-wide analysis of kelch repeat containing 1066
F-box family. J. Integr. Plant Biol. 49: 940-952.1067
Tamura, K., Stecher, G., Peterson, D., Filipski, A., and Kumar, S. (2013) MEGA6: 1068
Molecular Evolutionary Genetics Analysis Version 6.0. Mol Biol Evol 30:2725-2729. 1069
Waadt, R., Hitomi, K., Nishimura, N., Hitomi, C., Adams, S.R., Getzoff, E.D., and 1070
Schroeder, J.I. (2014). FRET-based reporters for the direct visualization of abscisic 1071
acid concentration changes and distribution in Arabidopsis. eLife 3: e01739. 1072
Wang, Y., Wang, J., Chai, G., Li, C., Hu, Y., Chen, X., and Wang, Z. (2015). 1073
Developmental changes in composition and morphology of cuticular waxes on leaves 1074
and spikes of glossy and glaucous wheat (Triticum aestivum L.). PLoS One 10: 1075
e0141239. 1076
Wang, M., Wang, Y., Wu, H., Xu, J., Li, T., Hegebarth, D., Jetter, R., Chen, L., and Wang, 1077
Z. (2016). Three TaFAR genes function in the biosynthesis of primary alcohols and1078
the response to abiotic stresses in Triticum aestivum. Sci Rep. 6: 25008.1079
Wang, Z., Tian, X., Zhao, Q., Liu, Z., Li, X., Ren, Y., Tang, J., Fang, J., Xu, Q., and Bu, Q. 1080
(2018) The E3 ligase DROUGHT HYPERSENSITIVE negatively regulates cuticular 1081
wax biosynthesis by promoting the degradation of transcription factor ROC4 in rice. 1082
Plant Cell 30: 228-244. 1083
Xue, F., and Cooley, L. (1993). Kelch encodes a component of intercellular bridges in 1084
Drosophila egg chambers. Cell 72: 681-693. 1085
Yasuhara, M., Mitsui, S., Hirano, H., Takanabe, R., Tokioka, Y., Ihara, N.,. Komatsu, A., 1086
Seki, M., Shinozaki, K., and Kiyosue, T. (2004). Identification of ASK and 1087
32
clock-associated proteins as molecular partners of LKP2 (LOV kelch protein 2) in 1088
Arabidopsis. J. Exp. Bot. 55: 2015-2027. 1089
Yeats, T.H., and Rose, J.K. (2013). The formation and function of plant cuticles. Plant 1090
Physiol. 163: 5-20. 1091
Yu, S.-i., Kim, H., Yun, D.-J., Suh, M.C., and Lee, B.-h. (2019) Post-translational and 1092
transcriptional regulation of phenylpropanoid biosynthesis pathway by Kelch repeat 1093
F-box protein SAGL1. Plant Mol. Biol. 99: 135-148.1094
Zhang, X., Abrahan, C., Colquhoun, T.A., and Liu, C.J. (2017). A proteolytic regulator 1095
controlling chalcone synthase stability and flavonoid biosynthesis in Arabidopsis. 1096
Plant Cell 29: 1157-1174. 1097
Zheng, H., Rowland, O., and Kunst, L. (2005). Disruptions of the Arabidopsis enoyl-CoA 1098
reductase gene reveal an essential role for very-long-chain fatty acid synthesis in cell 1099
expansion during plant morphogenesis. Plant Cell 17: 1467-1481. 1100
Zhu, J.-Y., Li, Y., Cao, D., Yang, H., Oh, E., Bi, Y., Zhu, S., and Wang, Z.-Y. (2017). The 1101
F-box protein KIB1 mediates Brassinosteroid-induced inactivation and degradation of1102
GSK3-like kinases in Arabidopsis. Mol. Cell 66: 648-657.1103
1104
1105
Figure 1. Morphological phenotypes of the sagl1-1mutant.
(A) Comparison of leaf size between C24 (left) and sagl1-1 (right). The 6th rosette leaves from 5-week-oldplants are shown. Bar = 0.5 cm.(B) Cross sections of C24 (top) and sagl1-1 (bottom) leaves in the middle of the lamina. The 6th rosetteleaves from 5-week-old plants are shown. Bar = 20 μm.(C) Comparison of leaf thickness between C24 and sagl1-1. The 5th to 6th rosette leaves from 5-week-oldplants were measured. Averages from 60 rosette leaves from 30 plants and their SD are shown. Thevalues were statistically tested using ANOVA (*** indicates significant difference at P < 0.001).(D) Comparison of leaf reflection between C24 (left) and sagl1-1 (right) leaves. The arrow points to aglossy reflection in the sagl1-1 leaf. The 6th rosette leaves from 5-week-old plants are shown. Bar = 0.1cm.(E) to (J) Comparison of leaf (E, F), stem (G, H), and root morphology (I, J) of 4 to 6-week-old C24 (E, G,I) and sagl1-1 (F, H, J) plants.(K) Comparison of the growth habits of 6-week-old C24 (left) and sagl1-1 (right) plants.(L) Comparison of fresh weight between 4-week-old C24 and sagl1-1. Averages from 5 biologicalreplicates and their SD are shown. The values were statistically tested using ANOVA (** indicatessignificant difference at P < 0.01).
C
F
A
I J
G
K
B D
E
L
H
Leaf
thic
knes
s (μ
m)
80
60
40
20
0C24 sagl1-1
***
150
120
90
0
30
C24 sagl1-1
60**
Fres
h W
eigh
t (%
)
Figure 2. Molecular cloning and complementation of sgal1-1.
(A) Map-based cloning of SAGL1. 791 F2 seedlings derived from a Ler x sagl1-1 cross were used for mapping.SSLP markers for mapping were F14C21, T7N22, F7A10, T18I3, and T5A14 from left to right. The number ofrecombinations is shown below each marker locus.(B) to (E) Molecular complementation of sagl1-1 with the SAGL1 gene. (B) C24, (C) sagl1-1 with the SAGL1gene, and (D) sagl1-1 (E) Overall phenotypes of each genotype.(F) Predicted domains in SAGL1. Asterisk represents the sagl1-1 mutation site.(G) Position of the T-DNA insert in the sagl1-2 allele.(H) SAGL1 expression in WT (Col-0) and sagl1-2, as determined by RT-PCR.(I) Comparison of the leaf phenotypes of each allele and the respective WT control. Three-week-old plants areshown.(J) Growth and development of Col-0 (left) and sagl1-2 (right and inset). Six-week-old plants are shown.(K) and (L) Root morphology of Col-0 (K) and sagl1-2 (L).
C24sagl1-1
with SAGL1
sagl1-1
E
A
C24 sagl1-1
Col-0 sagl1-2
Col-0 sagl1-2
SAGL1
PP2A
Salk_097761(sagl1-2)
F
G
H
IJ
B DC
K
L
F-Box
Kelch
1 75 150 225 300 375 434
*
CIW1(18.36Mb) T8L23(21.4Mb)Chromosome 1
T1813T7N22F1C21 F7A10 T5A14BACs
Recombinations
4/1582 2/1582 0/1582 0/1582 1/1582 1/1582
At1g55270
385th GATTCCGGTCTTAAGACTGTTGT 407th
GATTCCG-----------GTTGT
34th SGLKTVVEARKFVPGSKLCIQPDINPNSGCRSKEVCSWFKALYST
52th aa Stop
Wild Typesagl1-1
Wild Typesagl1-1
Figure 3. sagl1mutants displayed enhanced drought tolerance compared with WT.
(A) Differences between WT and sagl1 phenotypes under drought stress.(B) Water loss from rosette leaves of WT (squre symbols) and sagl1 (circle symbols) at the indicated timepoints. Averages from 6 biological replicates and their SD are shown. The values were statistically tested usingANOVA with post-hoc Tukey HSD test (P < 0.05). The lowercase letters indicate statistical differenciation.(C) Comparison of stomatal density on the abaxial surfaces between WT and sagl1 leaves. Averages from 15biological replicates and their SD are shown. The values were statistically tested using ANOVA with post-hocTukey HSD test (P < 0.05). The lowercase letters indicate statistical differenciation.(D) Relative stomatal aperture in response to 2 μM ABA treatment. Averages from 50 biological replicates andtheir SD are shown. The values were statistically tested using ANOVA with post-hoc Tukey HSD test (P < 0.05).The lowercase letters indicate statistical differenciation.
A C24 sagl1-1 Col-0 sagl1-2
12 days drought
Cb b
a a
0
50
100
150
200
Sto
mat
a D
ensi
ty
(no.
/ m
m2 )
sagl1-2Col-0sagl1-1C24
D
0
30
60
90
120
150
0 1 3
Rel
ativ
e S
tom
atal
Ape
rture
(%)
Time (hour)
a
aa
C24 sagl1-1Col-0 sagl1-2
B
Wat
er L
oss
(%)
0
10
20
30
40
50
60
0 60 120 180 240
aabb
Time (min)
aabb
aabb
aabb
aabbaaaa
C24 sagl1-1Col-0 sagl1-2
Figure 4. Scanning electron microscopy (SEM) of stems and transmission electron microscopy (TEM)of leaves of WT and sagl1 plants.
(A) to (D) SEM images of cuticular wax crystals on the stems of C24 (A), sagl1-1 (B), Col-0 (C) and sagl1-2(D). Bars = 5 μm. The typical shapes of epicuticular wax crystals, rod (blue arrow), tube (yellow arrow) andhorizontal plate (red arrow), are shown on the surfaces of the Arabidopsis stems.(E) and (F) TEM images of the cuticle in the leaves of Col-0 (E) and sagl1-2 (F). The large black squaresshow magnified views of the imiages in the small black squares. Bars = 1 μm.(G) and (H) Cuticle thickness (G) and cell wall thickness (H) measurements in Col-0 and sagl1-2. Averagesfrom 5 biological replicates and their SD are shown. The values were statistically tested using ANOVA (*indicates significant difference at P < 0.01).
H*
0
10
20
30
40
50
Cut
icle
Thi
ckne
ss(n
m)
sagl1-2Col-0
FE
G*
Cel
lWal
lTh
ickn
ess
(Pm
)
sagl1-2Col-00
0.3
0.6
0.9
1.2
1.5
A B
C D
Figure 5. Cuticular wax and cutin composition and levels in the leaves, stems and roots of WT andsagl1 plants.
(A) to (F) Cuticular waxes were extracted from rosette leaves (A, B), stems (C, D) and roots (E, F) of 4 to5-week-old Arabidopsis plants. (A, C and E) total wax loads. (B, D and F) compositions of cuticular waxes.(G) to (J) Cutin monomers were extracted from rosette leaves (G, H) and stems (I, J) of 4 to 5-week-oldArabidopsis plants. (G and I) total cutin loads. (H and J) compositions of cutin monomers.Averages from three biological replicates from two individual experiments and their SD are shown. Thevalues were statistically tested using ANOVA with post-hoc Tukey HSD test (P < 0.05) or ANOVA (*,P<0.05. **, P<0.01). Ak, alkanes; Ke, ketone; PA, primary alcohols; Al, aldehydes; FA and FFA, fatty acids;SA, secondary alcohols; MAG, monoacylglycerol; HFA, hydroxy fatty acids; DCA, dicarboxylic acids; Un,unidentified. FW, fresh weight.
a
b bc
05
1015202530
Ste
m W
ax L
oad
(μg/
cm2 )
a a
a
aa
b ab
ab
b
a
c
a
ab
b
a
d b
b
c
a
0
1
2
3
4
PA Al FA SA Un
aa
b
b
b
c
c
d
02468
1012
Ak Ke
DC
Ste
m W
ax L
oad
(μg/
cm2 )
Ste
m W
ax L
oad
(μg/
cm2 )
ab
b
c
0
0.2
0.4
0.6
0.8
Leaf
Wax
Loa
d (μ
g/cm
2 )
BA
Leaf
Wax
Loa
d (μ
g/cm
2 )
Leaf
Wax
Loa
d (μ
g/cm
2 )
a a a
a
a ba
ab
b a
ab
aa
a
0
0.1
0.2
0.3
PA Al FA Un
a
ab
b
c
0
0.2
0.4
0.6
AkAks PAs
Ke
Als FAs
Aks PAs Als FAs SA
HG
Leaf
Cut
in M
onom
er(μ
g/m
g D
ry R
esid
ue)
b
a
a
bc
b
b
b
ca a
a
a
ba
a
b
FA HFA DCA Un0
0.51.01.52.02.53.0
b
c
ab
0
1
2
3
4
5
Leaf
Cut
in M
onom
er(μ
g/m
g D
ry R
esid
ue)
FAs HFAs DCAs
JI
0
0.5
1.0
1.5
2.0
2.5
Ste
m C
utin
Mon
omer
(μ
g/m
g D
ry R
esid
ue)
a
bb
c
0
0.5
1.0
1.5
aa a ab
aba
b
ab
aba
b
a
b
a
c
b
FA HFA DCA UnSte
m C
utin
Mon
omer
(μ
g/m
g D
ry R
esid
ue)
FAs HFAs DCAs
C24 sagl1-1*
*
0
50
100
150
200*
**
** **0
20
40
60
Ste
rols
and
aro
mat
icw
axes
load
s (μg/
g FW
)
Wax
load
s (μg/
g FW
)
C24 sagl1-1
Alip
hatic
wax
eslo
ads
(μg/
g FW
)
FE
**
**
07
14
****
2070
120
0
0.5
1
SA Ke
Aks SA Ke Un
Figure 6. Immunoblot analysis and Coimmunoprecipitation assay of CER3 associated with SAGL1.
(A) and (B) MYC:CER3 and SAGL1:eYFP (A) or mutated SAGL1F:eYFP with a deleted F-box domain region (B)under the control of the CaMV 35S promoter were transiently co-expressed in N. benthamiana leaves. MG132 (100μM) was used to inhibit the degradation of proteins by the 26S proteasome system. Anti-MYC or anti-GFPantibodies were used for immunoblot analysis to detect MYC:CER3 or SAGL1/SAGL1F:eYFP. Equal proteinloading was assured using Ponceau-S staining.(C) Coimmunoprecipitation (Co-IP) assays to detect MYC:CER3 and SAGL1:eYFP interactions. Total proteinextracts were obtained from N. benthamiana leaves infiltrated with Agrobacterium suspensions harboring theMYC:CER3 or SAGL1:eYFP construct. Input, Total protein extracts were subjected to immunoblot analysis usinganti-GFP or anti-MYC antibodies. IP: α-MYC, Total protein extracts were immunoprecipitated with anti-MYC agaroseand subjected to immunoblot analysis using anti-GFP or anti-MYC antibodies.(D) Ubiquitination assay of MYC:CER3. SAGL1:eYFP and MYC:CER3 were transiently co-expressed in N.benthamiana leaves. MG132 (100 μM) was infiltrated into the leaves to inhibit 26S proteasome activity. Total proteinextracts obtained from N. benthamiana leaves were immunoprecipitated using anti-MYC conjugated to agarosebeads and subjected to immunoblot analysis using anti-MYC or anti-Ub antibodies. WB, western blotting(immunoblot analysis).(E) MYC:CER3 protein and transcripts levels in 14-day-old WT (C24) and sagl1-1 seedlings overexpressingMYC:CER3 under the control of the CaMV 35S promoter. MYC:CER3 protein levels were determined in total proteinextracts by immunoblot analysis using anti-MYC antibodies. Equal protein loading was assured using Ponceau-Sstaining. MYC:CER3 transcript levels were determined by RT-PCR. PP2A was used as an endogenous referencegene.
DSAGL1:eYFP
MYC:CER3MG132
++-
+++
MYC:CER3
SAGL1:eYFP
Ponceau S
Ponceau S
Input
Ub(n)-MYC:CER3
++-
+++
++-
+++
IP: α-MYCWB: α-MYC
IP: α-MYCWB: α-Ub
MYC:CER3
100
55
180
70
130
kDa
---
--+
+-+
-++
B SAGL1:eYFPSAGL1F:eYFP
MYC:CER3
SAGL1F:eYFPSAGL1:eYFP
MYC:CER3
Ponceau S
Ponceau S
ASAGL1:eYFP
MYC:CER3100 M MG132
---
-+-
++-
+++
Ponceau S
Ponceau S
MYC:CER3
SAGL1:eYFP
Ponceau S
C
IP: α
-MY
C
MYC:CER3
SAGL1:eYFP
SAGL1:eYFPMYC:CER3
-+
++
Ponceau S
Ponceau S
Inpu
t
MYC:CER3
SAGL1:eYFP
E
MYC:CER3
PP2A
C24 sagl1-135SP:MYC:CER3
MYC:CER3
Ponceau S
C24 sagl1-135SP:MYC:CER3
A RFPSAGL1:eYFP Merged
ChloroplastSAGL1:eYFP Merged
B
YS0
0.1
0.2
0.3
SAGL1
expr
essi
on(2
-'C
T )
RoR1 R2 R3 St FlBu Si
M
SAGL1
expr
essi
on
(Fol
d ch
ange
)
Time (min)0 15 30 90
ab b
a
0
0.6
1.2
1.8
0 40 80 120
NaClMannitol
ABAMOCK
Non
GUS Activity (RLU/mg protein, x106)
O
Non MOCK ABA Mannitol NaCl
N
C D E
F H IG
J K L
Figure 7. Subcellular localization of SAGL1:eYFPin N. benthamiana protoplasts and GUSexpression driven by the SAGL1 5’ promoterfragment in Arabidopsis.
(A) SAGL1:eYFP driven by the CaMV 35S promoterwas transiently co-expressed in N. benthamianaleaves with mRFP in pPZP212 (left panel), which wasused as a cytoplasmic and nuclear protein marker(Goodin et al. 2002). Protoplasts isolated from N.benthamiana leaves were used to visualizefluorescent signals under a confocal laser-scanningmicroscope 48 h after infiltration. Autofluorescentsignals from chloroplasts are shown in blue (middlepanel) and merged images are shown on the right.Scale bars = 10 µm.(B) SAGL1 expression in various Arabidopsis organs.Total RNA was isolated from 7-day-old seedlings (YS),rosette leaves of 3-week-old (R1), 4-week-old (R2),and 6- to 7-week-old (R3) plants, and roots (Ro),stems (St), buds, (Bu), flowers (Fl) and siliques (Si; 1–10 days after flowering) of 6- to 7-week-old plants andsubjected to qRT-PCR analysis. PP2A was used asan endogenous reference gene for normalizationacross samples, and data are presented as 2−ΔCtvalues (Livak and Schmittgen, 2001). Averages fromfour biological replicates from two individualexperiments and their SD are shown.(C) to (L) and (N) Histochemical analysis oftransgenic Arabidopsis expressing GUS under thecontrol of the SAGL1 5’ promoter fragment. (C), Ten-day-old transgenic Arabidopsis seedling grown in aPetri dish; (D) and (E), Three-week-old and four-week-old transgenic Arabidopsis in a soil. (F) to (I),Root (F), stems and cauline leaves (G), floral organs(H), and silique (I) of 5- to 7-week-old transgenicArabidopsis. (J) and (K), Six-week-old transgenicArabidopsis grown in a culture bottle before (J) and 32h after (K) removing the bottle cap. (L), Some leavesof 5-week-old transgenic Arabidopsis grown in soilwere not covered (left), but others were covered withplastic sheets for 3 d (right).(M) qRT-PCR analysis of SAGL1. Total RNA wasisolated from rosette leaves unwrapped or wrapped inplastic sheets for the indicated times and subjected toqRT-PCR analysis. The PP2A gene was used tomeasure the quality and quantity of cDNA. Averagesfrom two biological replicates from six individualexperiments and their SD are shown. Data werestatistically analyzed using an ANOVA with post-hocTukey HSD test (P < 0.05).(N) and (O) GUS staining (N) and activity (O) inrosette leaves of 4-week-old transgenic Arabidopsisbefore (Non) and 24 h after incubation in half-strengthMS liquid medium without (MOCK) and supplementedwith 100 μM ABA, 200 mM mannitol or 200 mM NaCl.(O), Averages from two biological replicates fromthree individual experiments and their SD are shown.RLU, Relative Light Units.
Figure 8. Immunoblot analysis of SAGL1:eYFP and MYC:CER3 in transgenic Arabidopsis plants,and cuticle permeability of WT and sagl1-2 under relatively low and high humidity conditions.
(A) Assay of SAGL1:eYFP protein levels under different humidity conditions. Seven-day-old WT (Col-0)and transgenic Arabidopsis seedlings overexpressing SAGL1:eYFP grown in Petri dishes weretransferred to soil. The seedlings were covered with an opaque plastic lid for 1 day (>90% RH),uncovered (50–60% RH) for the indicated time points, and subjected to immunoblot analysis.SAGL1:eYFP protein levels were determined in total protein extracts by immunoblot analysis using anti-GFP antibodies at the indicated time points. Equal protein loading was assured using Ponceau-Sstaining.(B) SAGL1:eYFP protein stability assay. Four-day-old WT (Col-0) and transgenic Arabidopsis seedlingsoveresxpressing SAGL1:eYFP were treated with the MG132 (100 μM) or DMSO before treatment with100 μM CHX for the indicated amounts of time. SAGL1:eYFP protein levels were determined in totalprotein extracts by immunoblot analysis using anti-GFP antibodies at the indicated time points. Equalprotein loading was assured using Ponceau-S staining.(C) Seven-day-old transgenic WT (C24) and sagl1-1 seedlings overexpressing MYC:CER3 grown inPetri dishes were exposed to 50–60% RH for 0 and 12 h and subjected to immunoblot analysis.MYC:CER3 protein levels were determined in total protein extracts by immunoblot analysis using anti-MYC antibodies. Equal protein loading was assured using Ponceau-S staining.(D) Arabidopsis WT (Col-0) and sagl1-2 plants were transferred to soil after germination on half-strengthMS medium and uncovered or covered with a lid to maintain high humidity (>90% RH). Four-week-oldArabidopsis WT and sagl1-2 leaves were immersed in Toluidine blue O solution (0.05% with 0.01%Tween 20) for 10 min, washed with distilled water, and photographed.
A B
Col-0 sagl1-2
Relatively Low Humidity (without lid, 50–60% RH)
Col-0 sagl1-2
Relatively High Humidity (with lid, >90% RH)
D
Ponceau-S
SAGL1:eYFP
Col-0 Hour(s)4 4 0.5 1 2
Removal of MG132+ Treatment of CHXM
G13
2
DM
SO
Hours4824120Col-0
Expose to ambient humidity(50–60% RH)
Ponceau-S
SAGL1:eYFP
C
MYC:CER3
Ponceau S
C24 sagl1-135SP:MYC:CER3u
0 12 0 12 Hours
DOI 10.1105/tpc.19.00152; originally published online July 18, 2019;Plant Cell
Hyojin Kim, Si-in Yu, Seh Hui Jung, Byeong-ha Lee and Mi Chung Suhto Changes in Humidity in Arabidopsis
The F-box Protein SAGL1 and ECERIFERUM3 Regulate Cuticular Wax Biosynthesis in Response
This information is current as of January 6, 2020
Supplemental Data /content/suppl/2019/07/18/tpc.19.00152.DC2.html /content/suppl/2019/07/16/tpc.19.00152.DC1.html
Permissions https://www.copyright.com/ccc/openurl.do?sid=pd_hw1532298X&issn=1532298X&WT.mc_id=pd_hw1532298X
eTOCs http://www.plantcell.org/cgi/alerts/ctmain
Sign up for eTOCs at:
CiteTrack Alerts http://www.plantcell.org/cgi/alerts/ctmain
Sign up for CiteTrack Alerts at:
Subscription Information http://www.aspb.org/publications/subscriptions.cfm
is available at:Plant Physiology and The Plant CellSubscription Information for
ADVANCING THE SCIENCE OF PLANT BIOLOGY © American Society of Plant Biologists