Upload
the-computer-paper
View
310
Download
17
Embed Size (px)
DESCRIPTION
Canada Computes! BC Edition
Citation preview
Fvugo No.4 > May I97 > CHADA C O M P U E .
I7-inch monitors:‘Weitest run the best
A %
% jMultimedia mäfigicI? keeps ongettmg better
n,’k‘.9
w w w . c o m p u t e r - p l a y e r . c o m l
o NoSetup Feeo NoHourlyChargeso NoPrime-timeRestrictionso Free Sofiware Kito FreeTechnical Supporto Over 95033.6Kbps Lines
COMPUMoNIToRsACER 14 N/I ......................... 59ACER 15'N/l DIGITAL .................. 5420ADI 4v LR.N/I .29 . . . . . . . . . . . . . . . . . . . . 5490
aBTIgelag/HIIR ._. . . . . . . . . . . . . . . . . . . . . . „S790 AHOrdg bIe5 HX. . . . . . . . . . . . . . . . . . . 5545 C t 8‘MITSUBISHI 17-HX . . . . . . . . . . . . . . . . . . 51239NEC M500 15" . . . . . . . . . . . . . . . . . . . . . . . „S550 C
Om U erPRovIEw 14"NilLR . . . . . . . . . . . . . . . . . . 5239PnovIewIs-N/ILR F/S ..............„S320 OmmumcahonSONY 15SF15'N/I ................... ‚S660SONY I7 SE2T17‘ N/ILR. . . . . . . . . . . . . „S1490 ProdUC15
Acer 1011114011i 5KImem‘X1331schalmouse CANON BJ30BuBBLE JET ............ 53301-“ 2: CANON 9.10240CoLoR BUBBLE JET ..... 5239.
j
[ 1- CANONBJC42o0 BUBBLE JET .......... 5319G,
7
‚— — 5
7
2
O HP82OCXI INKJETCoLoR . . . . . . . . . . . .„5529Pentium HP5LLASERJET ..................... 5549‘e55; HP6PLASERJET ..................... 5990Pro .o“ „mm3 HPLASERJET5 . . . . . . . . . . . . . . . . . . . . . 51900
AsusT‘E“D0‘HPLASERJET6M?................... 51290
31MB . \ OKIDATAOLSOOE LASER . . . . . . . . . . . . . . 5549P2111450“E"3nd F10 I TX „ RAVEN2405 24PIN . . . . . . . . . . . . . . . . . . . 522932b E81Am4011M ‚D 1-.
L1;‘ RAvEN2497 24PINVflde/Quiet . . . . . . . . . . 5579
1M ‚m; _. 104Key 3 m‘ .M16W“ Ehard011W 1- 00'110: 15' m“ N11 1GBE“) -« InU“ A06‘ 4MBSGK?“ 1:“‘ . I dM d 4 — usc » nK .Kupon 1 den e41 ATI . 31m0 „ARBINAL 33.9 INT.FAX/MODEM .......... . ‚S139
21%3S64b“2MBRIA1:10:56 Nxacmsoh J2bunt)“5°“ z suPRA33.6 INT FAXMODEM .............. 513a
M, 3g:Zbuuon5911.1
dSnwso .‘ US.ROBOTICS x15SPORTSTER EXTERNAL . 5215
‘mMMx 1001100 S2 _ 0s RoBoTIcs33.9 sPoRTsTER INTERNAL . . 51991
‘.
S1668! FLOPPY DRIVESI.2MBFLOPPY oRIvE ................‚ .5631.44MBFLOPPY DRIVE ................. .532
VIDEO CARDSN . cIRRus LOGIC 544e . . . . . . . . . . . . . . . . . . 5522
H33: ATI WINCHARGER 5401MB .............. .590Novell Netware 4.1(25 user)„B3299 ATI vI0EoBoosT 6402MB . . . . . . . . . . . . . 5119
_ [
5 NE2000Elhemel neMoIk12m....ss9 ATI WINTURBO Mach s42MBVRAM . . ‚ . . . 5319l — 5 ATI 3DExPREssIoN2MB soRAM . . . . . . . 5199
. ATI 30 PROTURBO 4MB sGRAM . . . . . . . . 5290CÜmputer PTÜbIEmS äfimfmäggg; "i222 DIAMOND STEALTH s4PCI2MB vRAM .. . ‚S369
. _ Ximom Ethemei pocket adapior ‚ a l ll l ‚
UpgradB 386 s, 486s, MonItorRepam . 041m2121401151“>t:)r 93g I; HABDDR|VESHardDnveUpgrades -
gmeKmam 50OhmTemmkg,’ gjss 1 OUANTUM 1.2GB12MS 129KCACHE . . . . ‚S260ä; CIUANTUM 2.5GB..................... 9359
WD. 850MB TOMS 54K CACHE . . . . . . . . u: 5219WD. 12GB10MB 64K CACHE . . . . . . . . . .. 9279WD. 19091014364K CACHE . . . . . . . . . . . 5319 »
- w.B. 21GB EIDE . . . . . . . . . . . . . . . . . . . . . . ‚S349"
„ W.D 2.5GB EIDE .....................„S399
“EZZTSTEOäfiäääßiäs'zxaga55.7519;" " """"’°° "Eißffiffliä‘iflä‘ä”a’ifl‘äoä°f’a"gaa'ag;a'5;1:;;""'”’”° WWGBEIDE --------------------- "-8405
10.4‘ dual scan screen. 256K Cache Acftve Matrix screen. 256K Cache, PCMCIA sie! WD‘ 4o GBBDE ' ‘ ' ' ' ' ' ‘ ' ’ ' ' ' ' ' ' ' ' ' ' ' ‘S525PCMCIA slot mmWindows 95 „am CD ROM. sound card, Windows 95 '
RMEGAHERTZ PCMCIA MODEM 23-8 -------------------„S259 TOSHIBA 74OCDT NOTEBOOK......................„S85801MBsIMM „NS ca"Pentium 166 MMx‚16MBRAMEDO. 2. 2GB Hard Dnve 3; ----» ----------P -------<BACKPACK EXTERNAL axCDROM ...................„3459 12 1m . “„an“W e m 256K u m , PCMCIA 5m s; 4MBWM ‚UNS 30m _________________3a„
BACKPACK 800MB TAPE DRIVE EXT ...............„x199 mm10x CD ROM, sound card. Wnndows 95 9MBSIMM soNs 72PIN ................. ‚canI; 16MB sIMMGONS 72PIN . . . . . . . . . . . . . . . . . .caII
_’
’2 ‘ 2 2
’ WeSupport and COLORADO 900MB TAPE BACKUP INTT1ooos1s9_ . Service. coNNER 800MB TAPE BACKUPExT ...... 5265
Tradlned ed0m - CONNER 900MB TAPE BACKUP INT ....... 5215
t t - IoMEGAZIP DRIVE ExT ................ . 255a" es. “e;Wmkmg _Novell NetWare 5
N H1o proynde Partners m wmdows Forworkgroups IOMEGASCSI JAZ 1GEXT . . . . . . . . . . . . . . 3649
ove SUPEHOI .Certified NetWare LANtasflc ENetWare Support WIndows NT
NetworkingPartner MICROSOFTWINDOWS 95OEM (wim syslem) S149’ 369WORDPERFECT 6.1 SUITE . . . . . . . . . . . . . .5
MICROSOFTWORKS FORWINDOWS . . . . . .569MICROSOFTPUBLISHER FORWINDOWS 45158
MlS HOME " " 7 " "
Engineer
BUS|NESS HOURS:I IMulti MedIa WOHd CDROM ‚ÜMON-FRI 9:00-15:00
Acer 9x CDROM................................„5135 OPTI 15bitCompatible Sound Crd.......S35 PACKAGE SAT 11100-5I00Mitsumi 16xCDRom. „S189 Sound Blaster 16 „.595
‘ _1L- ‘ FREE PARK|NG ATREARPanasonic 12K CD Rom 155 Phone Blaster 28.8 S329 Panasonic/Toshiba 1.xx
2 YEAR PARTS I; LABOUR “IARRAPJTY 0N S Y S I U H“ S ”‘2"°°“°"" '59
C'°““V°"WEZ2P'ÄP' ‘S233 3373»5553l?5'?>i"5a"5e S a4 m.Eazäfisxgzirtgsgns’:5222iAltec LansIng pea ers rom ............ 2 shielded Speakeß _ SUEJECT T0 C H AW E WTHOU „ C E"—’-'-I ALTERICAN EXPRES Ä D D 3’‚
.
_s uTf‘iu“a1‘T*&—«-»_ n
i‘I_ __ \
45 Capsuie OSHistorie: n-.."48 05/2 Imaruuite Iinally arrives
5| Who will produu the OS oI rhe Intim
h a r d u:a r sI2 The great Ii-inch monitor roundup‘43 Boob tube: The next generaton
featuresI7Iwantm7 DVD
20 Multimedia; educational saviour or hi-tech gimmick' -
22 What's new in multimedia!
23 How to pick a muitimedia synem33 The TechIIomad Tour
l'I B UJ 528 Briefs
I0 Douglas Collage asxists Nicaraguan educalors‘30 Corel waiting Ior Sun to show
mu I t i me d i aI4 Searching Ior multimedia on lhe web
|4 Multimedia a: dead Iong im neu fnedia!— 32 va Im; kids‘ soflware
b u n I4s70 Building your Office 97 libvrary
g a me s7| Gimme (hat giain robol
7| The add-on phenomenon74 Games people play
i
‚y
c u l u mn s8 StreefBi/zz: BC arts grads_hit it big in Seattle
37 Ialtwary,‘ Iiunning old D05 game: in Winden:
38 05/2 Ready: Life with Fixpak43 Hac lIant: What's on Apple TVthese days?
54 Tec/Ina/agy 3nd the end a! culrure
o n I i n e56 The Web garden blooms
.I:"‚C.Y‚»„Y._‘ZI.'Ä‚'; f5 — 581e! polling results Iace scrutiny'
_62 Feeling pushed
1 64 Kewl Siles
readeriservicas6 Letten ° 72
' 60 ISP List ° 78 Mvertisers Index
‘Piihfl ’
‚
7.
1 66 ä P C
ß COMPUTER PLAYER! > M A Y 1 9 9 7 > http://www.comIuter-playencom/
‚IIIHVWS
I
FREDRICTON
I
HÄLIFÄX
I
EVDNEV
r a o c z s s o a
Systems not exacny as shmvn
1 plus SpeakerPhonew/VoiceMail__...__..I
y
IntelligentPersonal ComputersPentium‘processor -120Ml-IzMicrosoft Plus &Windows 95 pre-Ioaded manuals and C.O.A.
PERSONCOMPUTE.t7.
SURREV
I
BURNABV
I
KAMLOOFS
I
KELOWNR
I
FRINCE
GEORGE
I
BEI)
DEER
I
KITCHENER
I
BRANTFORD
I
HAMILTON
I
CHELPH
I
IflflHlE
I
RFLLEVILLE
I
KINGSTGN
I
LflVfll.
I
UARTMOUTH
0
MDMCTON
I
5T
Comox . . . . . . . . . . . . . . . . . ‚Panic Computers . . . . . . . . . . . . . . . . . . . . . . ‚ . . .250.339.0929 Vancouver . . . . . . . . . . . . . .PoIson’sOffice Products . . . . . . . . . . . . . . . . . . . .604.879.0631' Delta / Surrey . . . . . . . . . . . ‚Str ider Computers . . . . ‚ . . . . . . . . . . . . . . . ‚ . . . .604.543.4200 Victoria . . . . . . . . . . . . . . . . .Data Image Technology . . . . . . . . . . . . . . . . . . . . .250.388.9991„ ‚ Kamloops . . . . . . . . . . . . . . ‚Specialty Electronis . . . . . . . . . . . . . . . . . . . . . ; 2503513949 Vidoria . . . . . . . . . . . . . . . . .Odyssey Computers . . . . . . . . . . . . . . . . . . . . . . . .250.721.4488
Kelowna . . . . . . . . . . . . . . . ‚DCCSystems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .250.762.2696 Williams Lake . . . . . . . . . . .‚Information ManagementService . . . . . . . . . . . 2503924675
pentium”
eethe IPC 5120-2L0 at an authorized IPC dealer nealr you, or fo r information call: 1.888.l-0.4-lPC- Abbotsford . . . . . . . . . . .. . ‚PacificOfficeN Things . . . . . . . . . . . . . . . . . . . . . .604.864.0865 Mission . . . . . . . . . . . . . . . . ‚BargainBytes . . . . . . . . . . . . . . . . . . . . . . . . . . . . .604.826.8298
' Burnaby . . . . . . . . . . . . . . . ‚Dexton Enterprises . . . . . . . . . . . . . . . . . . . . . . .5044319866 PortAIbemi . . . . . . . . . . . . ‚Alltech ComputerSystems . . . . . . . . . . . . . . . . . .250.723.1127i’ CampbellRiver . . . . . . . . . . .OdysseyComputer Services . . . . . . . . . . . . . . . . .250.287.3311 Prince George . . . . . . . . . . . .Computime . . . . . . . . . . . . . . . . . . . . ‚ . . . . . . . . . .250.564.3778Chilliwack . . . . . . . . . . . . . . ‚MS Computech Electronics . . . . . . . . . . . . . . . . . .604.858.8337 Richmond . . . . . . . . . . . . . . JCM Computers . . . . . . . . . . . . . . . . . . . . . . . . . . . .604.277.4637
y1MB vmeos3 ‘rm0
v!Ask your dealer about upgradingto the IPC5120-2LO-A or the
y
wcs1zo-zLo-Ac both feamring the 7
IntelPentium processor -120MHz
_flnlfllflhlnaadüfi-awflndljndrflmmfcwpinfinfldmlfiuflufisumbauen nninhnüahmflnvncvonux o v A M c o u v E n -EDMONTON o cALcARv o snsnurroon -n E c m A owmmvsc -TNUND E R am: o L O N D O N -; - --raummuaumnnfinufiahxmfidiaflnnpfiunwnfimflhfinfiduuafiauatflmflj ' _
rononrro -OTTIHNA -K A N A Y A -MDNTREAL -QUEBEC cnv -( M A R L O T T E Y O W N -sann zum.
IIII
NOLÄIHOSH!
I
L5I
NOAJNOIAI
I
HLHOIMLHVG
I
1|1A|11
I
MOLSDNIN
I
ETIIASTIBH
I
BIHHVH
I
K413i‘!!!
I
MOJJNMVH
I
(IHOiLNVHB
0
MENEHJLHI
I
H330
03H
I
398039
SJNIHd
I
VNMO1SH
I
SJOOWWVN
I
ABVMHHB
I
AEHMHS
SJHMOI’
‚ss»;.„„‚fRLAVE
99AuamscIm,Suite 40s, rannte;ÖNM3181’mm(4)5)man:Fax (41353341-10 „1EIIIToI-lR-GIE MaraGulens,
y
MummEntre‘: LarawasKing_a
An D13610! lehniferHmkmscpttAssxsmn Euro: Renöewarm "
o
lfiktllsißrms5usäntl4agill
Lauredatlankstiäqe
- Frankliotnstm,i
Marsha Müller, i 1
Vrpunasyrentm i t ;HD5119 —
„ mmmwamreaummänwfißseafivmfiattflnfi-xg:etedznonadf TotrLHeis o
j 'adaMomrpla;„..Riecnver s}mmimmun»1m "
typewexecveatatiiryxadnbgfiäflmäo
E COMPU T E R PLAYER!
Don't fixatenn the messenger! \.
l e t t n r f r u m t h e
ou've probably had this ex-rience:You buy a CD-ROM that,
l m the outside,seems promisingIThe cove is attmctive and
the blurb soundsintriguingWhen it starts
spinning in your drivc,howcver,you’redisillusioned. The graphics look likethey Were scanned in from an 01dbook, the interfacc is boring, the con-tent is shallow, and the layout is somediocre, you go looking for a hardcopy.At this point,you realize you've been
spoiled by the hyperactivity of theWeh.Then you click on your browscr,
however, and you're confronted withthe same old Internet problems: per-petual slowness,pages and pages of dubious o:
inx+econtent,and an
information quagmire.At this poingyourealjze you've become a“speed Junkie.”You've also
come to demand stunninggraphics and superb content (because youhave had at least a few cxperiences with both‚Witli CD-ROMs and onthe Weh). In short, you want the next best thing to being there, and‚you want it nowJust Iike all the rest of us.
d i t n r
According to Hoffmann, over the past year, fear that the Internetwas going to takc over as the mechanism for CD-ROM delivery hit theCD-ROM industry quile hard.Now, however, people have witnessedthe Internet atplosion. and the financial community has been burntby it.“We have seen the Internet and ISP euphoria happening, but wehave also realized (hatwhat's there on the Internet does not companewith the delivery and immediacy and fastness of What exists on hard-dislcs or on CD-ROMs,“ says Hoffmann. “[On the Net} We still don'thave full-fledged interactivity as we would have on a CD-ROM.”There is now speculation that Wider Internet bandwidth might stillbe a few year's off, {hat it may be localized within networks and notavailablc to everybody, or that it might devclop into a televisionmodcl with channels.lnstant gratification“I think people are suddenly.Seeing that CD-ROMs can deliver some-
thing that the Internet will not for a while. l think that the indmztry isgoing to again pay attention to the CD-ROM industry,“ she says.Hoffmann believes that multimedial companies with technology
behind them will have an advantage in the futurefThose multimediaplayers that have bcen in the past successful in producing games forCD-ROM and for the lnterent are quite clearly in a key position to beable to take advantage of the new media and the new delivery sys-tems."
In fact‚ Hoffmann hesitates to classify herself asjane, Start this crazy thing!lf you read through the multimedia fcaturcs-in
this issue, you'll find out about new informationädelivery advanccs (56 Kbps modems,DVDs)‚ newcontent,and vlvhere and how to find the ootimal‘combination of both.
I
"To be stuck on the wayof deiivery, that's tohave no imagination."
“multimedial” or “CD-ROM.”“It's not the CD-ROM industry we're in.Wheneversomeone asks if I'm in theCD-ROM industryglsayno,I'm in recreational Software.The way of deliveringthat recreational Software happens to be CD rightnow.Tomorrow it will be DVD,the day after tomor-
For some people, the issue of delivery andcontent. including the distinctions and contrailictions betweenthe two, is a daily concermTake lsabel Hoffma n, presidcnt andCEO of Hoffmann + Associates. the Toronto rm that marketsthe highly successful Nikolai Learning Advent re series of CD-ROMs, and which recently purchased Corel orp's entertain-ment and educational CD-ROM business in a dcal worth aboutS22 million.“This is a step for us to gain critical mass to be ;ble to be a major
player,not just in the CD-ROM area,but also in the ntemet and rccre—ational-software delivery,” explains Hoffmann.
row it Will be the Intemet.To be stuck on the way ofdelivery, that's to have n0 Imagination.”Read on and draw your own conclusions. But there's one that you
l
won't help but notice:this is an art form and an industry that's chang-ing daily, if not hourly, if not by the minute...It's show time!Happy surfmg and CD-ROMing, and enjoy the issuc!
D MAY
nur
3:!‘ ‚r-f 1vkalJul.‘
ff’: x’
"i"1
1 9 9 7 >
here oh where couldthat Linux be?
4In the Software scction of the
April issuc of the Computer Playerl,flcevin Linfield writes that the Linux
[nternet do I find it? A
http:llwww.computer-playeucom/
Jperating System can be downloaded —ree from the Internet. Whcre on the
l—a byjthieves. ‘Ehe warningi“ toaiall__7'‚l_
onId-bc; vietims‘ is a good remindcr
ant conscquences.In his article, Steve states: —“Local
police say the most effective method forrecovering stolcn Computer equipmentis to document all malte,model,and ser-ial-ntnmber information in case of thcft.’This, too, is another timely reminder forus all tohave records. not only of ourComputer equipmcnt, but also of all our
7
“dcsimble”goods. -
„ I . to add gto this advice:' i:Vangouiier-based Software’ companyA somehas a stealthy that willncreascä‘ your chanees gof cquipment
16s
w/mt you vom accomplisbwitb the rig/at tools.Office 97 Small Business Editionis the perfect package for your ‘small business. The Small
Home Essentials 97provides everything a home needs to write a letter or
Business Edition gives you six full-fearured applications t0 report, keep track offriends and family, do research for ahelp power your bu-siness. It is everything you need t0 f school report, create a personalized card, find informationorganize your desktop, increase your marketing capabilities, onthe Internet and relax playing games. Home Essentials 97and leverage the power ofthe Internet! Put Office 97Small Business Edition t0 work for your business today!
’_offers something for everyone in the home allowing you toget the most out ofyour PC.
Comes compleie zuitb: Come: tomp/ete wit/J:
AlicroxofiPzxblix/Jer 97 ‚‚ __. ___> . N . 7
Aiicrosofi Word97AlicraxofiOutlaok 97
a m ”K m h i fi l k w fi m ”i MinwoftWerks 4.0
MirrosaftWord 97 Mitroscft Erzmrta 97 StandardMicromfl‘Exce/ 97
V
MicrosafiGreeting:WarkxbopMicrosoft 577141!Busines: _ Aficromft InternetExplorer 5.0FinancialManager ' AficroiaftArradeMicrosofiAatomap Street: Plus
5
MicrosofiInternetExplorerandmm}; more.’
andmucbmore.’
S999 ValueifputbaxedJeperately Valuefor only . pur/mm!seperatelyS ERP*
7
f0’ 0'719’- S] ERP*
UpgradeERP* *Dealer.rmay 52/1for Im
Visit 012e oft/aese retailers today.Net Tech Computer Systems MSComputech DextonEnterprises Software Alley206 -1761996th Avenue 45610 LuckakuckWay 5112 Boundary Road 1630South Bast Marine Drive
Surrey Sardis Burnaby Vancouver(604) 882-5101 (604) 858-8357 (604)435-9866 (604) 321-5499
aeamscoiPe-{eDistributedin Canada by BeamscopeiCanada Im‘ 1 800 268-5535
i:15H
continued from page6PS: I am not connected to Absolute
Software Corporation-I just believethat your readers (especially corpo-rate) should know about this innova-tive retrieval product.
Tbanks for your {arten We baue awriter cunently cbecking outAbsolute’: product. lt will bepfea-tured in an upcoming issue.
ß IIwired upI read a back issue of CCI
Online and found an article aboutStonehaven West, a ‘wired communi-ty‘ in Newmarkct,Ontario. I am inter-ested in finding out now that pro-ject/conccpt turned out (the articleran in the November 1995 issue)..Doyou have any ‘other articies aboutother wired communitics t0 whichyou could refer me?Thanks in admncc,John C. Gunn
We bad an attensive featüre anwired communities. in tbe [da97issue of tbe Player:Yöu am alsoflnd A
tbe art icle a! our web site atb t t p J / w t u t u m n p ’ O
Sinai/I! Bein
Two BC Emily Carr graduates have foundsuccess in a very bigway south of the bor-der.Tish Hill, native of Victoria, and Graham
Hill, originally from Montreal, saw anopportunity for themselves and gmbbedit. In less than two years, Sitewerks, theWeb-site design firm they established inSeattle, Washington, has grown from aback—closet business into an enormoussuccess.Earlier this year theywere award-ed the Status of ‘Most’ Promising NewCompany of the Year” by the WashingtonSoftware & Digital Media Alliance(WSDMA).Their little company now employs a
staff of 35 and boasts some of the most
sought-after clients in the United States,including AT&T, Black EntertainmentTelevision, Microsoft, Paccar, TurnerBroadcasting, and US West. In their firstyear of Operation, their company‘s annual
ramllyEntertammnnt 80MB:IntelPentium 133Mhz16MBEDORom1JGBHordDiskMid-TowerCose orDeskTopCose1.44MBFloppyDriveSounk Blosierl6 Sound Cord12xCDRomDriveUSRobofic 33.6 voice FoxModem60WMultimedia SpeokerW|n95 KeyBoordMSMouse15'Digi1oiMonitorMSBundle (Encono97,GoIf‚Mone'y.Works]1Yeor Technicol Support
sramn31,30
BUSINESS EFHSIEIBY SERIESflifl l lfl i i l
revenue topped U552 million.For more information, visit their Web
site at httpJ/wwwnsitcwerkscom/BCTel's grecn Ilght to broadcutIna gesture that may tum the heads ofcable-television providcrs, Victoria isclearing the way for BC Tel to apply for a _broadcast liccnseThe move comes aftcrOtjtawa was convinced by HeritageMinister Sheila Copps and TransportMinister DavidAnderson to relax foreign-ownership rules.‘Full competition between the telecom-
munications and cable-TV companies isonly a couple of years away,” says BCTelCEO Brian Canfield. “Wäre examining avariety of wired and wireless technolo-gies to deliver a wide range of communi-cation Services. Our goal is to become afull-service provider."Ildhmond nttrncu Internationalhlgh-tochTaiwan-based Aceton Technology
Corporation, manufacturer of workgroupconnectivity hardware and Ethernet appli-cations, has made a new home for them-selves in RichmondThe Richmond officeis their ninth worldvwide office andcxpands their opemtions into Canada ontop_ of their offices in Tokyo, Sydney,
in SeattleLondon, Frankfurt, Beijing, Dubai, Bombayand Taipei. Last year, Accton’s productsales reached S126 million. Worldwide,Aceton employs more than 650 employecsin the high-tech sector.Code swlteh takes effectBC Tel's new 250 area-code switchbecame more of a reality last month formany British Columbians. Since October,callers dialing 604 instead of the new 250prefix for long-distance Calls were auto-matically connected. For the next year,callers will now hear a recordedmessage.The new 250 prefix applies to telephone _
numbers within all areas of the provincecxcept the Lower Mainland, FraserValley,Sunshine CoasLWhistler, and Howe Soundregions. Cellular telephone users arcreminded that units purchased beforeOctober 19, 1996,will require reprogram-ming by their communications dealer.Holldny tnvol nctwork malte:WÜVC IA Vancouver-based high-tech company
has established a private, subscriber-basedintranet Service capable of providing trav-el agents with Computer access tounscheduled airline flights within Canada
GAIVIES LOVERS’LI B R A R Y-FuII Iine ofComputer systems-Custom built systems toyour specifications
PHIJFESSIIJIAL PUWER SERIES818l!!!332C
STIIIIEIIT EBOHOMY SERIESSIUIIIISIII‘
PRINTERLEXMARKOPTRA E600DPI 6PPM 1MB.........................„S705LEXMARKOPTRA 4039GOODPI 109m2MB........................&1570LEXMARKOPTRA1200DPI 16PPM4MB.....................„S1850
MWITHLYSPEGMLSOUIIDBMSTER l6 500MB CARDUNÜEATABLEPRICES
3 CALL USIIOW!Trode- nsWeicome. LeasingAvalobie.weSpecrcfize InCorporcne Sdes.
NNET COMPUTER IVIARTWWW.ZEVEN-INC‚COM/BUSINESS/NNEIHTMTel: (604) 738-7577 Fcx: (604) 738-2033 E-Nlcu: InlOi3Z€V'€0'i0C-C0«"”=
ß COMPUTER PLAYER! b MAY
-Specializing inupgrades'
*0
1’ a}m!!! 5"
nip; „ peiineßurst Cache»
‘
T44. 915V? . .Eiühafrlrdrive» A .7vV iiößikßouafl* 8Xlriifefflai‚GWROMDrive-(ESDE)
i weitematrsneakers 7
» ßtißittsvtikcard r - '
y
t4‘ sVGA1Non-interiaced color monitor2buttonmouse —104ikey/Vfindows 95KeyboardWindows 95CD
PCGames, CDROMS, Computer Boolrs, CDMovies, Rentals &SalesPhone for our everyday Iow price onnew PCgames. Wecarry both Chinese &Englishmies.Over 700 almost new consignments/used PCgames ai very good prices to choose from. Plus awideselection oi hint books and strategy guides. Wecarry both Chinese and English game magazines.
Feature Game of the Month: Magie: The Gathering 357"’Some examples of our fine pre-owned games. Lots more with Iower prices
Ah-64D Long Bow S3800 John Madden '97 538.00 Warcraft 2 538.00The need for speed SE 38.00 Time Lapse
’
43.00 Ouake 45.00Terra Nova 38.00 Duke Nukem 3D 38.00 11th Hour 45.00Hours Nlon to Fri 10am—Bpm
Sat, Sun. Holidays 11am—7pm140 -9020 capstan Way Hichmond, 3.8.One block nonh o1Cannbxe unGarden Cniy next lo 741
Tel: (6010270-7898httpJ/wvawujvbcom/gamesiovers
1997 D http://www.computer-playencoml
.‚_.... --’„....-„_ ._..—..—»—b’! Pfplff‘
c;A‚e‘ I 1 “
Uplnasiimages in aPQ . _. _:r3s1}e>&“%;‘;+ 5€‘"7 22*?‘-
qg r p; ‚;‚— w. -. « - . ‚ „ ‚ . _ „ 5 ‚
'
» sggoxancryigw __Q =_
77" efiictnre am} Iiflsfäßä" v. ._ }?ofv‚jiegfi_insgr
4 u änszan! eranis «s? digfläi amagesConnectioaTvimbig-screen vnewing
'' “ '
v n4 ' '
ew PC PartnersfromcAsloAmts? Capabilityi, mare xxersatiiity’, snare mobility. y
u. 1 » : v„
4 cAssioPEiAiQis4 4
Q
4
a] handheld PCQdevelopedfitjoge Q
4
‘
ajnd4
1
HANDHELD PC"
CQASSQIQPEIA
44
4
44
wmäuiäca" u : :' - 1:‘: L‘: '
Aummalic nata Imks wizh a ‘Jäändaws 5' 96 deskicz: PC Saacialiy cesignen safiwarer“ .‚
-; ü: 1 "z": Lii -4 '—::t. _;
' L4Ä 5- ‚L g ." 1 .
„
v „ z. . _— vBann-in Nhcrosafl?’ Pocke! Mvord Mncrosüfi; Pockei Excel Backäi: dispiay makes {er easy veaäng, aßen .2: äsäa:Poweriul New wctosoflw‘ ‘uvändows 5:‘ CEUperating SystemInternet access an the gc
„u
vmoson.Wsndows.mswmwsLogoammeMnuosafl lmetnei5mm: AVMLABLE A1’:Logoam 9mm regrsteredtraaamrksortmentamafiuuosofl Gorporaxm ‚
—' ' f“ - i’ '‚
'
in lhe UmiedStaus ard/or olbevooumms '
‚ '. ‚
* » BATrEHY Q COMPU Q HJTURE Q OFHCE Q STApLEs-Adobe«sa regvsxered trademark o:Adobe Systems vnoocoocaeao _ 4
‘ 7 .‚
2 *“ PLUS SMART SHOP DEPOT
Indoheflxotoßelzsxersatrademrtofhoobesysietnsincorpomed. j __ '__ ‚r
flXLAamuoaPnoto amtraaemrxs o!xsR Sroup Lmited ‘’ —
m ä fi m m ä w GIVES YOU VISIONCASIO CANADA LTD. PHONE: (416)431-3747 FAX: (415)431-3664 ARD 011cm FINEnamens
COMPUCENTHE C CDMPUTERCUY 0 MICROAGE C ADVENTUHE 0 DOPPLER
o o o o l c o oo
0 0 ByJUNE CAMPBELL 0 0
' ‘äoint project under-fiken by Douglas
"ävüfiTollege in NewWestminster and the
Nicaraguan Institute forResearch and Popular EducationINIEP) has been rated a success’by a team of personne! fromoth institutions.amie Gunn, Jan Gara, CarmenRodrigues, and Cecil Klassen of
—Douglas College returned fromja final visit to Nicaragua in—_March.They participated in theevaluation and wrap-up on aproject designed to giveNicaraguan educators the tech-nology and technologicalexpertise to produce their own—learning materials, such asbooks, maps, brochures, and
’
posters.The idea for the Popular
'_ Education Learning MaterialsProduction Centre was bom in1990, when Fernando Cardinal,
continued from page8and beyond. While regularly ‚scheduledflights are Iargely available throughexpensive networks such as SABRE andGemini, “Solarnet” can provide informa-t ion t0 travel agents for as little as S65 permonth. _ .
The new network features charter flightinformation for more than 250,000 flightsfor carriers such as Signature Holidays,Sunquest Holidays, Air Transat, ConquestTours, and Globus Cosmos,which have his-torically only been available to ‘agcntsthrough phone calls. Solarnet is the inven-tion of SCS Solars Computing Inc. whose
‘
CEO is Alan Winter, formerly of MPR
-E-mail-I60 Mhz° Web-Browsing
Douglas GalleNicaraguan equcators
a world-renowned leader in the literacymovement,addressed an international lit-eracy conference hosted by Douglas_College. Cardinal is the director of INIEPand former minister of education in theSandinesta government.Although a world leader in the literacy
movement, war-torn Nicaragua is hin-dered by an unavailability of equipmentand a shortage of persons with techno-logical expertise. A transfer of Canadiantechnology and expertise was seen as animportant component in the creation ofthis proiect.First stepsIn the early stages of the project,
Nicaraguan educators visited DouglasCollege, where they were trained to useindustrynstandard desktop-publishingapplications. Next, a team of personnelfrom Douglas College visited the Centrein Nicaragua, where they supplied, setup, and later maintained the equipmentand resources necessary for a wel lequipped print-production Centre. TheOriginal equipment (recently upgraded)ineluded two 486 DXs with high-resolu-t ion video cards. CD-ROM drives, Syquest
Telteeh. For1
mp1‘:V
Üinformatiön-‚a visithttpi/Avsrwviisolarscoin/ _
MA Vancouver Weh siteisbcurren’tlybuildingfa database of fieelance digital—artisis andwriters-and‘Clients.The siteCalls itselfthe“Digitaland1s.
’
free of Charge to both ‚contiactors andClients.The focus of the site is to build adirectory of searchable databases accessibleto-and for-frcelance a liv-ing through“newmedia’Servicesconnectedwith the Internet. ,
For ‘more information, the site at. ‚
‚ httpJivvvvvuinterspuxeom/diäfflmiän/
Lastnionth,NorthVaneouver-based Pivotal
a5 Arri126d.’-Word Processing0 Spreadsheet-Connect toWindows or Mac
yxmovvaaI25! Pacific Boulevard.
British Columbia V62 2R6604.899.0425
Q COMPUTER PLAYER!
TORONTOI40 Adelaide SnEastOntario MSC IK94 6.36I.0446
P MAY
MONYR€AL450. Ouest Blvd. Rene-Levesque
Quebec H2Z IZ65 I 4.954.I 308
liv
driives‘, tape-backup drives, an HP 600 xeqo dpi laser printer, an HP 500 dpiflätbed Scanner,two VCR‘s, photography‘uipment, a VHS camera, analogue edit-imequipment, and other miscellaneous
items. Software installations includedsuch staples as MS Officä, Pagemaker,CorelDraw, Pbotosbop, and disk-mainte-nance applications.
ccording to spokespersonJamie Gunn
Ü}!!! Douglas College’s Centre ofE‚ucation Technology, the l i t t leNicaraguan print shop faces challenges f
a1‘ ost unknown to Canadians.irst, power supply in Nicaragua is
uripredictable. Frequent and unexpected“ '
wer outs” combined with faulty elec?t cal wiring, leads to plentynof downtirpe. “We just sat back in our rockingc ‘airs and waited for hours for the elec-tiqcity to come back,” remarked Gunn.Environmental conditions presentedthkir own set of problems. Equiptnentwas in need of protection from Water
streaming through the roof during tor-reiitial downpours of rain. Even BCdyirellers, not unfamiliar with rain, foundthe “humidity” level to be excessive.
F»essful Reiduonsbij: A
’ f gwhich is used fpr consolidatijngland. fsmarketing professionals. — — —-_e new release iintegrates ’32-bit
a tionsbifis architecture also enables"an’2..ed nurnberof users to share curfent.-omer information using ‚aSYSICIII thatgrates virith Microsoft Exchange Servera ology. Cost of the Software is.‘x
_ i‘
138 ADELAIDE ST. EAST. TORONTO. CAN. M50 1K9FAX: 416.361.0451TEL: 416.361.3443
, 1 . 8 8 8 . P A L M .4 u 2 I
ge assists
e” released theruecondlversjofiäof m; r j Tori-a W o r l d 5x' ’
that featurestö60-degrce”Ä
*’ viövvs of popular landrnarlis Greät
‘.nizing Client information _used i
. x
’
fmaldesignerfRaymonci Kam‘ hasgained
www.palmtopshop.com
c4
DustyOn another occasion, dust proved to be
the culpriLAn examination of a malfunc-tioning computer keyboard revealed theinterior to be a clogged mass of dust andinsect bodies.The keys wcre constantlybeing shortcd out.Local unavailability of supplies and
shortage of technically trained persons isanother hardship.When problems occur,such as a hard-drive fai lure, the item have ‚to be ordered from Miami;flnding a localperson with the expertise to install thenew drive is difficult.Not surprisingly, according to Gunn,
“Brain drain was one of the biggest prob-lems we faced. As soon as we trainedsomeone, they left the project to take abetter paying job somewhere else, andwe kept having to retrain new people".Despite almost insurmountable prol}
lems, the project has succeeded and isnow both economically self sufficientand producing pr int materials for use byNicaraguan educators.As for the Douglas College team, they
have new found appreciation forCanadian computing conditions! O
yancouvenvfhei site nsesnblogyÜt0 _ tours ofifamöüä‘spots;suäh as Stanley Park-„Gxjagirifleiff -m
. Smog‘Fraser University, ittie new‘ centmi bianch’ of "the
zäsPÜbläC Iibrarygffhe site hasb e e n :- parnedawards fromYahoo! Canada.1}.To;vievv:the sitegvisit httpr/[www f‘ca/e-‚rfaymondk/SpiderIQHÄCkTinIeZ/j’indexhtmi, _
,
Stgvifliain i5theComputerwayw/cafiqdbfemcorresppndentin Vancouver, _
questioqs, orcomments toStevefllefiinäl
FeaturingProducts by:HP 320LXPhilips ValoNECMobile ProUSR Pilot \\Psion 3C ‘
P US ROBOTICSPilot PersonalPilot Professional0 Backlightingv Modem.connoction0 Email capabloo Upgrades available
| \ \
l1 9 9 7 b http://www.compluter-playencom/
'23“ '"ICI->I g"- . . Parker Place äT6“ 694173-13“ ääifläiiitf.“äfi'llilfiifw‘ifi‘i;525221222’:.255äifäflfäl, ä!“m °°'“‘° i:. ‚
' z äFax- 604-278-5268 Busmessflour:Mon-Sat: 10-7, Sun: 11-7 AIderbridgeWa5
Email: [email protected] WWW: ht1?://www.parkerplacecom/infowave/ LansdowneMaII
;P-166/MMXUpgradeSpecialsää IBMAptiva Systefm Specials May Specials{Trade in your oldComputer 81Upgrade to-P-166/ MMX-166: iAll with 33.6K Faxuodem, 12x-16xGD-ROM/meatresound, Inkjet Printer: Epson Stylus 600, 1440 dpi S398 ;j Intel Pentium-1GB or MMX-166‚ 256K Cache, P 166
'i9-40Softwaremies, Stereo Speakers, Keyboard 8: Mouse Laser Printer: HP 5L, 600dpi/4ppml1MB S548 1'' Monitor: NEC ‘I7xv+‚17"‚ .25dp S948 :216MB RAM, 1.3GB HDD, 1.44MBFDD.
iPCI 2MB MPEG Video, Mid-Tower Case.IMultimedia Option:LAcer 12x CD-ROM&Acer 16 Sound +8168
59281098,MMX-166
3
igAptiva E IBM166+, 16MB, 25GB,14"MonitorS2498iAptiva C MMX166, 32MB, 31GB, 15"MonitorS3198äAptiva S MMX200‚ 32MB, 4.2G_„_,B, 17"MonitorS4698
ZIP Drive: Iomega 100MB, Internal SCSI wl Controler S198:CDWriter: Panasonic 4x2 kit intemal SCSI wl ControlerS59856K Modem: USR 56K intemalVoice/FaxlModem S2481
AII ICISystems ComeWith 5-Year Labor&2-YearPartsWarranty&OneMonth Free InternetAccess !
-1‚7GBE-IDE HDD Mode 4‘-PCI64bit2MBMPEG Card-15"N-I L-R SVGAMonitor-1 .44MB 3.5" FDD-104 (Windows 95) Keyboard-Mid-size Tower Case-LogitechMouse + Pad-EIDE 12xCD-ROM-SoundBlaster 16 PnP-60W Amp.Stereo Speakers-Compton's Encyclopedia 8.4 CD TrtIes
Upgrade Options: SoftwareOptions:Up to 512KP.B.Cache +820 Windows 95 (Release2)S13032MBRAM (from 16H) +3110 WindowsNT(Station) S2802.1GHD(from1.76) +340 CorelWordPerfectSuite S90Acer33.6VlFlFDIModemS120 MSOffice97Pro S480
1
Ä4 6MBEDORAM (up to 128MB)
MMX.166/2001/-Pentium 166/200MHzCPUWithMMX-512K Pipeline Cache „ M L 1 6 6
-2.1GB E-IDEHDD (Mode 4)-ATI 64 2MBMPEG Card-15"N-I L-R SVGA Monitor-1.44MB 3.5" FDD-104 (Windows 95) Keyboard-Mid—size Tower Case-LggitechMouse + Pad-EIDE 12xCD-ROM-SogndBlaster 16 PnP-60WAmp. Stereo Speakers—Comton'sEn c l i a & 4 c0 Titles
Upgrade Options:32MBRAM(from16M) +5110 m .2.66HD(from2.1G) +540 Wi -.16xco-Ronmrom12x) v‘
Acer33.6VIF/FDIModem5120 MSOffice97 Pro
S56/mth*
Pentium PfO Ü-Pentium Pro 180/200MHzw/256K Cache-lntel VenusATX or AsusATXM/B-32MBEDO RAM u 1o 128MB-2.1GBE-IDEHDD Mode 4-ATI64 2MBMPEG Card-15"N-I L-RSVGA Monitor—A7'XTowerw/235WATX P/S-1.44MB 3s-FDD-104 (Windows 95) Keyboard-LggitechMouse + Pad-EIDE 12xCD-ROM-soundblaster 16 PnP—60W Amp. Stereo Speakers 377/1770!‘Upgrade Options: Software Options:
64MBRAM (from 32H) +5220 Windows 95 (Release2) S1302.66 HD(from 2.1G) +540 WindowsNT(Station) S28016xCD-ROM (from 12x) +540 CorelWordPerfectSuite S90
872011011Pro-2m
USR 33.6 FuII DuplexVi 5150 MSOffioe 97 Pro 5480
6x86 P150+/P200+‘CYF/X 5x35 P7501‘?755+ CPU .. H|TACH| |BM-ThinkPad-MMXReady/256KPipelineCac e “P5 E133DN P133 16M 1.0G 11.303711‘ S2098 365XD P120 8M 1.08G 10.4DSTN 4x S2578 g-15MB‚;AMaLgtQ1ZQ„5‚ E133TC P133 16M 1.0G 113TFT I)8X S2778 365XD P120 8M 1.086 10.4TFT 6X S3048 ._13GBE_‚DEHDD C133T P100 8M 1.06 12.1TFT ‚ 28.8 S2468 5x0 P133 8M 1.4G 11.303711 6X 2868 i- M1200 P120 1611 1.0G 11.8DSTN 8x 28.8 tagiggaa 365XD P133 8M 1.46 11.3717 6X S3698 ;
MX133TP13316M 1.46 11371-7 8X 33.610BT S4998 560 P133 8M 2.1G 11.303711 Ultraslim 53838}TOSH|BA-SateIIitePro NEC-Versa z
' ' sss/mrn’ 430CDS P120 16M 1.36 11.8DST 110x S2778 243060 P133 16M 1G 11.3DSTN 6X S2798 i'1°4(V‘"“d°""s95“‘°"°°a'd 430CDT P120 16M 13G 118TFT ‘10x S3698 2650GB P15OMMX16M 1G 11BDSTN ex S3998-Mid-size Tower Case ' ' ‚ ' ‘
_MS_Comp_Mo„se+pad scEp-l-REsoundx i; 423OCD P133 8M 1G 10.4TFI’ 6X S3898
3900 P100 am1.06 11.30sTNI_: was ACER-Acernote g„Acer 15bnsoundcard 3900 P100 16M 1.06 11.303 ‘6X 2 8 371 P120 16M 1G 11.3DSTN Li-Ion S2198.. E“ ‘
‚ 3900 P133 16M 1.0G 11.303710 6X S2748 373+ P133 16M 1.36 11.303711 10x 33.6K S2968 2'5°WAmp‘ 3‘°"°° Speaki-‘VS 5430"" 216 121TFI' i 10x S5498 374+ P133 16M 1.6 1137m" 10x 53288€
Dr ‘ves P '1 rmters
‘IFujitsu1.3GB/1.7GB 8248/260 Acer33.6Fu/lDu IxV ' 1 12 Proview14"/15"N-IL/R 8228/308 gzaaxpcmclArax/Moden 8188 Ic I r pr-nter.FuJitsu2.1GB/2.5GB 5298/328 USR33.6K Int./Ext. S138/208 Scegtre 15011-1141155--- Jm I3C0mEtherLinkIlIPCMCIA S180 lI o o ’ -fQuantun 2.1GB/2.5GB 5298/318 11312335FuuDuplexvgicelnt 5150 Acer17"76ie/78ie 5698/728 iAdaptecAPA-146OSIimSCSIKitS238 1 ‘CanonBJC-240C0|0r 5228Ouantun32GB/38GB
äflß/ggg USR33.6 FuIIDupIexVoiceExt S248 flgggflgxw s 3468/65 MegaHertzXJ10BT10BaseT S165 f408mm BJC-4100 42 298/318 i;w02.168/2.56B 298/ „s„55‚(p„„g„ [exyofce 24g
" _ __50 1028/11 MegaHertzXJ428828.8Mdm S298 I 10m0"BJC4550 17‘X11“C0I0r 5598 21WD31433/4093 3368/463 DiamondWdeoConferencingKit 3498| g°"as°mfg_7Gf’‚7GL. 5438:2: MegaHenzxJ4288M288ce1 S328 i I5 50040049IG-OGB 5598 USR Big PictureVideo Phone Kit S498‘ am“? e '
MegaHefiz33-5K+10BaseT S428 1 IHP Desuetflzggglgr 3328121GBQuantumSCSl S418 ' 5°"Y15 ‘° °5X"° °3F 553m6?“ 1M ‚am 2 3 3 K ; M d m 24g I EHPDeskJet82OCxil870C 5510/650145GBQuantum SCSIUWide S1268 Sony17"ZOOSX/ZOOSF 5938/1138 ‘usRzsgK FaxMgdem 5253 I i14.368Seagate SCSI UWide S1268
?HDDControllers .{Adapters2940 PCI SCSI Kit S260‚Adaptec 294ouw PCI SCSI Kit S328gAdaptec 3940WPCISCSI Kit 5530Diamond Fireport 40 SCSI Kit S168
;ZIPIJAZ Drive .g100MBZIP Drive Para/SCSI S198l1GB JAZ Drive SCSI int/ext 5498/6181100MBZIP Disc1/10pcs 519/1781GBJAZ Disc1/5pcs S1251628Panasonic 4x CD/Optical Drive S560
Tape Backup .Ditto 800MB lnt/ExtTBD S168l208Ditto2GB/3.2GBum 3250/328CoIorado T1000 BOOM In/Ex 5178/218Seagate 3.2GB 712.3 um.790 S298Travenm1 m 2 3Tape 839/75
Panasonic 8x/12xCD-ROM 5118/128 '
Hitachi 12x/16xCD»ROM 3128/168 ,Pioneer12xSCSICD-ROM S198 ;Acer 16bitPnPSoundCard S38 '
Soundblaster 16/32PnP 380/138SoundblasterAWE 64 PnP 2 ‘
Backpack4x CD-ROM Par. Ext S298 2
Backpack 4x CD-ROM /Sound S398 ;YamahaM15StereoSpeaker S88Labtec3D Speaker&SubwooferS148
Panasonic4x2 Int. Kit S590HPSureStore6020i CDWriter S638 iHPSureStore6020eCDWriter S768Yamaha 6x4 Int. IExt. 5868/968Yamaha 6x4 Int. / Ext. kit 51068/1188Sony/TDKBlankCDMedia ü)
Sony 17"SEZT 1600X1280 S1398Sony 20"300SFT 1600x 1280 S2298Viewsonic 15“ 'Wewsonic 17"V775 S868Viewsonic17" 17GS/17PS; 5868/968Viewsonic 21 ' P81O/81Sj 998/2468
Video Cards‘CL 5446 (MPEG)PCI 1M/ M 538/60;S3 3DWrge 2M/4M S88l98gATl 2MEDO /3D Xpression 388/118«ATI3DPC2TV2M/4M 3168/198iATI3D ProTurbo PC2TV4M S2381ATITVTunerCard S138l ‘CreativeLab3D BIaster4M 228,DiamondStealth3D2M S138‘Diamond 30 34004MVRAM S298Diamond 3DMonster 4MEDO S2981 2 9 4 m DMatroxMill.3D2M/4MW 5228/298
RAM/CPU.3op1n 1MB/4MB 310/35 ’ä72pan 4MI4M EDO sao g‘72p1n8M/ 8MEDO sss I72pin16M/16MEDO 311072pin 32m132m EDO S220 1AMDK5-90/256K/E-IDEPCI 3190
'
P-120/256KPBC/E-IDEPCI S288P-133/256K PBC/E-IDE PCI S328 zP-166/256KPBC/E-IDEPCI 3450 ß
ISA 1SbitEthernetCombo S38GVCPCIEthernetCombo3Com305098PCI10BT .. S1503Com 3C905—TX PCI 10/1OOBT S168NTServer4.0 5/ 10 User 5999/1238NTStation4 .0 S298
i HP 4V/5Si/5SiMx
Networki/ *
S68 ’
iLaserPrinter .sBrother HL73ODX 600dpi 6ppm S488iBrother HL760DX 1200x600dpi S598
y
.5HP 5L 600d_gi41mm 1MB 5528;HP 6P 600dpiBppm 2MB S988äHP 5 / 5N / SM S1728/2128/2468
32598/3678/5150IFuiitsu10ppml14ggm 5698/795exmarkOptraR+ 1200dpi 160 S1768
} exmarkOptraRN+ 1200dpi S2088
gScanner .{HP ScanJet 5P/4C 5510/1068|Microtek
ScanmakerE3 Flatbed S318 ‚Microtek Scmk. E6 Std/Pro 5488/768 EU-Max 6E Pro S798 J
DragonWriterChinese/JapaneseS278Chinese Gateway 813x3Pen S348FineArtGoGo6x4PenSystem S288
o c u l c o n n o :c
"‘° 9““!7-inchmomtor roundup
31iz_e'13.21
0 0 ByKEVIN LINFIELD 0 0 warc)‚a monitor.‘ file forWin95‚ and Display Data Channeldiagnosüc utilitics rWindows 95.
We asked majormonitor m The estimted s et price is S999, and die monitor comcsletustcstwtmfläeyfeltwouldbctfncir withamree-year w.bcstmonitorfiardncsecondifimxsza l7-ind1 SmndmüSIPIIRdisplayglmfixanslpooretamandaimcdat Formominfi)
thehomemcnflrywuetcstedmdcr OIJfhCWCbJViSitbothWmdows9Sand0S/2win1anATI opuquestvy‘Mad164VidCOC3Id(With2MBOfDRAM)- bymsonflc ‘ümWPmmm"8h“5P°°°9-d°m8m TheOptiquest A
nitorfcamtcsaßß inchdiagonal vicw-
DPMS,Encrgy Star,MPR-II,andTCO92.' ‚Call(909)869-7976or 18008888583.J/wwwviewsoniccom/
mdaYwdaYmdi-Wflhwmchiflhß ' smfacea umresoitio E1280 1024 65HzTheoptiquextvfli Vlewsonic - - - m3 '
e
“ “° .x a‘b’ WWDOSWESWNWHMWWM (l024x768at85 )a.nda0.26mmdotpitch.'lhclowdot
°f°°msd ‘ pitch makes this: odcl grcat for day-to-day usc 2nd DOSEvery one of thcscmonitorsWill providc the home userwithan cxcellent 83mm Esfimawd
-7
et pficc i5 3799 am‘ mm3 i5 ammeywdispIaytemümlandwfllbesignificanflybcttermananyM-orlsindlmon- mmloncymr
.
itor you might currmtly havcAll ofieredomscrecn digital adjustmcnt of set- smndardsvgsA‘PMS’MPRJLEncrgy 3m md pnp_
rings suchashorizontal ancl vertical sizx:andposition,andallcamcwithwriv- F0,m m 3 wo '
“an,ca“ (909) 8697976 m. 18008888585e] bases for easy tilt-adjusunenLAIlpdccswer:supplicdby thc company (in On theWeh’„ i m Pz/‚Wwwviewscniccom/
.Canadiandollarsfiindinmostcascsarccsfi- - -
matcd street priccAll claim t0 b: Macintosh 5°“,M “"3"(Pmzooslx. f l2 o 4 60compatiblc whenuscdwithaspedalMac
amaxmmmtcsouflono 80x1 2 m
Video adapta‘
' -r . and a O.2mm dot pitch. Nice fearure: separate contmst and
"Yundai nennst!“17Bmodelr
brightn -5buttons that make it easy for minor lighting adjust-ML786“ _ '_ 1 2
055m8 a ‘e-‘dumn °f 1280 X 1
„ The tcst u. ni tor showed discolouration in the uppcr1024at ÖOHZ and 8 l5.7-inch ä
.7’'
u.’- of the sagen,and almough {hexe i5 n0 separate5'153.53 Wim 038mm d0‘ Pitd‘: ‘m5 ‘mnim’ 1 7 — '‚ uon, a call t0 Sony informcd me that each time youoffers a good, clcar picture at high xcsoluüons, ‘
7
’ '*
'
tum thc uni tor ofi’and on it will automaücally degauss itsclfibut lookedbes:at 1024x 768 (at 75 Hz).It pi!)- A»
’ "
_ . -c myComputerwas o“ aueviatcdm3PmbIflIL“"535 3-0 mmoYinß audiblc "Guck"Whe“ V0“ "
_ Note (hatu is an annoying audible dick whcn switchingChflflgc 1330105005131‘COmCSWim 3 ÜWCÖYÜT ’ -- between 0 SandWindows scssions.Estimated street pricewarmntyandhasancsürrmcdsuveetpficeof
'
i55999mdthücisammc_ywwar_S799. _ „amstandardssMPR-lLlincx-gy SILHLVFSA DPMS, Standards: pnB MPRJL Enctgy Star’
and PnP. andDPMS.. For additional oontact Hyundai athflpJ/Wwwhdcokr/ or Call (408)252-8662.
Elzo Flexscan FX-C5_Foxmcrly sold as Nanao, this was theonly monitor testcd Ihm rccommcndcd mum msolution of 1230x 1024 atnotmnnmgatxesolunonslnghcrflxm . ‚ _ 60Hza024x768m70 Hz)“1024X758(at85H1>-31fl1°"8hth°5P°C 0.28mmdotpitd1 c a lssmdxdiagoxulvicwmgsuuracemncesheet claims that thc monitor can handle man;separat ‚ -s conttol fior contrast and brighmess.128°X 1024 a‘ 65 Hz (“m ‘wem-TimView‘ This monitor o bothD-sub and BNC conncctors and its351° 45380931 5 9 m 3 “5m i5 1554m“m“ ‘h5 cstimated sucet_‘ce is S849. It comeswith a two-ycarwarran- ’
monitor has a 0.28mm dot pjtch. mExtms induded special haniwmc and softwatc(Samen Manager Pro brWmdows 95) fix finetuning and oolour bagance, screen dcaningdofin,andfien-iu: 001dWappens in:attadfing tonon-Ezo Video atbleaTlnemonimr can be can-necned via the sumdmd D-mb axmecmr or aBNC ablc.Estimated suact prioe ‘s S999,2nd ltoomcs with a thme-ymr wananty. Nie: kann:
Standards:PR-Il.EnergySm1-‚TC09S,andPnl’.For morc information, contact Eizo at
httpzl/ wwvmeizmcojp/welcomc/ or call 1-800-800-5202.
Formotec o n t a c tSony(‘anada a:(416)4991414.GVC M1766
Pviyuruda? HE Thc GVC model tbarums a maxi- ‘ä
‚I‚andEnergy Star.* For morc information, ‘contnct GVC
Canada at (905) 738-9500 or visithttpzl/wwwgvaca/Daytek DTI731DThc Daytck monitor hadone of thcbcst picuue qualities at 028mmdot pitch. It features a maximumrcsolution of 1280 x 1024 at 60Hz (1024 x 768 a:80 Hz)wicha whopping löö-inch
Fa e. Estimaxed strect price is S760 undviewsonic mvs (173695) _ „ u m ,Fcaturingamaximmndisplaydcpflaofl600xlü0at69HzG280x ;l024zt80Hzandl024x768at l06I-lz)andadotpitchofacrisp0.25mm‚ - - „ist ( „ a n
thismontiorofiers cxocptiounllyslnmdcarinngealtahooflcrsbothBNC (905)94ou28_andßsubconnecwrsandhasalömchviewablediagonalsctceaflhesofi- A
t_ dwatedßkindudcsopfi-Gteenforwindowsäflmonitorpowu-savfingsofi-
um “ H ” °0 COMPUTER PLAYER! b M A Y 1 9 9 7 b http:llwww.computer-pl.ayer.coml-
F u fi y I o c d e g l P-‘I S; cgnßg 6 7 5M D G just opened c1 brcnch In your h o m e This Changes everylhinggel exoclly Ihe S a m e quole czs you would Computer relcxil will never
from our slores for your be Ihe s o m e again.N0PST GST N0PST GST Only
cuslom Configurofion visit us al : WWW.MDG .CA
Sa ip o Premium qualify TriIon molher board , wlfh 256 cache In) Io I MB._ y 4Phc’
Cmd 4 ‘SA90“‘-
"GShROQÄBIOSRGWIQY 90" ‘mmpfllcnl Enfry level pacl<age : excellenl Ilrsl compuler or inexpensive Upgrade for your
pre„bur„ed and tested units äfidgmfd ‘DIEl“P1134 "SKEIDSVESI:
655°Semifipm“:
05’ exisling anil. Fäaluring Iop oI Ihe line InIel Irilon mofher boarq and llghlnlng- ' ‘ec‘ono 99“’ e 9° - memmV ‘Uppo fasl 64 brI svga card wrfh MPEG Ihal allow you fo walch movles on yourready t0 gO any ÜUTE o B50MB hord drxve ‚ Enhanced IDE ‚ several fimes higher Transfer COTUDUISI’ screen. Playing garnes aI home on one of lhese syslems is an-experience Ihol will make you say any olher plalform (SEGA. NINTEND0 64) Is" small kids sluff". Top brand name parls,MDG workmanshlp and allenfion l0
raIe Ihan regular IDE. Mode 4u» H. 8 MBEDO RAM, 72 pin. The besI quolity memory
lt . . t t b tt z51:‘?fläzflgflivfglpägggogäfiä A" o‘ Moflox cvomble delalls makes Ihis machine by for Ihe bes’! buy in enfry|5 ‘mposs’ e O ge e er ‘ Ekegcm‘ mini ‚ (ower case 250wOcker Suppw‘
(economy)Ievel compulers in Ihe world.value for our money.We can _save you undreds of dollars.ü’
I04 win 95 Enhanced keyboard mMwwDeal with the best sales P-I505 595 P-I665 67 P-ZOO
‘B133 X IQ’Ä F Q I I - E“II-Ba5and teqhnical support force II]S t o c k f a a fl y t
In the industry o Premium qualify TRITONmVxChip ser,mofher board .wifh 25s pipllne t.0“‘" w " P°°‘“°‘°"°m9 bes‘ ’°""‘9 '"‘°- _...
vb bursl Cache 3 PCI and 4 ISA Slots, flash ROM BIOS. energy slar pen ‘um 7 M065 "enßndousbuying DOM/e‘W6 w“|NCRED|BLE LEAS|NG Q p T | 0 N s ;:o;n:IzgntEfri1han|ced llifillupdloEggarddnves), 1655gseUrIal ponf. _I 1 OO er33] JO/mo more in O weekmanm05? d m6 ‘CompemonN0 MONEY DOWN 5J. sänläiiä°f°'ii‚äo‘äfelogoofifiifäföäfär Iwävvi?“ pentium M"s°"'“°v°°'-l
' . ' pg _ ‚
' One step distribmion , direcfly from our productionq} o 1.6GB hard drrve. Enhanced IDE. several hmes hrgher 1 erßzß/mo 0nd tesflng ‚ccflmes ‚o your hondsIransfer rate fhan regular IDE Mode 4 ms bes,„einer, und peu udewomls In m6
I TIIIÄi/IQASOEDO :fi\CAe.I;ä:aqs'oT::)be5Tqucnw memow pen lumß Inausfly on hand 1o help you on our sales floors
coNsuLTANTsAND . S-Bverge 631312 MB „wie.Video card I 3 3 orsma/mo “°GIs°°*°“°"W""°"°'"Y°“° ° w ° m m__ _ opprooch I0 cusIomerseNIce.o EleganImznr Iower case 250W power supply enrflumCa": o I04 win 95 Enhanced keyboard pJeuuen r.. ‘I6 6 Just a few reasonsmmITICIKB ‘rhrs Inne Canadcrs" 0T540-27/"30 hoffencompurem. Delivering unsurpassed power
c| ne corn uter FU" mUIIImEÖIG Upplüde - and performance and scMng you hundreds of
fioueflore. MoGns (I 2XCD ROM I6 bn sound card and speakers. « (gmosm; S dollars In ‘Ihe procesa
legenda quality for pentium “I'm? 0’ - m°„m „ m m ‚o 4 MB
th°äfääldrfraisäÄ2‘ä'e‘.""’ "o m' Gala" Intelmmxtecnnoinnvnowsfilnnlnn !!PRICE IS 3% CASH DISCOUNTED‚CREDIT CARDS, P. O35 ADD 3*. ON SPO‘!LEASING AVAILABLE, APPROVAL IN MINUTE. PRICB ARE SUBJECTT0 CHANGE WITHOUT NOTICE.
868l2 0 0MMX"Zü! intel pentium200 MMX CPU.‚;1PIntel Triton lIl (VX)Motherboard4' 512 kb pipeline burst Cache module«I: s4 MBEDO RAM (60ns)4P4 GB SCSI ultra wide hard drive4' Adaptec 2940 SCSI ultra wide
. . Ü’ -PenIIumProSeneso 3502335553125:am I,’ äffß"‚'fip'e‘fiflfiätji'd ‘I50MHZ S1595 oI35256/mo* ATI 3D expresion SÜRAM ß M“ tower demxe 250W ndows NTServerForTopGunsOmy ‘I’ 1-44 floppv drive w!12xCD ROM 1 MHZ ÜI mwflflm5m
NT rk I I"IdealforwhdowsNTsaNerora powerhouse home mochhe Ü Microsofi mouse z
wo s a ich
Ihe onlymmon Ihk monsiers do nol go any iuslerk becaurs MH Ü s29954-5145ü» 95:22:55.24’ zu .-
4’ natural win 9s Keyboardl
Q AsussTriton4(tx)MBvvith512kbp:pel|neburst q, Midmwerdehmezsow SPEBIAI:wehe module, SDRAM, Concunent PCI, Universal __‘mmxophon Gdd s195 se„a„,„s_ ‚w, 5d ‚am 905 1PSONY15 .25momtor IN IIPIIDI
1P32MB SDRAM RAM (r r m EDO) ‘I’ 12x ide CD ROM nur H!1 MHz or ÖSBQ/mo Ü’ 21 Gbweslemdrgitalsrfxzrgfinfesteran * "V5329'335"? L355 “"5 “umQmnmß_
1 66 MHZ S2275 or 75.54/mo xflfä’:ff:”" ‘ “B W M "°'“"°“°“""‘"‘“°„ , 5 älnnsrm.. . fi _ _200MHz S2495 orasos/moww’ “ n ”mggrggggfiggqgfiggfiwww .»v"-.Z5’.25„?„’‚f-Z„?Z3Jf’
.- . " a m r:::"'"z-:-:-'v-5sz:‘:=cr L-ir-a-rnsr. iwjiä9üzöfäß9i xäxzir-fif"-"-‘liäcifißäfimr-‘ß:"
Nothlng IGSS than perfection IS acceptable for US. Our Computer vrsron syslems lake heavy bealrngs on productlon I m ä Only MDG machrnes ean stand ’ pentlum pro 18‘)add 5195We measure our Success by customers satisfaction Ihe Iest o! lxme and work Irouble free for years In dmand smoke Lawrence Ho VP ASPRO Technologles S 9 ‚m,week 0m’. 1,99„pgade 9°44 Intel Imon IXChip sei and
32MBSDRAMn0‘- bYprafits- Visjt “Sand experience the difierence Any small Dusmess Iookrng for a Computer, wrll geI Ihe besl value for Ihere money from MDGof dealrng wrlh people who care . LouxsAI Jaar ‚ Business uevaopment advrser ‚ Federal busrness developrnenl bank
MDG M I s s - S S A U G A ‘i’:332:?%‘3:22;Z „o...S;'?;7:%'ä;?;f2‘i:;:'?:::?sgäiääfioy5s monaav e wem <>e v5659 McAdam Rd.‚ L42 1N9 fax: 9 0 5 — 7 12 - 9 3 2 5 M o n —Fri. 9 0 0 m m to 5:30 pm s E.T. SQTUFÖOY 1045 35T
vI
Multimedia islqiglgtot’inmany contexts.When it was first. in .
involvesmuchmore.Somethe term and graduated“
'
and "NewMedia”.
preferto use “interactzve.media’Multimedia’;
‘
the nameoftheeve y
will beannouncedtduring"Regandless ofwhati
" ’
With the intmduction(asymmficalt 659i? Q.Iaunched sometimey
l
Cy. "lt’|| take aboutsaysVlfnlson. "You'llamouse andbookyour holidays {onlinggyaMarceau-Fawcett antieihas been used alniostexcte _find a niche in"thevyy _
' '
t3So avoid getfing’Iingo isehängingg
lll
Web ‚
Take a gander around th.e Web today. The promise ofmultimedia bnline is finall
ll
0 I ByCARlrN MLADEN 0 0
In the early dzys,we all loglkedforJumssic Park-style graph-ics to leap out of our Computer screens. lt was not forth-comingandgmduallywe
' ' ourexpectationswere allwrong,or at leastmostly ng.It evmtually dawnedon usthat the Internetwas not de to be amovie theater (we'rehoping the, Rogers gang realize the Internet was notmade to be a television but meanwhileWe can enjoythe joys that appropriate rnultimedia bring).So, whatever happened: to the promise of multimedialonline?Whene are the visullzilly richcommunication materi-als on the Intemet?Calm downflheydo exist,but they aredifferent types of media,
l
ew-style artistryr, and program-mjng layeredwithmultim V
'potentialffhe Internet is not
made to band you pne-falnl buxsts of high-tech Hollywoodglamour. It is at its best vsihen it allows you t0 take whatyou want andmalte it you} own.Ileverse cartoon enqlineering?Downloadaudio,Video,software,andanimations to leamhow they Were made andlto replicate and expand on theideas of othersJustwatchput for Copyright issues—lotsofmaterial is freely availnble with Copyright specificallywaived.Malte sure you the safe stufl’.What else? You can find upgrades, product informa-
tion, tech help,and cool Ilricks from all the producers ofrnultimedia products. From Adobe to Zelos, the newmedia royalty hold court all over the online World. Iwon’t bore you With a ljst of Web sites, since most ofthem are as simple as htltpzl/wwwgxdobecom/ and allare easily found With a simple Yahoo, Lycos, or Excitesearch. It's even ezsier if you’re on a major Service suchasAOl.or CompuServeTheyTe congregated together,forexample, under the keyword: Multimedia.These areasoffer a bevy of Services, access, FAQS, and seriouslyknowledgeable people.Ifyouan:looking forsiteswithbitsofvideoandanimation,
meycanbe fbund allover theWeb in the form ofadvertising.It's true!Advertising has become fun.Nobodywantsall that stupid junk email and the heavily hyped push tech-nologieshave not yet effectively taken shape.Real cash (andpush),however‚isbeingmade by theWebproducersandsiteadministtatoxs that am setting up hotmultimedial ads.Starbucks coffee pours into a mug that never Over-
flows; kitschy, shiny, happy 1950s people gtimace andguffaw about the benefits of condoms; revolving andbouncingplanets pointyou t0 happeningnews sitesffheeffects arerrt nearly a5 ‘
messageflhis,at least,shquld hold some promise for thedevelopment of the We —at least the commercials inthe Chat rooms can offer ‘some form of intelligence.Java applets and object äorientation offer some striking
programs and interesting fvisuals, a5 well.You can matchyourself to a mate or wateh a flower grow from seed tofull bloom in seconds.Chleck out the MITMedia lab sitefor innovative ideasffhe ‘nly problem with some of themore advancedmediao '
gs is that they require the lat-est versions of Netscape r Internet Explorer and someserious hard drive space_ d modern speed to be effec-
o COMPUTER PLAYERI P MAY 1997 b httpJlwwwxomruter-player.com/l
-wrong thingsWe are
rtant as the clevemess of the *
y starting to take shape.tive.We in the industry often ignone the important factthat not everyone is using topof-me-line pmduct,nor domost people need to do so.
Holy gimmlck!Meanwhile, at the Batman animation site
(httpz/lwwwbattnantascoml),prettywellanyone can seethe Dark Knight himself confidently striding along.Playthings such as these are cute, colourful, and some-times clever, but do they have any substance? Honestly,they generally don't,but thafs not the pOinLTheyare theinitiators, the precursors preparing us for the better ver-sions that are in development.’ I know you’re thinkingfEverything is always‘justaroundthe corner’andneverquite what we wantWhen we want it.“"lhars true, but onlybecause most peopleare expecting the
dissatisfied with theWeb because wecxpect it to beTVWehave a problemwithComputer games be-causewe expect them t0 be blockbuster movies.Both areunique forms of media that have their own purposes andstrengthsThe Internet offers instantzneous international‘multi-source communieation of digital media amongstthosewho can respondwith thoughts,relateddatx,graphs,and other evidence. Requiring Hollywood production val-ues fnom media ptovided online is a waste of time andefibrt. -Shouldn‘t we Start expectingmore multimedia from the
new hybrids? Pmbably not. Consider why people getWebTV—it‘seither for the novelty or for the size and familiarityof the scteen. Some are people working in the high-techindustry and Irying t0 ‚keep cument With the ttends.Otherwise, the few people buyingWebTV and signing upfor cable modems generally do so bemuse they keep hear-ingabout theWeb, but can't get over meir negative attitudetoward usingComputers for household comrmmications.Users are not employing theirWeb TVs for anything
more multimedia-oriented than people using StandardComputers to get onlineffhey feel as though they are get-ting a moremultimedia-rich experience,however,simplybecause they get to see and hear the standardTV visualsand audio.The porridge is just rlght‚ GoldllocksThe mini-multimedia that we find on today'sWeb is the
right thingfor today. It takesus on the next step toward thecontinuously evolving and expanding power of moderncommunications. If you use the online world a5 a sounce,you can find andmalte yourownmultimedia‚strengthenedby the influence and innovation of everyone else online.Multimedia-Es not just the combination of audio,Video,graphics,animation,and tat anymoreffhe key ingvcdientnow is interactivity, and only you can provide it. O
Pentium PlnsSystems PeliumProSystems6X86Systems PentmmSystems UpgradeOptlons
911661861159/16611299” “W "“”"-"—”"’°“’ mw"”’m”°’ä?mm ?'-'”°'*“"1‘2L’°’1'1?15‘-’°n“ä‘ä°"" 521'112.‘%:::::::::::::::ääTmonChipsel MBw/Bmh-m 1511112 TmmCInpsahIBwMnEIDE TmmümsaMBWM-In MM “ W _P1 mnonnnnflnfin„L090“,cm‚gfasgmnzxgpgcgh, C111&Fas1l1D.256KPme-ln1eBu1stCad: CHMLFasIIIQSIZKPQe-IMBWSICad: -Ct1l&Fas1l/0‚?56KP1pe-l1neBurstCache nnnGßüjGnnon-mnnm______"m003MBRAM(„p 133MB) 8MBRAM(cxp. 1281MB) 16MBF‚D.0.RAM(exp. 128MB) 32MBED.0.RAM _ wn0n5. nnnnnnnm__._m______n90uasnnsnndnnve 1668395216691“? 15GB5113539991“? ÜGBEDEWW‘ UseGigabylelAwsM/B ............„s4orso144MBHoppyDrivc 1454143151011’!0"" 144MBP1011101“ 144553591’?!Dm muumecia1211a11ax1nLx2291259ß299PclvmcafdwllMMam(exp_mzM) PCIVideoCmdw/lMMennryßxp.1112m AUMachMWdeoCmtPw/IMDPAM AflMdMVmCmdwflMDPAM hnnnnnnnngnmnmsxmkonn14-NL1.11,SVGA.1024117682sMunter I4"NLLILSVGA, 1024x76826Marmor l5‘F1U!SVGAP101“ “um |5‘N‘-LK5V“"mm " m " 1613a11.11Duplex 31)Soundcm1MagmacmwnoowP5 Mai-laut:CaseWQWW PS MmnomrCasew/230W PS Link-Tone:Casew/230W PS
5,0m505km v
l04Wm95EnhancedKeyboaId mänThMKryW ßfifgnfimflwm gfigygfihflhfiwfi ßmmläsegäfiryclmfla' 3BMouseman 0 1 m m “ u m ” ‘man Wem“ W953“:Logm
1 InternetPackage _.._____._..__....._s2o3949/8999/81129 8999/51049/31099 51469/31619/31799/51899 31799/52099/82199- —Memo‘? Printers / Scanner 510m0” Mlllfimedifl/CDWritel’30Pin1M---------------------------------«59 Canon BJ—30/24OC1420OC.......s2791s21513o9 PNVFW ‘f’‘f"17'------------------5219/53°9/5559 16BitPnP sonndCard .......................„S3530pin4M „S30 Canon 113p460 laser....... 99W14Q5'17" 415553255535 Sound 1311m 16111113211112.......„5691511972pin4M „S26 119DeskJet 400C/692C.... “w?”Ö5"7 ------- 5z49”3“9’“59 Sound 1311m32/64AWE..........„5139/523572P?" 3M---V- -----"554 H?065W820Cxi/870C- -- “ä‘S.m”? " " " " "
5449M‘; PanasonicCD-ROM 12x/l6x.....51251515572p1n |6M S103 HPLaserJet SUSN.......................„S519!1979 rgn001,71513227301790T“ 0 MitsumiCDRQM 129d16x_________s|25/515572p1n 32M ........ ...„S199 HPlaserJet 5I5M/5Si........„517090359/3669 V 0050 . nsncs/n[0700 705191193CDRQM „m69;________"3135/“6572pm4MEDO „S26 1n>LaserJet SMPI4M+ ............„51370/5261o NECn551°:500n0500 5470m0 S00CD_ROM nzmnn__________M9195,910572p1n 8M1200 ..... ......554 11v 4V/4MV/l600C.....„s25so/s3s191s1s19 NECnmnnnm---- 5-
n0000nn20 M0000 „n ScsnCDROM___________S17972pm l6MEDO .....s1o3 HP6P/6MP.................................5979151259 NEC„„M700 "" "
9099 Pnnnmnnc 4x5CDCnnnnnn""
"S10972pin321115120.... ......„S199 BrotherHL—64l‚300dpL ßppm...... „x389 00m n00501005" gnnnnnsw n0,Summe 002m Cnnwnngn” '""n500168pin löM/EDO.........„s1o91s119 Brother111-730,wenn,ßppm............„5459 SONY 200002000 0 0 m m _ -------------7. 3,5mm.H]:1660.nzoodpl 12mm“"513” j. Sony 926SCD-Wnter.........................„S43
Motherboardw.“CPU Epm5mm ‚goo/öm/pm 5315/53995520 “d”C3115 BlankmcordableCD.............................-39Pemmm 120/133MHz .....S259f299 am,LoggcvLB/pc}. |M________________559/529_ mm2o3oao5o12o7o..„s2xo1s3351s399 _ ModemsPeumnn 150/166MHz_.3349/499 „n,5mm4359m 590954995999 s3Tno 64, 11111211D ......................„5391555 390K000nnnn ,0 n09flnfinfimjjjfiäfi äßfimrcwehte/full——————————————————————3395/5795 iänvfnzn3äzn”nn’‚‘n‘nfngjn:::ijgggg 33.6K11ps1n1.vn1ne/rnx11)nn ....„S95
686 “ a m ” A" 3D 2MEm RAM______________"S95 Im. ...
H D_ VLBBDEContmflfl----------------------------"S27 ATI33+’ZMMMSDRAM____WW"M_5| 49/5185 USR316K 111L Fax/Data.............„S129"d ‘"95 Adaptec 1520/1522SCSICtd 885/590 ‚m 30+,1 5 0 m m , “gDgAM_3159/g195 1151133.6/56K InLVoicc.... 51391523912GBEIDEHD......................„S239 AÖFIPWC 2940SCS’Cm "-5235 An 30+‘ pro-I'm“),pCn-v’4M/8Mwn49/s349 316E“ Vojcc/Fax/Dam__________________„S16916GBEIDEHaniDrive .........„S259 699W2940W59310“ "-5399 ATIMach64,2M!4MV .................„522915349 PCMCIA28.8/33.6KFax/D11Ia..Sl89/2892.0GB EIDEHardDzive .........„S279 Ada!!!“3940SCSIÜTI----«------------—--—-5509 Anwum“cmwmhmmm5129/g339 Cases/KeyMards/Monnses2.5GBEIDEHardDlive..........„S309 TapelZip/JazDrives gamma su54, 1M1214D_____________395/3115 n00Wmd 05n 00m0 0203.1013151131511mDrive..........„S359 [omegaZipDrive.100MB,SCSI/Para...Sl99 Diaxmndsu64, 21111411v ...... ......s2491s319 n .. nnggnfnnnn‘Y ---------
350/0554/5/6GB 15m5111153991554915579 lomcgalazDrivc. IG.Int/ExL....„5499/5605 nimm 3o 2ME130 _________„ m 5 “F?” -------- ----------------1.0868SCSI-Z HandDnve .....„5319 Zip 1001111311112 101312151...............„s17/s99 DiamondMonster31)4M ..........s299 L°3‘.‘°°h“ WM ”5m’""""""""""""""33321GB scs1-2HardDxive ..„.„„„s419 Colorado 11000,800MB lnt/Ext...Sl595199 MatmxMillenia211141.1 „3209/3269 M5195“M°“9°M9"B“ ---------------"539301GBSCSHHandDnnve _________5489 (jolmdo‘[2000 [In/Ext______________5229/5279 Mann,‘Mysfiqm3D2M/4M__9__mm___g139/s|79 l3 /15 TOWCI’Case WVZÜOW ......547/55742GB SCSI-Z HandDrive .....„M249 lomega 1mm211GB Im/Ext ..........s1991s249 MillcniaTVTunncr/VxieoCapnne.....Sl69/S399
A1MultiLink Computers. weore fuiiycommifled 1oprovide you wifh n01only7c; qucmy o1:but also e;-.;1
1 10111 once.‚es? Service Sowhenever
you need c1System or upgrode/repoir.come 1osee us. Our professionoi 0ndfriendly STOff wili do whotever They con1omee? your needs.
197125"TowerCase w/230W ......567/597
Business HoursMon.-Fri.:Satqsun-I 11:OOam-4:30pm
cge oefi 2d-:'N'r*„
11 :0Oam-6:OOpm
rar-x‘W -<-‚ ‚Au „
5;". _ 1"l‘‚- nJ u / ‘ v v 1 '- 1 u u .‚\.«
Fax: 278-6653mtbsqt 513’ T3126
i
Pentium’ 133/150
C C J R / I P L J T E RLayawaywithPricelProtectionBest Rate Leasing In Town ‚Hang/mm,
iTe1:jj({604)2735-3316.FHXI (604) Hour
Sun: _1*1,.-5:30pm
Suoxww» S/eowfl Warraniy Express Seivoe: Same DaySeivi Extra ChargeIntelMMXMB256K
S707 S77 5277 (RetailBox) 577S 570S .S33DVirge4MSVGA MatroxMillenium4M SoundBlasfer32PnP l2XCDROM USR33.6VoiceModem Viewsonic 17”.26 Monitor
573S 5697
FirstTimeB erS cialPentiumil20 5678256K PipelineCache8MBEDO RAM13GBEIDE Hard Dri
"
Panasonic 1.44 Floppy64bit SVGA IM104KeyWin95 KeyboaMini Tower Case _Mitsumi Mouse& Pad ‘
5728/748166/200 5868/978
6x86 PRl50+/166+ 5668/688200+............... „S768
- 6x86 PRl50+ S1268Triton 111-MMx PCIMB
hPanasonic 1.44 Floppy. S3 Trio64 V+ MPEGVideo
1 33.6 Fax/Modem
Notbookl TOSHIBA Satellite/PmMultimedia420CDT..........................................„S3448P100/l6M/ 1.26G/6xCD/Sound/11 3 m 7
430CDS..........................................„S2768PI20/16M/ 1.26G/IOxCD/Sound/l I.3“DSTN
430CDT..........................................„S3698P120/i6M/i JGG/IOxCD/Sound/l 13-717
SCEPTRESoundxMultimediaS3900 P100l8Ml1G/11.3"DS........„S1998S3900 P133/16Ml1GI11.3'DS......„S2338
1 15" KTXNI‚LR DigitalMonitor
i PRO 200................. S1998
S4000P133l16M/1Gl6xl11.3"l'l-T....S4068 "i
.
i
PowerStation
256K PipelineBurst Cache
2.1GB EIDE HardDrive
‘l2X CDROM80W Multimedia Speakers104KeyWin95 Keyboardl6 bit PnP Sound Card
15"Mid Tower Case w/230WMitsumiMouse& Pad
.\I.\l.\ 166200 515681798Pentium’ 120/133 51288/1338150/166/200 51368/1478/15986x86 PRl66+l200+ 51318/1368PRO 150/180 51568/1788
AMD K6-166l200.....CALL
Triton 111-MMX PC1MBI‘512K PipelineCache
‘ —
’ (Intel440FX Natoma P6/256K) I ::::x11“?‘ 32MB EDORAM'
2.lGB EIDE HardDrive
‚ s3 Virge 3D 64bit
- Pioneer 12xCDROMi
SoundBIaster 16PnP Sound
ÜPentium’ 133/150
_ PRO 150/180PRO 200..................S2238
UltraStation 6|6x86 PRl50+ S1578
1
FullScreen 2M EDOMPEG Video
Panasonic 1.44Floppy
80WMultimedia SpeakersI04 KeyWin95 Keyboard
33.6Voice Fax/Modem19" MidTower Casew/230WMitsumiMoose & Pad‘I5' KTX NI,LR DigitalMonitor
NINIX 166x201) 51838209851638/1668
166/200 81788/18986x86 PRl66+l200+ 51598/1368
51798/1838
PentiumMB256KIntel Pentium 12016MBEDO RAM
Ä‘64bit PC1SVGA
4“ 396/496 H!
M e n üIILTIIIIIA
S399ASUS T2P4 HX MMX 512KMB3.2GBQuantum FireballHDATI 3D Xpression Plus 2M160WMultimedia SpeakersSoundBIaster 32PnP SoundUSR 33.6Voice Fax/Modem
Video & Monitor MultimediaMisc.Top 10 MainboardsPentiumTriton 111MMXMB.....Sl09Built-in Fast 1/0.256K PLC72/168 DIMMPSLSDRAM, usn586/486 PCI/VLB/ISA MB...........„S894EIDE‚ lP/2xl6550, 4x72pin
Acer APSTX 1x 512K...............„S199ASUS P55 7 2 m 11x 512K..........„S189ASUSvx97256K.......................„5159ASUSTX97512K........................„S239FIC P2005 VIA 512K (75Ml1z!)....Sl65GigabyteATVNX 512K..............„S165AM-430TX 512K, APIC ........„5179Tyan 51470 vx 256K...................„S189TyanTomcat n1 Dual P5/512K....‚S325Tyan ProS1662 Dual P6 ..............„5499
AMD 5x86-133 ..............................„S55AMD K5-75/l33.....Pentium 100/120.....Pentium I33/lS0.....PentiumMMX P166/200.....................„5329/459AMD K6 166/200MMX ......„5369/539
Cyrix 6x86 PR-l50+/I66+......„3129/169Cyrix 6x86 PIK-200‘?.....................„S239
SM/EDO 72pin (60ns)....
Mitsumi 104Keyboard..........„S20Fujitsu 8725/4725 KB..........S29/59Litcon Natura!KBTonchpadmS85MitsumiBusMouse................„S25
T.N—.T 13"Tower w/ 230W PS..S39T.N.T 15"/19" Towcr......„._S49/79Super IDE I/OCanl.............„S30
SCSI ControllerASUS SC200 SCSIPCI........„S125DiamondFirepon40UW.....„S239Adaptec 2940U Ultla SCSI.....S259Adaptec 2940 um:wae....s299Ethernet isA/Pci..........„S35/5498 Port IOBaSt-THub.............„S109
(OEM only soldwith systzm)MS—Encana 97 CD Packs.......„S89(Encarta,Works,Mmey‚Golf,Exp.)
S249
NT 4.0Wlßtation Full.........„S289"l .c.1st-B;1xt-( I ( )n
3hinil1.llI“/=Bu\uulo Prices subject tochangew/o nofice
l.28/1.7GB...................52252592.1125GB ....................5289/319WD 128/1668...........„5259/279Quantum 2.1/25GB.....„5299/339WD 3.1/4.0GB.............„5369/469Qnnntnm 3.20.86 FB.S379M39
Qnntnln3.26 n; scs1....s499
Panasonic 1.44Floppy........„.530
HPColoratb T1000Tapc.....Sl60Dill/o2GTape Drive...........„S195
[Omega ZipI00 Int/Ext......„S249
Zoltrix 33.6 Fax.......
USR 33.6Voice/Fax... „S135USR 56K In. Fax...............„S219Zoltrix 33.6 Ext. Fax.........„S129Motorola 33.6 Ext. Fax......‚S149‘USR 56KExt. Voicc. ‚S249Megahertz XJ3336T........„S40933.6 Modem + l0BaseT l
Cirrus Logis:64bitSVGA..................„S29S3Trio64V+MPEG 1M...... . .....„S49S3 3DVnwge 4M EDO......AT1Mach64 w/MPEG..................„S75ATI 3D Xpression 2M EDO..............„S99DiamondStealth 3D 2M EDO.........„S119ATI 3DPlus/IV 2M SDRA1\/L‚..S149/169ATI 3D ProTnrbo 4/8M...........S235/325Matrox Mysliqne 2M/4M........„5169/‘209Matrox Millenium4MWRAM........„S299
MAGoxisr 15- .25OSD...........„S479scepne 15" P531I17" .............„5369/8689SONY 15” IOOSX/SF .25...Acer 17"76id78ie .26 1600 „5679/699Optiquest 17"v773/775 26 ......„5689/819Viewsonic 17"GS/PS 160025.577979»MAG 700T 17" .25 Triniu-m..........„S899SONY 17' zoosx/sr .25........„5929/1069NEC 17xv+Multisyuc.................„S989
Epson Color40O 720x720dpi.....„S335Epson C600/80O 1440dpi.....S425/639HP Desldet 690C Coior.............„S389
LaserBrother HL73ODX 600dpi‚6ppm„S449Brother HL760DX I200dpi........„S589
Panasonic 8XCDROM...................„S109Pioneer/Panasonic l2X CDROM....„SII5Goldstar!Hitldl i IGX...............„.319Pioncer l2X Im. SCSICDROM.......‚.519Plextor l2X 1m. SCSICDROM....__.S399
HPSnreStore 6020i6x2CD-WriteL5629TDK CDR 74min 650MB................„.51I
1551868 16bitPnP 3D FullDup1ex._.„„s29Sound Eimer I6Sound Bhster32 I ' l l ’................__._..Sll5Sound BhslerAwEu (Reuii)....„„„sz25
60/1603’ MultimediaSpeaker.....„S25E59SoundBlut:Awe64/I2x/9Tnls....s359
3 ycar labar S; 1nur puris uarrantpiIGM/EDO 72pin (60ns).. 1:59916/32MSDRAM.............
ä besig-areau an =»&brxnds an die propcrlyol‘ rheir rrpcdive i n n e n .
Canon LBP 460 600dpi .............„S349Panasonic 1200dpi,6ppm............„S469
F755 l/IIENICISJI/p .1Auen IIst l/nnili/
o -ByMARCSALTZMAN- -—How things changc. In my short lifc, Iman watchingVHS take ovcrBemCDsmeplacc vinyl, and CD-ROMs knock offthe good o!‘ floppy drivcWc are now,howcvcr. standing ovcr Wim could pos-sibly bc the biggcst tcchnological
adjranccmcnt of reccnt dpcadcs-thcDVD player.or DigitalVersatile Disc (o:Digital Video Disc, dcpending on who70l! 35k)-Asyou may know from all the teccnt
hoopla, DVD is poised t0 rephcc audioCDs, vidco tapcs, hscr discs, and CD-RqMs thmugh ins mzjor storagc czpacity
and ample functionality-all on a productthe sizc ofa regularCDJhcyh: alreadyhcrc, too. Cncativc Tcchnology, bcstknown for thcir Sound Blastcr lincup ofComputer sound cards (20million uscrsand counting), hzs Itleased onc ofCanadts firstDVDROM drivts for the PC.
AE ELECTRONICSCORP.iImaewomLoom 138-2981Simpsonfictflidwnonctßccanaflmvfixzm
I
Asswwwx '‚ snsA s s r z u m x u i p s e x j u u p e r fi m p a m z s a m m a a S189ä (MCFX ‘.'‚_ qPenuinPruPCllß E&xs DcdHafimPcoPQIB S720i ä P a fi n n i a y i ß / I S O H E G I Z I I I E Q S|iäPaülnPmüilslfllßfllflzmP i I R A I I 4 | B 1H P E I F M I I U H I G Q E { I l l fl fl s
SOSSNESQNIJS
Savy S E A5 1 1 k l G S X l l 1 145EIWGOBOOGPGIDBIZIB S E EfllälxunsinoPüfl/ZBIAIB sresrassfllfilfioinhofiflfldEßfl SI l ü m fl h e ä fl u fl z fl w fi m fl y i g fi l i u m 51139259äbfideotfiuflenfiutxfiflxim 211175
TAPE, ZIP, JAZ, HARD DRIVE, CONTROLLERS? Fafl-MI IZiJQI/LSCE SZ7WEQ3INSGS i r - ä IIBIZIItX-EB S fi i f fi l fi
( „ B I Sä 211432 94511345I ä ä3S Cclfiks2 9 4 G J Wk! 3 3 5 / 4 1 9
’ 3 1 7 i
Tel: (604) 279-8867 Fax: 279-5510
Want fto run an ISP business anywhere in the world?
Ifyou d0; we have all the necessary hardware,Software and technical expertise to you help you
VMONWORA“ v“ f setup It up and tram you to malntam lt.
We are a USRGold authorized partner.We are trajined on USR’sTotal Control products.
Please call Tony for more information.
(604) 279-8867COMPLETE N1ULTl-NIEDIA SYSTEMSWITH SPEAKERS,MONITOR AND WINQS CD
S1AE133Leasefißs
52755AE166LeaseS97 Areas of Exmrtise
' Windows 95
Windows NT
‘NovellNetware
Share Fax_mateuconouwuiugusnencm) msmfinaoaesaxnmrzxszs 3135x4920sanauaswnv 16.2215: sasnnstss 4 - R9510“!A0088nasunzsnrz 535459 ‘
»
w a n n - s a g e am zsow PS Is-rzswux 51217159165 : -weh _
USR TOTAL CONTROL - . 1 “*3” “"3"‘ Ä ACCPAC Accounting- JTVbv/Sonic
' -15‘DamkmunxWflveavydüycase -19'haavycnyase -‘I9'heavydnycass ‚ ‚-EOWPonerswpfi esowpowsppoy -zsmp..„s.„‚.‚ Wedoon-sztescrvlc:
Isvnmatlznnssllnhaaznnnasmnunmusuwau samt: -Sou|6hsIet16PtP «Solmxflashrlöfi? sann-rammstein? friegmy stgflfog-gflIrrsawmnoaual-uuuuans u - A n p fi d q l fi n s a -nnpiiadqaeuasa 4uw| iauspaanasu ." ponL- uns um 9 5 m m -Wnhas95cnCD - W l l t a s ß m fl ) yourcompltlngleeds.
httpfllwvwmomputer-pfilayeLcoml 4 MAY 1997 4 COMPUTER PLAYEI! 0
0 0 0 0 0 0 0 0n
continued from page ‘I2Compaqwo‘IhewmpaqwowasflxemostcxpenfivemonitortcstedwithanMskPofsLzziltfea-nucszmaxünumresolufionof1280xl024at6OHz(1O24x768at8SHz)wi1h1ciotpitd1ofO.28 mm am! a l5.67—'inch diagonal view-able surface. Nicc fututc: analogue comrast
andbriglnncsscunuhhfincflutmacäm
and Wmdowsflrhe monior councs wixh aflnec-yearpattslotne-ycarhbmrwey.S n g P n R 2 n d M P R - I I .lbrmoleinflllnflilLullalztütxmpqall-800-567-1616o: vä lnpz/Iwwwcompaqxta/MIIIMIIIBIIDIIIOIIÜPIDGHXViheDiamondProfeannesannximumrcsv
0lutiouofl2&)xl024:164llz(l024x768
a: Hnwithaolfimmdotpitchandam-'
diagonalvicwzblc smficc.Niceütme:hide-away screen controls. lt comcs with aIhre: year warnnty 2nd has an estinnatedstreut:pricc of 51,049.sgandanis: TCO92, lbiPR-II. Energy 5m,
DPMS,undPnP.Fqr additional information, contact' ‘ ' a: (905) 475-7728 or visit
httpc/Iwwwmitsxxbishi-disphycom/
25REAsoNs WHY NRI TRAINING INGompuma SERVIGINGlsYoun BEST Gnom: FOR GAnEEn Succsss
ccordhlgtothebqrarunent of0
15Youminwithandkeep YoucanprepareforLabor,jobs for computerService the seIf-bcntingForeFront dieA+Certificationted|nicianswillbeupby3896infl1e TmubI5hoow“‘softwa1ea1xiCD-_ ._ examwimmm’;man l0 years. Isn’titabout time dm R O M , ‘
V exclusiveyou lookedinmNRlu-ainiilg? youmnmnst. (KB-ROM!
1 Youdon’tneed anyexperience 1 WnhNRfsnewPC » A g 2 Youcantogetstarted optionsPmytxlmnptnchase L mntinuereceiving
___ low-ctmstcxmpuutmgadesaxxi admearldfeetflaxkfromyotxrixxstnmmrYoucandependonNRLadrvlslon . . . i2 OfmMcGmw_muCompamesi penphenalsforyourcuskxnxmdPC. gadxlare.3 Yousmdvmhom myom
YouhveammsmNRPs YouczultumtoNklforlettersof- ’ band-neu“cyberschool” to Ä umscripß,ownpm„ comactyonrinstrucmr, fipsbnresumewrifingandmom
You put theory into practice “W035 i .with hands-on projeets. muten-als.partiapmm tommm‘
online semimrs,mal „‚_m“ “Pm‘
YouWork one-on-onewithan „ m , theepob, stmtglnewunter,or opeuexpefjencaj1,5mm; yoqr own busmess.
0 YoucancallNRI’s 9
6 You establjsh asolidfoundation 1 Tdegemmhoflmf0, YouC3“C3“0m’501141139 "umherwith a reviewofbasic electromcs. 24m0“, „ m m 3mYou, h
f0?3 f“?W108» 31- J/wwwmhcec. W !1 YoutrajnWimtheNRIDismvery quesnms’ m’ m m 0 "
Iabtoexperienceciruntdesigi 1 Yougethnnlediaiefeaibackandmodification. WimNRysTejegrafing
8 Ymmnwithadigfidmmüfllfik: servmfeanlringzä-honuexanlgradingforquick andeäsy testing Yourcmpmynny
9 Youget a custmnized Of mpfga"mm"
Pentium‘166or betten‘PC(Hyourl I’dto trau:wnfln am!keep!mmpmiöd0!)1oYouleamhowtotroublöhootaxldmaintain today’s sophisücamdPCs.
11You explore the featlnesyon’ve chosen for yourComputer, from the menloryChips to the high-speed
„ ‚<5.- CD-ROMdrive.‚.3
You leam how t012takeadvmtzgeofA
PCoommmlicafitmsaxxlflle... Internet.' 13 You useyonr
newcomputefs28,800 band or finster fax/modem in conjnnctionwithNetscapeNavigator“!Wehbrowser software.
1 Youexplotg the andaocessorisofWundows95, todafshonest graphical usermterfaoe.
ß coururea PLAYER! p MAY14997 p hnpulwwwmompänter-playencom!
| K i n o - uIreutäkflcxxgnfidßr
CALL 1-800-321-4634 FÜR FREE OATALOG!smvmsueu‘Eligomariolläflqdann: d} acholfihm m| G e f ä ß ; ä
k?“ gl j I V I I N G jNetwofliingwifiVmdcvwsNf
i: E ä äORGET YOUP. DEGREE!
LfiDivixiaxtflkät-{Gräs
II
| JTV/Viden/Andfiosuvicixg _lV'|sualProgrmnpinginC++ || 3 _I Maseringuicnfpsofiotfice |I WTÜPWMÜH jWebmaster w’ l
nennst-kg u - u n a a m i g u - u 3315-05972 2 — — “ ’ — z 2 — — — ! - ’ — — — ! — — _
IonexSI785F‘Iheflflflifiztuuanuximamxesohfim
d12aox1o24zx6onz(1o24x76aaxs5m)wiihaozsmmdotpitdaandalfinnchvicw-ahlc Gagmal. One sang tlfmg about thismonitorflmwasnotseenonanyofflroflnsistltscremappeztstobefiwüctfiaafwhmdromnplmcrwentflnmnghinsifilfilmcnu-ydniOmIOS/Zbßtxxlbhmgprisdfisphycd,thctwizchitagstombtrtitishfiglalyagnwntixxg.‘lhcsugstedreuilprizesbetwemflmandSalomnchhcxeisarhree-yearynrnmy:Smmhrds:DPMS,hdPR-II,EuagySm:‚andPnBFor morc information, contact Monex a:
(905)709-3660.NEC Multisync XV17+TheNECXVl7+offetsamaximumrcsoh>
tionofl280xl024zt7Sl-Iz(1024x768a1l00Hz)wiflxa0.25mmd0tpitch2nda 15.6inchdizgonalviewing surfactzNice fcature:themonitorcan displayflimes üps"atz
comcswiflxatlnee-yczrwinmtyandhjasancstimatcdsueetpticeof5L069.smxhdsmusfimPnRDnaaanm-n-ILFor morc infotmaxion, contact NEC a: 1-
0rvisithttpJ/wwwncccom/SceptreP73AWmancsfimtcdstzectprmeafonlyflofi,
thc P73A ‘s a good cboice fix d2 hudgct-mindedomstmezFcaun-inganmxhnmxes-oIIItionofl2Mxl024a1®HzGO24x768aI75I-lz)‚zd0tpitd|af0.26mm,andavicw-ablediagomloflißindrsjtoomswhhathree-yearparts/onc-ycarhlxnrwamnzy:Standart: DPMSjnetgySagPnEandHPßIlSChcclcoutscepträswcbpagezt
httpzl/wwwsccpuctectxcom/ or c2!1-800-’
7882878 i):movc dctails.CH Editors ChokeAwrdsAmaxcdmcscmaxirxswufldnfizüba-
crbrthczvuagmeghnwfleävigunplmn»ansmlhcvicwsax’: lßhsqaponsflnelfin-eaxesohfimaxjcxfixscnzcflemxcfieflxm:
cumntnscxecnxesüflxslfyicebanfixfic-mfirlxyäflflßlßbagxoddäwfllunngcackphrfiesmncfiammdanw jsuectptistxflfilbfittfitsatxmmltuxqxoufiebetwemptixmflpcfinmtm: O
Choosing aI7-inch monitor:What to look fo '
Mastusetsdxflgveasemndüugrtbflienufinrufimbtyhgamcrputawflshermslpn theinirisisflbwfastistfneCPlWuflbwmxhnlaruydoesähaveflyuxstnpadfiitäaaxti,howevqyurnuüis ptobdxytfnenm‘nponztpatdymrcaruterystznx.flcnufioracßasüienürittafaabasvea:youmdprmmmpuogzmunflbfir-rypiznreczxratheyeshünaxdtmhdres,Üwhieabgayfikfimzeczlreaüh
akgescreen rmnincodrlsaveyuxwlbecpgahglhemstdproalpmymr:Jfiüeyotnpyakyarnnfiat Dekan
ELPENTIUNI SYSIEM I
Ltttel PentiurnP-ISS CPU16MB EDO RAM
PCI/ISA Mothcr BoardBui1t—in EIDE Ctrl .256k Pipeline Cache
PCI 64bit Video Cardl.3GB Hard Drive144MB l-"loppy Drive
l5" Mid-tower Casc. 230W PS104Win'95 Keyboard. 2 or 3 Button Mouse
One month free internet
PNENTIIINI SYSTEM II
Intel Pentium P-166 CPU161MB EDO RAM
PCI/ISA Mother BoardBuilt-in EIDE Ctrl. 256k Pipeline Cache
S3 3DVirge Video Cardl.7GB Hard Drive1.44MB Floppy Drive
15"Mid-tower Case. 230W PS104Win'95 Keyboard. 2 or 3 Button Mouse
One month free internet
or lease S34/mon
WE OPTER BEST SERVICE,BEST PRICIC. BEST QUALITY!
PENTIIINI -Pro SYSTEMS
..Int.e1_.13t3ntjum-ProCPU. ZEQLCLKLLQ.32MBEDO RAM2.1GB Hard Drive
Asus PCI/ISA ATX Mother BoardBuilt-in EIDE Ctrl
S3 3D Virge Video Card144MB Floppy Drive
15"ATX Case, 230W PS104Win'95 Keyboard. MouseOne month free internet
Pro-180 51699Pro-ZOO 51810
J01' lease S44/mon
NOTEBOOK
SHARP P100 -----------Sl97512. l"DSTN/8l\/1B/1.lGB/l6bit Snd
DAEWOO P133 CD----------------------«S385012.1”TFT/l61VIB/1.4GB/16bit Snd/6xCD
SCEPTRE 3900 P100/Pl33 ----S2290/S25201I.3"DSTN/l6MB/l.OGB/Win95
SCEPTRE 4000 P100 ------------------——S3690l2.1"'1‘FI’/16MB/1.0GB6xCD/Win95
SCEPTRE 4000CD P133/P150 64390/5459012.1”TFT/24MB/1.0GB/6xCD/'\Nin95
MTI JETBOOK CD P1O0----------------"S239010.3"DSTN/8MB/1.0GB/4xCD/l6Snd/Win95
MTI JETBOOKCDP120----------------«S3065l().3"'l'F1'/16MB/1.3GB/4xCD/16Snd/Win95
MotherboardPentium Motherboard MMX -------------------<— S129Gigabyte vx 512k MMX—————————————————————————S162Gigabyte HX 512k MMX————————————————————————„x175
Asus VX97 512kMMX-------------------— -——- S149Asus T2P4 HX 512k MMX-------------- --—— S189Asus T2P4 HX 256 MMX ATX-----------------—S219Asus Pro6NP5 IATX------------------------3314/5345
CPUPentium 100/120----------------------------"5138/8141Pentium 133/150 ------g ----------------- --—S182/S209Pentium 166/200 ------------------------ —-—S347/S479Pentium PRO150/l80 --------------- ——-S265/S619Pcntium PROZOO ---------------------------------«S730Pentium 166/200 Mh/IX-------------------—S415/S668Cyrix 6x86 150+/l66+ -------------------„5143/5169
Hard Drivel.3G/l .7G EIDE ----------------------------"5238/32552.1G/2.5C1EIDE——————————————————-' ----S270/S3l9WD l.6G/2.1G EIDE ------------»- ---—S265/S289WD 2.5G/3.lG EIDE ---------------------»—S322lS359WD 4.0G EIDE ------------------------------------"S479Quantum l.2G/l.7G EIDE---------------45253/5282Quantum 2.lG/2.5G EIDE---------------«5308/5330Quantum 3.2G EIDE -----------------------------»-S375
Memory30p 1MB/4MB-—--—---——-—-—--———————--------v-———-S1U53172p4MB/8MBEDO--------- -- -----"530/55672p 16MB/32MBEDO------ --—-S106/5219168p SDRAM 16MB -------------------------"S120168p SDRAM 32MB --------------------------«S235256K/5I2 Pipeline Cache------------"520/540SOJ Video RAM IM--------------------------"518
Li/I/itcc/ qi/ru/Iil): Prices arc CllS/I disxfoluzlcd und sw/z/cc/ In ("l/u/zjqe will/nur nz/‘i/“a. Ccl/[fi/I‘ Ihr’ ("ur/‘c/zl privat.
B.C. (Lougheed & North Rd)-Fri. 1100-6230 Sat. 11:00-
20l-403 NorthRd, Coquitlam,TEL(604)93l-5809 FAX:(604)931-589l Mon.
Video CardCirus Logic PCLIM/ZM ——————————————«1549/367s3 Trio 64bit PCLlM/ZM ——————————————549/567s3 31) Virge 2M/4M —————————————————-- ——575/5102ATI hiach 64D.lM/2M w/MPEG ----------569/387ATI 3D X+ 2M/4M wMPEG -----------—5149/5183ATI 3D X+ 2M/4M wMPEG. PC2TV---Sl69/S203ATI 3D Pro Turbo 4M/8M. PCZTV — - » 5260/5360Matrox Millenim 2M/4M WRAM------5235/5335Matrox Mystiquc 3D 2M/4M ---------——5157/3202ATI TV Tuner -------------------------------------"S159
MonitorAcula 14'715" H7"---------- —--—-5219/309/599Proview 14'715" /17"—»—— -----—5225/319/629Daytek l4"/15"/l7" ———————-- -——- 5235/325/635SCEPTRE l4"/15"/l7" --—— --—— 5255/355/649MAG DXIST .25 ------------------------«S479MAG 700Tl7" .25----—— —---—----------„SS59NEC l5" XV+ » « » --a -—— ---------------—-„S550Viewsonic 15" 15GS-------------------------"S509Viewsonic 17" 17GS/17PS------—- --«—S779/S929Optiquest 17" 0.26 V775 /V773---- «6819/5709Sony l5" SX/SFII----------------------- «5529/5619Sony 17
" SX/SF———————————————————————————„5919/51099Printer/Scanner
Canon BIC240/4100 ------------------------5229/5299Canon LPB-460 Laser-------------------------------S365HP Dcskjct 692C/870C-----------------——8409/5649Brother HL730DXl760DX Laser----------S479/S589HP 5lJ6P Laser 600dpi----------------------S529/S950HP 4P/4C Color Scanner ---------- ---S649S1125FujituPrintPartner PP-IO/PP-14------------„3728/5838Microtek E3 Color Scanner ----------------------„S345Acer Scan 300F Color Scanner -------------------5355
NIIJHTIÄIEDIA SYSTEMS
InteLPentinmgPU _ _
16MB EDO RAMPCI/ISA Mother Board, 256k Pipeline4. Burst Cache, Built—in EIDE Ctrl1
PCI 64bit Video Cardl.7GB Hard Drivc144MB Floppy Drive
Ä‘I5" Mid-tower Casc , 230W PS104Win’95 Keyboard. Mouse
l4” SVGA Monitor8x CD ROM, 33.6 fax/modem
16Bit Sound Card60W Speakers
One month free interner
P43313-120 S1305P-166 51511P—200 S1643
or lease S44/mon
MMX SYSTEMSIntel Pentium MMX CPU
16MB EDO RAMPCI/ISA Mother Board, 256k Pipeline
Burst Cache, BLlilt-Ill EIDE CtrlS3 3D Virge Video Cardl.7GB Hard Drive1.44M Floppy Drive
I5” Mid-tower Case, 230W PS104Win'95 Keyboard. Mouse
l5” SVGA Monitor12xCD ROM.33.6 fax/modem
Sound Blaster 16 Card60W Speakers
One month free internet
MMX-166
S1 MMX-ZOO S199901' lease S57/mon
WE PROVIDE COMMERCIAL AND INDUSTRIALSOFTWARE DEVELOPMENT, NETWORKING
DESIGN AND ONSITE SERVICE.
5:INDIVIDUAL AND CORPORATION CLIENTSARE WELCOME.
i!Modem
33.6 Eax/Data/Voice int-----------------------------S103SupralI33.6 wNoice int----------------------------—-S138USR 33.6 Fax/Data/Voice int———————— .. M5139USR 56k Fax/Data/Voice im...................„S23933.6 Fax/Data/Voice ext------------------------"S199GVC jPCMCIA 33.6 ------------------------------"S259
Sound Card / SpeakerStereo Sound Card -----------------------------------S43Sound Blaster 16 PnP/ 32 PnPi ———————————569/ 5115Soun Blaster 64 AWE retail---------------------S249Spealfer 7W/60W/120W--------------«515/524/342
CDROM8xCDROMHitachi/Panasonic-----------------------"S12512xHitachi/Panasonicffoshiba ------—-——-—»—------——»S13516xCpRoM 5155i: JAZ / Zip / CD Writer
JAZ 1GSCSI int/ext------------------------5515/3625ZlP Pgnasonic/Iomega IOOM intJext-m- -—-—S249Yamaha 2x/4xCDWriter ext-------------- —---S965Panasonic 2x/4x CDRec. Kit w/sf/ctrl —————— "S595cremiye CD-R 2x/4x im. w/SCSI .............„S595comiei 30014/120 im. ..................„siss/szsoDitto18OOM/2G/32G im.........„5155/5205/5320Diii641sooM/2G/3.2o Parallel-----S205/S265/S375
4. OthersJoypad / Joystick -------------------------------«318/525Microphone Sl2Earphone w/Microphone ---------------------------“S20CasioDigtal Camera -----------------------------«S529ISA I/OCtrlCard—--—-----<»—--------——---------—-———-»-——S3OVESA I/OCtrlCard------------------------------------"S30
S275QuickCam
Eithernet Adapter16bit ISA lOBase 2/T -------------------------——S3932bit PCI l0Base 2/T----------------------------S578 /]6Port HUB ---------------------------«5125/255PCMCIA Eithcrnet Adupter/Comh————————"S155
Keyboard MouseWin’95 104 Keyboard --------------------------S20Fujitu 8725/4725 ---------'-----------------"529/59Logitech Mouse 2B/3B--------------------"520/35Microsoft Mouse ---------------------------------S35
Casel3" I15" w/230W PS —————————————————————548/558l9" /24" W/230W PS -------------------568/5104Desktop Case -----------------------------------"S59
ZßaflqisamlBrand Name 2.lG HD S270FujituPrintPartnerPP-10/PP-14
3728/55838
5:00
{Extra Food
Royal Bank
Z LITECHI
H LondonDrusHongkong‚EBank
Illultimetlia:Educatiunal savinur urhigh-teuh gimmietzh?
0 0 BySANDRA MINGAIL 0 0
Blackboards, textbooks, ovethead projectors,educational Videos-traditionell teachingprops familjar to us all.These tools am stillvery much in evidence in classmoms fnompreschool to post-secondary. Now a flashy,new bteed of computer-based assistants standpoised to win educational tetjtitory.Multiplemedia-moue colloqttiallymultime-
dia-ate inching their way into acadentia.Varied in form, the term multimedial is acatchall phmse that refets to CD-ROMS, tele-conferencing. Internet use, hypermedia, and
Universities experimentwith multimediaUniversity rescaxch teams reach out to Cor-
porate sponsors and forge allegiances toexamine the use of digital netwotks,powcrfulWorkstations, and memory-chomping stomgedevices in the name of higheteducation.The multimedia communications reseamh
lab at the University of Ottzwa concocts
3DStudio MAX is llnallyhere and il is HOT....3DStudio MAX dlrectlycompetes will: other htghend 3DGraplaics packagescostlng thousands otdollars more... Call todaytot Vancouvers liest prlcesonboth tull paeltages andupgrades.
4-
mfioVIDEODC3capture, edlt, add speclal efiects ortltles toyour vldeo, mlx cD-quallty audlo‚ and then
giutodpslg 3d!) Studiolacäegtrlgässtrumo 325e?
S
CALL Todayior a DEMO3D MAX for STUDENTS.lc Technology isVancouvers Student and InstitutionalAuthority tot all DigitalVideo and Animation Products...
sophisticated applications for deployntent inmcdicine, banking, and insurance businesses.Researchers rack their brains t0 enable cnduser's to jointly view, create, edit, and discussmultimedia docutncntsflhe greater thc levelof electronic cooperation, the bettenMultimedia distance leamjng, multimcdianeweomiemand,andmultimedia 5D applica-tions are highon the lab’s to-do list.The Interactive Ixarnjng Connection, a
working alliance of the busincss and lcamittgcommunities, conducted a university space-network pilot pmject Participants includedthe Institute for Space andTet-restrial Science,Spat- Aerospace. Queen's University, theUnivetsity of Western Ontario, and theUnivetsity OfTOIUDIQA multimedial course inspacecraftsystenns design was collabomtivelyco-autltored and deliveted on CD, with sup-port through e-mail andVideo conferencing,Overall, students responded positively.
Modules wen: self-paced, teamwork was inte-gral to the course design,andmultiple instruc-
.S895Professional studIo-quality nonlinear
dlgltalVideo and audlo edltlng systcm.
output the tlnal cut tovldeo tape. Perlect tor Vleddlng and FamllyVIdeos...... lncludes...ruLLADOBE PREMIERE 4.2
e t e c h ane l e
(604)681-7057 DUAL Pentium Pro Systems Hvialiable -i
PC‘ to TVENCODERS AVerKaNotebook, Iaptop, desklopwith VGA outpul lo TV, orVCH. Supports composlteand S—Vldeo Output All
800x600 Flioker-lree image In 16.7 millioncolours, Wlndows & DOS
Vteß
D0V00 WANTT0D0ANIMATIDN0 VIDEO EDITING0NYDUR0?MIMATIOHBEOMEAN ANIMATO roadcast Video at
ffordable pricesPDI bus, Gomponent, S-Video& Betacam@60 tields/sec, 720x480 resolution. Real- tlme capture andplayhack ofVideo 8:Animation. Workswith manypowertul editing packages such asSpeed llazor,
_.„Premiere and Video Action IT.
WPE<CEP7ID1En u n ) s t u u l u u
05v:"
v
V6 c ‘.82 Kt.‘
Outstanding PRDFESSINAVIDEO quality from DPS(makersotthe PAR).SCSIZ,
32395.00l
l
I L...‚..N.Q_.....-.«..
wo»
‘I d
cables.
ä COMPUTER PLAYER! > MAY 1997 >http://www.comiuter-playeucom/
S249y PlusAneconomical but also high
quality and ilicker lreeproduct with composile andS-Video out. 640 X 480NTSC) Flioket-tree image in6.7 million colours,Windows & DOS «
Call for a DEMO-
u PACKAGE S295lmoo no setup feeo includes flat-rate internet .-o no prime-time restrictio v
o free Software kit and '
A
o Website upno traffic
o optionaltutorial d web address‚cable
‘Afees
WEB PUBLI’:fACKAGE A
p
o no Setup feeo 5 Mb storageo direct FTP accesso no traffic chargesO NETSCAPE
_ 4
Commerce Server‘ o MICROSOFT
FrontPage Extensions
ISDNPACKAGE 3380/1110no setup fee
o dedicatedhigh—speed ‚
128 Kbps digitalISDN connection
0 no traffic charges
InternetGateway CorporationSuite 503-889West PenderStreetVancouver, BritlshcolumbiaCanadaV663B2
Phone : (604) 654-6088Fax : (604) 669-8489Toll Free : 1-800-453-1286
Internet :http:llwvvw.intei'gate.bc.caEmaiI :[email protected]
vucuua-unso
cf
ä COMPUTER PLAYER! > MAY
l
fafl230ä<Ä102%1’xo9e1_. T
SnapScanonoasunuumhmunss:
noxmepiresuaiut zummlitsßlrxu. sonuaefov
StudioStarü w w u x m ü g q m n n a b u
-uanammmnxnuMama-Cityrad Sdtwaeb
MfofPC fififiaflfimvfit
F ä n i ‘ f ä f t ‘ F ä u ‘
aurowu-v-kubuuwugamn
wflwmdnanhanmmuaunnm
“ V 1 W " @ ß ' ° W Ü € ÜLnnlcd Edtusfläafilfimmhoc‘
u c u h u p d b g w m n ä
qmm . n n b a fi
m m w w m m m r u m k m r n ü fl h
l
AGFAThc compleie picxure.
What's n e w inmultimedia!
0 0 ByJUNE CAMPBELL 0 0
Bämultimediadevclopers are on the move.
EniertainlnentDream Logids Gregory Zbitnew has bcgun
developmentof an adult-orientedCD-ROM thatwill provide digital artistsWith an opportunityto showcase diffcrent styles of artwonc, andWillbe markcted usingan alternative approachsimilar t0 that used by thc music industry.Contact: [email protected]
DNA Multimedia is announcing the releaseof Starsigbt, an edutainment CD-ROM thatexafmines ancient civilizations and their obscr-vation of thc Stars and other heavenly bodiesto Creme laws of the universe.Starsigbt introduces the viewer to five “communities”as theyexisted 5,000 years ago.
'
Qontact:http://wwvv.dna.bc.ca/
Performancesure to catch the cnsemble Screen in
their performance at Western Front’sElectronicAns Festival,scheduled formid—May.The three international performers PhilGiborski, Efic Rosenzveig,andWilly Le MaitreWill be performing thc installation"lnterplace”in aWindow (4thSt.‚a halfblock east ofMain)3ndwill feature a blendof live andpre-record-ed ivideoffhe dynamic image will change toreflect the approach of a viewer.Screeds performances involve “hypermc-diai-the linking and translating of multimedia
aComputeras interläcc.Amusical note, forinstancc, could aflect a Video on screen, linkingthc;media and crmting live arLThe artists work
impmvising thc 15cof audio‚Video,andmoivanmt to create a dynamic, spontaneous
o1" site-specific installationpieces.Contact:[email protected]
mixationSince Screen is interesled in the DVD medi-
urn,they‘|l want to check out thc world’s firsthands-on DigitalVersatile Disc training coursenow running at Vancouvcr Film Scho0l‘sMultimedia Production Pmgramfhc instruc-tor, UBC's Dr. Panos Nasiopoulos,who is saidto be Canaders top DVD expcrt, is joiningJapanese owned Daikin US Comtec as chiefscientist. The DVD software-developmentcompany will bc assisting in the funding of aDVD research lab at UBC.Contact:httpJ/wwwmultimediaedu/
VR Didatch has released “AdventuiecomUSA", an lntcrnet-cnablcd multimedia applica-tion, and is prcparing to release CanadianTmasures, a CD-ROM pnoduced in coopemtionwith the National Archives of Canadzi. Suitablefor giadc 5 to adult. (‚Izmudian Treasums is anexäting learningexperiencc fcaturing archivcdCamdian memorabilia.
(Iluntacl:hltpJ/Wwwvrsystemsconl/l
e Brainium, produced by MultiAcliveEdücation lnc.V:1ncouver: in associatioxi with
http://www.computer-playencom/
ScienceWorld BC, i5 an inleractive, educationalWeb site designed for gmdes 4 to Sffhis project teaches science thc way science should betaught: in a manner rhut will captixate personsof all agesffhe Bminium must be Seen t0 bcappreciated,and is available free of Charge t0schools in British Columbia thnough a licensing agreement with the BC Ministry otEducatjon. When you’re visiting the site, besure to enter the Bug Zone.Comact:httpz/lwwwbmjmtuxxcom/
PmmotlonalTopicTi-ackers hasentened the market with its
first mleasefVsit BC on the mtemetTThis pn}motional item attracts viewers to a coiporateWeb site While mising thc company's pmfileand enlarging its markct base. Developcd undreleasedbyWebWriters Internet PublishingandNightcats Multimedia Productions.TopicTrackers fits compactly on a diskette undcombines custorrfized corpomte content with100“Best of theWeb“URIS of sites promotingatopic of choicczTopicTmckers is also availablefor retail salcs.Contact: [email protected]
Weh ToolsTotallyHip Software lnc. is offeringHip Clips,
funky GIF animations forWeb pages.Downloada free “six pack“ from the Web site, and whileyou‘re there, consider gtabbing Sinler. a frecplugin that streams various animation formats.The highly praisedWebPainter isTotally Hip's
“flagship”product for this year,however. It's anaffordable and easy-to-lcam painting and anima-tion tool that incorpomtes sophisticated {ca
tures such as onion skinning and cels, indudesuse of sound,video,and most gmphic formats.Contact:httpz/lwwwxotallyhipcom/
Cinax Designs I.nc. has relcased il-‘ilmEtlit, aMPEG videocditing pmduct desigxied for thclowendMPEG encoderboardsand the Internetmarketplace. According t0 thc Web silc.iFilmEclit is a “simple, easy t0 use MPEG videoeditor mcant to be used with real-time MPEGencoder (IBP) neferencc dcsigns and deriwrativeMPEG encode platfom1s."Contact:httpz/lcinaxcom/
Vertigo 5DDizzybringsSGIcapabilities to thcMac platformWäth Dizzy.you canwork with 5D modcls in industry-standard applicationssuch as Adobe’s Pbotoshop. Premiere, AfterEfiects,und PbotoDeIuneaVenigdsSOfEWTIIC hasbeen used in thc production of Escape Io L4.Ace Ventura,andMortalConzbal.Contact:hüpI//WWVV.VClTigO3d.C()lTl/
For more information on multimedia (lcvel-
opment,Check lICS’sWeh site.Contact:httpy/wwwjicsbem/
lune Campbell is the owner of Nightcals MultimediaProductions. You can reach her by e—mail [email protected] o: by phoning (604) 980-3219 during business hours. O
continued from page2Otors meant studcnts Werc cxposcd t0 contentdcveloped by a numbcr of spccialists.Insu-uctors observcd that studcnts were moti-vatcd t0 d0 more man just study forgjinalCXfllTl
Tree huggers?On medownside, many studcnts fclt the
interfacc was too lineanTheywould have pre-fcrrcd a more bmnched appmach to content
prescntation, Which Would allow for moredetail in arcas such as cngineering, if necdcdby certain studcnts.Mont: emphasis on simula-tions and. the ability t0 “play” or manipulateequations would have also improvcd intcrac-tion and ultimately retention.Onc big advamage of multimedia is that
instructjonal stylc can be matchedWith Iearn-ing stylc.A Student who leams best thmughdiagmms and visual reinforcement should bccxposcd to plenty of graphics and onscnccn.
Prus and cuns ufmultimedial IearningPro50 Greater user control produces morepositive attitudes towards leaming
0 Computers have strongmotivationalimpact onstudent Iearning
o Multimedia learners enioy a sense ofempowerment; they can control thepace, sequence‚ and format of con-tent
0 Use of audio and video clips, dia-grams‚ and animations addresses avariety of Iearning styles and elabo-rates on complex concepts
v Web-based content delivery reachesa broad base of remotely locatedstudents
0 Collaborative course developmentmakes use of content experts andexpands limited human resources
0 Programs designed with small, inde-pendent modules encourage nun-sequential navigation
Cons0 Poorly designed courseware lacksfocus and users can easlly miss rele-vant content
o Heavy use of text-based content isphyslcally restrictive and offers littleadvantage over printed material
0 Immature technologies may focusontechnical issues and inhlblt produc-tive interaction ‘
0 lnadequate teacher training results inineffective technology use and las-than-desirable student-Ieamlng out-comes — _
0 Less motivated, at-rlsk studentsmayfall through the crackswlthoutprop-ermonitoring
0 Traditionalmethods ofstudentevalu-ation are insufficient in measuring
l
student leaming d1rough multimedla
animafion to cnhance concepts.An auditorylcamcrwill gravitate towards audio Clips thatpaxaphrase and elaborate on text.Evcr-evolving courscwarc authoring tools
incorporatc thc ability to addvideo and soundClipswithirla hypcrmcdiacnvüomnent-ortolink to dynamicWeb pagcs that comzin up-to
‘
——dat\ccontent that plugs intocomsc curricula.
learälfiithtoughachlevementCurrcnt researcfi in multimedia dcsign
ims t0 tmditional principles of Iearning.dcnt motivation is directly proportional to
achievcnmmt. Studies show that when usingniultimedia programs, motivation increases
studcnrs work coopcmtivcly. Programstlüt prcscnt a choicc in how to completeaötivities and whcre uscr mtcrfacc is casy tofollow are most successfixl.‘Professor Gary Boyd, of ConcordiaUhiversityzs EducationalTcchnology Graduatel.
O
Progmm,focuscs on computcr-supported col-labomfivc Iearning. Boyd insists that a highlcvcl of motivation cm be achieved if a stu-denfs comribufion is nomrlvial and if pccrsand adult role modcls providc crcdit and pub-lic recognition.Boyd supports the use of a production and
evaluation team in order maximizz lcamcrcontinued on nage 27
http:llwww.computer-blayencom/ 4 MAY 1997 4 COMPUTER PLAYERI oAlllogosortradfilnancsare
thepropertyolthelrrespecflve
u
Autborizednaseller:
DEXTDN112Boumlary Hd.Bumahy, 5.8.Tel: (684)433-9866 ‚ W38unsTECHIIOLOGY 51135’369 lllleslBroahayVancouver, ILC. _
_‘Tel: (am) 3755553 l“W
1- 5*\’(,j„e1'„„.;i(; 42-’) KTX Flathgd Scanner
NEW TYPE COMPUTER “""‘ '
‚—l 0 480l! llpl
WORKSHOPß __ o single Pass
1179Paciflcam. -IBMvoiceryoe v3.0 lorWindows 95 -244m culorVancouvsr, 8.8. o lBMAntivim; =’ 0 scslTel: (604)889-0328 0 Jungla Bank ‚lt
-i‘
0 PC&MAC Platform _ __‘„-KTX 33.6Volge v Wordllnx OCR Program_;FaxModem v Pnololmpact v3.0 . “umscannenSALES ‘*2
452g “m,”w”,um15g - Voice Recognilion ‘S. Bundledwithkrumm;3_c_
-Navioate your llesktop Ä Lotus SmartSuile 97m.(au)2144“: -Dictate and rebly your email " - " " " '
_ including Lotus 123, Lotus-Surl the netwlhout keyboard M Word Pro, Lotus Freelance,-Works with LdlusWord Pro ‘B8332:P155;cm LotusApproach‚ Lotus
FAHONICS 3ndMSWord"g afln an Organizer. and Lotus53Clipper 3L, Ulm57K “in”.vx256K Screen Cam.coqulllam, 5.0. _Tel: (au) 540-5199 LotusSmarlsulteB7
» CREATIVEDESIGN1-2727Olmlra St.vlctorla. B.C.Tel: (250)388-1132
ADVANCED COMPUTERSEHVlCES7285 James St.Mlsslon. 81:. ._„
Tek m.2382 Microsoft’
TRI CITY COMPUTERS3510BWaslvood Sl.
: 2-3199° ( ) m lnlemelSonor xTx P133 Notebook z“-lBM P200+ CHU o 16MB RAMACURA commnsns -32MB EDO RAM .„ m ;„am „M 5546’13647-1mm:Ave. -25GB HardDisk o 3xca-99’;8mm, 5.0. -144MB FlOPD Drive .Trank pad - ‘ggyym; 5m)5314955 -2MBVideo Ca‘ . . - „ --. _ _ _ _ ‘ :l-2‘1l"lll";".'::."„"'°-12xCD-ROM ' ‘ ’ ‘
"m"T53“ coupu-Ens ' 164mSound äard was 0 2XPCMCMTYPE || 0|‘ |||31Willi 33- -3Com NetworkCard s Gnmeswllll Softwareworth S1945:Ladysmllh, 8.6. o 104Win95 Keyboard 3545 IBMVoice Type v3.0, Jungle Book,Tal: (250)245-7723 -MitsumiMouse IBMAntilfirus,MSlMndows 95.-33.6Voice FaXModem m. Lotus SmanSuite 97 including Lotus 123,
“mutenm -MSWindows 95 9“ LotusWord Pro, Lotus Freelance,Monitor not iocluqeo. 31;- r f f LotusApproach, LotusOrganizen and
E.’Fn’:'nsig. ‘r Lotus Screen Cam.
TII: (604)372-7337. Priees (0 63137199Wliholfl 9770|’HOÖ%.
oooooocuooo
H o w to pick papmupltimediao -BySTEVEBAINO o
uying amultimediaComputer is a xdativelysimple taskfliefarmlycreditcardwilloften
domstnicelynmkingittoüxccashxegiscerwimsomcthing that will pcrfiorm m your cxpecta-tions and remain serviceablc for the neun fcwyenrs,howcvex; is anothcr nmucr.Most Computer-statt salespcople can bc
incnedibly well vcrsed on thc necessary bcllsandwlfistlcsyouflneedtohave-aslongasthcy scll thcmßcyond thaga lot ofhead Shak-ingandshouldcrshruggingisirxvolvedflowdoyou lind outwhat you reallyneod to run thc lat-est titlcs 3nd play the gmcs you’ve alwayswantcd to try?What should you look foflWell,hends a primer for you.How dose to the edge?In terms of multimcdia playback,technolo-
gy is chmging rapidly. lf your currcnt systemis a few ycars old, it may not havc what ittakes t0 cffcctively nm today's latest titles, lctalone tomorrow‘s. Thc good ncws hcrc isthat most multimcdia devclopcrs positiontheir products to tun on systems that fcaturcthc lowcst common denominators of Com"-poncnts. The bad ncws is, this bcnchmarkclimbs roughly once a year with thc latestavailablc technology.Deciding whcther to buy lcadlngcdgc tech-
nology and pay top pricc,or go chcap and getthe bareminimum is always a big decisionflhebes: solution may be somcwhcrc betwecn.
Currcnt top wstems kann": 200 MHz proccssorsandshipwith IZX-speedCDROMdfiVCs,muldflisabytc hard drivcs, 32 MBRAM chips,andultta-fistgraphicdisplayczrdswifimtuptoniMBofvideo RAM (VRAM).Today's barc-bonessystemconsistsofa66tol0ONlI-lzprocessorvVithSMBOfRAMaqLndSpeedCD-Rohfldfive,SOOMBharddfiwJLndagraphiCdiSpIzyCfldWühZMBOfVRAM.‘Iheidcalmainsutamsystcnnnfightkammal53MHzPcrxtitnnproocsso1-‚l6MBofRAMaGX-speeddrivemndaglaphlcscardwithatlcastzmeghytcsofvRAM.Okaygcnoughoffixctedmkzliargorx.Many Computer dealcrs scll “packngod”ws
tcmsirxaneflorttofillashoppirlglistlikcmorl-itors‚speakers,harddfivcs,andaudiocompo-ncntsJfs toughtotcllcxzcflywlnt you're gct-tingflmoughlfs renfinisocxtt ofoldmusic enter-tainmerlt Systems whcrc the tuncr, amplifier,turntablaandspeakcrswemconglomcrated.For rmny technophobes, bundled packagcs
an: gxeat, becausc there's very littlc dxoiccinvolvedYou simplyshopbrflac xightcombi-nationofwidgetsandpaythelowcstpricalfyouhalookingforgoodqtnlitxflxepackngedealmay not bc thc bes: mutc, howevc:Canefilllypicking out you own componcnts usuallyxesultsixmasupcriorsystcm.Parts ls parts?For thcvisualcficctagettingaquality moni-
tor is a wise movcA good monitor can lastmany yearsAX/hen choosingbe sureyourncw
mqnitor comeswith adjustablc brightncss andconjuast controls and the image is uniformlycrigaanddeanclnazkforanyscreenflickcrbyusijg your periphcrsl Vision rather than look-ingptlhcscreendirectlyandlookforgoodantl-glarc coating. Cheap coatings appcarcotfiseanddifiuse light,makingdctails on your: diflicult to readTry tuming themonitoroffjlnd omreading a rcflection fmm whitc,
tvpfwrittcnPapetAlso‚bisher quality coatings=bc reißßnized by a purple-bluisl’!when vicwcd undcrfluoresccnt Iights.good sound‚ speakcrs malte thc dificr-. ‘Iwo reputable speaker manufncturcrs'
:SonyandAltec IansingExpecttouglfly S110 for a pair. Look for spcakcrs
haue power supplies 2ndstaydes} of battcry-powered modcls. -Tlie bcst-soundirlg speakers often includcm 4' spaltet concs, individual controls,andppcrfomed mcml grilltsfilhe sound card
fläflzdfivingyourspcakcxsncedstobcatleastl _Sound Blastcr Pro compatiblc and capa-‘
handling both digitizcd analoguc sound' ' music.Many popular sound cands
A
a: least this. Some cvcn includc head-pho; and rnicmphones,which am usuallycheap addons.If jouac considering connecfingm theWorld
WklqWebpa fast modern is Ihe tickctAlthoughyoufivotftfixldmtllümcdiaqtnlityasxficeasü}basedtiflcgsomcsitesolfersoundandvklcodips.
' 'themisatteagbutifyourmodan
blc
1L
systemiszftuptospeedyounuybedisappointed.Formodern speeds‚55.6 kilobits per sccond
modclsarecatdfirlgombutßßlcbpsisthccurrent standanilfyou decidc on an cxtcrnalmodcm(whidltnanyapenspmh)‚bcsurc.yoursystcmcanhandlc iLYoursystcm’s"UAKl"'düpslmmdbcthemostup-tomtctosuxpponthefastcsttransfcrmcs.A brighter future?Soon, thc necd to buy additional compo
nemsslnchassoundmrdsandgmplficdisplaycards will bccome a thing of thc past.Currcntly emcrging Chips by manufacturcrCyrix xtplacc addcd handware with softwarcinstructions handlcd by thcir ncw 120 MHzMedia Gxffhc result will be multimedial systcms chcaper by as mud1 as 52006300.Alrady, Microsoft, Compaq,Accg AST, and
IBM Canada am intcgrating Support for thctechnology into thcir new products. Cy11x'schip competes with similar tcchnology dcvel-oped by Intel, callcd IMMX,whjch is availableon Pentium-bascd pxoductsWhile both newChips hold promisc for high pcrformancc andlower prices,existing operning Systems don'tyct recognize thcir command instrucfiorls andonly rcccnt applications takc advantagc of theChip'S stncngths.
Steve Bain isaprofessional illustrator,designe, andwriter.Heislhe author of Spezial Edition, Using CoreIDRAM 6 (QUE) andLooking Good Online (Ventana). Conlact him [email protected] orSteveflxeliulet O
IIIILY MAI!!!MacLCwilh Monitor 5495
“
Persono|Laserwriter 5495
MAI: 95ältlntlwaresg
Watt S(verynicellreakers
Inly529950!‘-
Laser 8. DotMatrix PrintersJust Arrived!
Hard Drives (all sha es 8:sizes from 20 to I0 0 Mb5 “"..*l!I5"“„.
6MonfhWarranfy on EveryfhingSold!
l‘t SäleM[BHMlllllll.PCIVideo Cord 539 PenliumMlb 8; CPU‘|6 BiHSound S39 P . 66 s‘14.4
M°dem| Pe""."m 90 519914.4Externe 37mm“
K513i?*6‘?
äzsggäeme Just AmvfdsqPenliumMotherboards S99
BOXES 8<BOXES OF' Com & Lpl
orls, prinler cobles,ans 8; LED's, etc, etc
H‘!!!
‘PITERS
Phone #2627 Kingsway Vancoulver, BC V5R 5 H 4
4511-5333 Check our our web silewww.rapidexma/I.com/BC/BC/Benchmark
ß COMPUTER PLAYER! > MAY 1997 p http:llwww.computfler-playencoml
LumberLand
’BRIDGEPORT
SWEDEN2nd floor abovc Subway
586 PCI SYSTEM5X86-133MHz CPU
PCI/ISAMBw/4X72 Pin SlotsFast I/O 4 EIDE& IP/2x165508MB EDO RAM 60ns1.3GB EIDE HardDriveMitsumi l.44M FloppyDrive64bit PCIMPEG IM Video14"Acula NI/LR .28 Monitor104KeyWin95 KeyboardAddax 13"Tower Case 230W ps3Button Mouse& Pad
Multimedia Bundles6x/l0x 8159/165‘Mitsumi 6x/ 10xCDoROM‘16bit SB compaliblePnP Sound Card‘Gooseneck Micphone
SUPERDEAL
ADDAXCOMPUTER Inc.
Bes!quality, Bestprices, BestServiceWewill try to beat any avertised price! Systems are InternetReady withf 1monthFREEaccess. 3 year's Labor& 1 year partswarranty!
Multimedia SystemsPower Systems
#21-1239I BridgeportRd.Richmond V6V 1.14TeI:(604)244—07»93Fax:(604)244-9762http://www.ac1dax.caMon-Sat:l0am-6pm
. PentiumCPU‘1 . PentiumCPU: '
6x86 P151“ 51493 5 i:„„‚„‚„„„33 s8_‚„8„5,„5 Intel P100/120/133 51309/1325/1375
6x86 P166+ S1538 2 „‚5„‚„6„„„ „3„„‚79‚„59 Intel P150/l66/200 81399/1539/16196x86 P200+ S1598 MMXl66/200 51129/1389 MMX p156/2oo 51539/1349
'
391/533‘; 86glfifflß“ PRO 150/180/200 81609/1919/2029Triton 111PCI MB,512K PL Cache Plyggfimom‘ 5835/949 Cyrix/IBNI 6x85 CPU;Fast 1444131958:1P/2xl6550 5 86PR150+ 533,; 1-11 1 P150+/Pl66+/P200+ 51305/1345/140932MB EDORAM 60ns '° '- " “ x4x72 8‘ ““°3P‘“* 3 9 “ “ ,USB p‘ 150 5111149 6 86PRl50+
'
5130512x PanasonicEIDECD RQM _ Pro 150 S160924GBEIDEHARDDRIVE IntelTriton Chipset 256K PL CacheMitsumi l.44M FloppyDriveS3 3D 64bit 2M(exp. 4M)MPEG Video15"Acula NI/LR/DigitaI/OSD MonitorZoltrix 33.6 Voice FaxModemZoltrix 3D Surround PnP Sound CardMitsumi 104KeyWin95 KeyboardMitsumi Mouse& Pad '
Addax 19"Tower Case w/230W PS60WAmplified Speakers
Fast I/o, 4EIDE & IP/2xI6550 USB8MBEDO RAM 60ns1.3GBEIDEHARDgDRIVEMitsumi l.44M Flo y Drive64bit IM (exp.2M)EIMPEGVideo14"AculaNI/LR JSDP MonitorMitsumi 104Key Win95 KeyboardMitsumiMouse& Pad
„„
*InteI Triton III VXChipset 256KPBC 4EIDE IP, 2xI6550*15" Acula NI/LR/Digital/OSD/Flat 1280x1024Monitor '
*16MB EDO 60nsRAM*2.1GBEIDEMode4 HardDrive‘64bit IM(cxp.2M) MPEG Video*l6bit PnP Stereo Sound Card‘Mitsumi 104Keywin95 Keyboard
* Panasonic 1.44FD
* 60W Speakers
Addax 13"Tower Case w/230W PS*33.6V3.4 voice Fax/modem
*Mitsumi Mouse&Pad* 15"Tower Case 230w* 8xCD-ROM EIDE
‘60W Speakers
PCI VIDEO CARDSTrident 9680 64bit MPEG .....................S39Cirrus Logic 5446 IMMPEG ................. 39Cirrus Logic 64bit 1MMPEG...... 28S3 Trio 64V+ IM MPEG.....................‚ 42S3 3DMPEG 2M/4M. .........DiamondStcalth 3D 2M.......................... 119ATI 3DXpression 2M SDRAM ........... 95ATI 3D+ PCZTV 2M/4M ................ 159/189ATI 3DPCZTV ProTurbo 4M/8M.. 252/359AT1TVTunerCard..................................137MatroxMillennium2M/4M W......‚. 199/279MatroxMystique 2M/4M SG ......... 145/189STBLightspeed I28bit2MMDRAM 129VideoCardEDORAM IM ......................14
MAG DX1795 .26dp/700T .25dp ....815/855ViewSonic 17"GT770/PT770.........909/ 995ViewSonic 17"GS/PS ..................... 795/945Optiquest V773/V775 ................... 685/81515"Mitsubishi ISVX .28 ........................52517"Mitsubishi 67XV/87TXM .....„896/104915"NEC I5XV+/M500 ................... 529/53917"NEC l7XV+/M700 .................969/102917"NEC P750 .25dp 1600x1280 ........ 1225
15/19"ATXTowerCaseW/PS.........115/149
i
peee iilställlävfläiflADDAX@Computer isUSA based computer wholesaler which has been successfully serving our customers since 1989.
We sell various Computer and Internet books foess tMOTHERBOARDS
Pentium Triton III PCIMBMMX ...............S1094EIDE 1P/2x16550, 256K PLBurst Cache4x72/2x168pin, SDRAM. USB PS2 Port
Hsingtech Pentium ProMB .......................... 279ASUS T2P4HX256K PLMMX .................. 167ASUSVX97fTx97 256K PLMMX ......... 145/219586/486PCI/ISA/VLBMB............................... 85
Fast I/O. 4EIDE, 1P/2x16550. 4x72pinGA—5MSATX 256 PBC 8-512MB ............... 165GA-6FX PentiumPro 512k PBC8-512MB...299GA-6DX P-ProDualCPU 512k PBC ......... 549TyanSl470P5VX5l2k .................................I89Tyan Tomcat lll DualP5/512k ...................... 315Tyan ProS1662DDualP6 ............................ 479
MONITORS PRINTERS14"Proview/AculaNI/LR .............5215/229 3gägggfgägfi----------------------- °- 521815'-xrx .23NI/LR/DigitaI/Fla ............‚ . 28815'-ACULA NI/LR/DigiJOSD/Flat .....„319 153m“Lßäwpägä-ööäm:äigäü
""""
15"SceptreNI/LR/Dig/Flat...................‚ .339 ßanafiongrßönxT 6063 .öppfi” 43417"SceptreNI/LR/OSD .28/.26 .......599/679 Bfihflfluöeonxrmelzoog‘.(‚mm
""""""
544l7"AcuIaN1/LR/Dig./Flat./OSD .............599 B‘°m°‘HLman “fzood PLIPPM
-------"B99
Samsung I5"GLE/GLI .....................449/479 8mm“ 00S‘"°
4 P‘. ---- "7
Samsung 17"GLI/GLSI.... 839/999 ‘° WC “ “ m ” 0°"?! --------------------- -" 9
MAG DxlsTlsdp _____________________________ u 475 BrotherIC-ISOScanner400dp1OCR .............. 99FAX/MODEMSZoltrix33.6FaxModemNoice......GVC 33.6 Voice Fax modem.......USR 33.6winFax/Modem............ '
USR33.6FaxModemNoice ............... 135/I38USR56KFaxModem/Voice...................228/248GVC33.6Voice/Fax/Modem Ext................. I39Zoltrix 33.6Fax/ModemExt. ........................ II9
3 CD -ROM& CD WRITER6xMitsumi EIDE ........................................ 99
13/15"TOWCTC356W/230W PS --------346/52 8xPanasonic/Hitachi/Mitsumi ....................10917/19"TOWCTC353W/230W PS --------- 57/64 10xMomitsu............................................. 112ATXDesktopCaseW/PS.................... 105 12x panasonic/pionee, __
12xCreativew/RemoteControll16xHitachi/Toshiba......................... ..12x SCSI Pioneer/Panasonic................... 2278x/4x SCSI Panasonic ...................... 209/147Panasonic 4x2x w/SCSI ControllerCDR.. 559HP SureStore 6020i 6x2xCD-Writer ....... 615
g
_ HARD DRIVES1'l.0/I.3/1.7/2.0GEIDE 8213/223/245/2552.5G/3.1/3.5EIDE ..................... 315/365/3954.1G/5.IG EIDE ..............................445/595Quantum I.7G/2.1G ........................269/295
p Quantum 2.5G/ 3.2G/3.8G ........329/379/419WD I.6G/2.lG/2.5G ................. 269/295/329WD3.2G/4.IG...................... .1Quantum SCSI 1.2/2.IG ................. 339/445Asus SC200 SCSI PCIController .......... 119
SOUNDCARD«ESS 1868 16bitPnP.................................S28‚Zoltrix3D 16bitPnP 31‘Ymaha3DSurroundPnP ........................ 42Sound BlasterPnP 16/32Bit ............. 68/125SoundBlasterAWE32 ........................... I45‘SoundBlasterAWE 64 RetailBox .......224
‚Speakers 60/200/300W................20/55/75Micphone .............................................. I0‚HeadphonewNolume Controll .............. 19
Keyboard/Mouse/Misc.MitsumiWin95Keyboard........................S19MSNatura]Keyboard.... ...... 85Mitsumi Mouse.. ........... ........ 8MSMouse...................................30Logitech Mouse2B/3B ........... I7/28Panasonic 1.44Floppy Drivr .................. 29
Networking„ISA 16bitPnP Ethernet Card .................... 32{fpci 32bit PnP Ethernet Card ....................39‘5Port Ethernet IOBASE-THub............... 95j-8 PortEthernet IOBASE-THub...............105‚.16PortEthernet IOBASE-T I-Iub............. 169
Wesell parts and
QV/‚Iriialan half prices!
MEMORY30pin 1M/4M................................ 59/3172pin SM/EDO... . . ......56/5672pin16M/EDO....... .... .. 107/10772pin 32M/EDO.......................214/214I68pin SDRAM 16/32M .......„115/232256K/512k PipeLine Cache........ 20/39256K Cache for 486/586MB ........... 19
CPUAMD 5x86-133MI-Iz........................ S52IntelP100/120/133 ............ 135/I42/I79IntelP150/166/200............. 199/338/409MMX I66/200 ...................379/618Pro 150/180/200 ................275/569/679Cyrix 6x86 Pl20+/PI50+......... I19/125Cyrix 6x86 P166+/200+........... 159/219AMD K5-75/90MHz..................... 55/68AMD K6 I66/200MHz .................. Call
ZIP DRIVESPanasonic ZIP ParallelExt. ..Iomega ZIP ParallelExt ............... 199Iomega ZIP SCSI Int/Extm. ....... 199ZIP Disk 100MB .......................... 17.50UPGRADEOPTIONS8M to I6M to 32M ...................855/106256K PL to 512K ............................. I914" to 15" to 17"Monitor ...........89/2891.2G to I.7G to 2.1GHD ............. 40/3513"to 15" to 19"Case ..................10/I0Win95 SR2 FullVersion CD .......... 105MSOffice Pro 7.0 .......................... -269Video RAM IM to 2M to 4M ...... I5/28Speakers 60w to 200W to 300W 29/19CD—ROM 8x to 12x to 16x............ 15/30
(Notebook......CaII)3.5" Floppy Diskct ....................„S029Moveable Hard Drive Case ............. 29Power Corc Split .............................. 5PS2 Mouse S: Keyboard Adaptor..... 5PrinterCable ................................... 5Cablc IDE Hard Dive ................„3CablcSCSI 2.-"5Heads ....................„S18.systems at wholesale prices!
0 0 ByCARYN MLADEN 0 0
If the Internet i5 SLlppUSCd to be instanta-neous. why are delays and download waitssynonymous with Weh browsing? Untilrcccntly, you could puy for a special phone
Modems picking up s p e e d againline, such a5 ISDN orTl.or accept the slow28.8 kilobits per second (Kbps) connection.Thatls fine for strict data or text. but oncc theshow gcLs gmphicnl. the wait to download 21
single Weh page can feel like an eternity.Weil. hold onto your connection ports.
because the line just got fasten Top modem
makers have just relc-‚zsed 56.6 Kbps modcmsfor little more than the pricc of an old 28.8job. Global Village und US Robotics haverecently announced their plug—‘n‘—play, high<speed modcms available in both X2 andK56flex standards for both Windows and
You mny have l() change your acccss dialingnumber-chcck with your ISP-or add someprovided Software, bui it's all a simple processthat takes no more thun 21couple of minutes.The result? l-‘astcr dnwnloads, morc sttemn-lined video, and lcss fmstrating browsing.Llnfomuutcly, some oFthe delays rt-nuin. evenMacintosh.
l1
ualityWithou CompromiseSceptre WINpayP5A
Iust one in a complete Iineofaward-winningwindows‘95compatible
CRTmonitors.
Sceptre:
17 inch,.26 dotpitch,non-glare,flat screen(15.9 inch diagonalviewable image)
1600x 1200 (6370152) resolution1advancedon digitaloontivols
lowInflation(MPRÜII,TCO)‘ Syeariiwarranty
Sceptrifs family of14‚15. 17, and 21 inch ORTmonitorscomply fully with DDC1 / DDC2Bprotocolgenstsring
v maximum oompatibilitywith Windows ‘95 from Miudsoft.They also featureVLMF orMPR II and äsfngllei’,
footprint for saving späce. As an ISO9001manufactdrel’of'
notebook computers. CRT andLCDflatpanelmonitors.SceptreTechnologieshas theability tomaintain highquality
Standards and competitivo pficlng.
Sceptre VFTIS%
The futureofLCD coifilputermonitjors. Today.1|
15 inchTI-Tdisplay ( ’ .5 inchmeasureddiagonally)plugandplayXGA (l _w
x 768 resolutlon)smallfootprint (15.5 Üx l3"hx 7”dwithstand)wallmountable (15.5
‘ x13"}:x2.5%)advancedon screen ‘talcontrolswindows ‘95oompatifile
Soeptrds high resplution LCD's. including the 15" FT15‚ the.12" LT12S (beige)and LT12SB (black) offer a vühole newwodd of soluflons not possiblewilhtraditional ORTmpnitors. ; extremely small footprint allows usewhere spaceis at a premium. Sceptre LCD's emit no radiation, maiking them the idealchoice in envirdnments wherfe radiation ‚is a major concern - suchashospitalsand laboratories. Sceptre‘s if/adiation free displays won't disrupt magneticirnaging orotherflequency sensitivework. Sceptre radiation-free LCD’s “
eliminate emission-related höalth issues and are also flicker-free, reducihg thepotential for eye strain. .. l
i| Freewithpurchaseof anymonitor I! |
Forcomplete’ äoduct line
information :
EXCELLENCE F O R ALL T H E W O R L D TO S E E1-800-788-2878
@(‚mnpu
Yisit us ul (Imndt-x(Lanudzi ‘FIT , Iuly .‘l»l Llionlh «f3 I22MicroAge CÜTIFLCEITTFIE
0 COMPUTER PLAYER! D MAY 1997 D httpz/lwww.computer-playencom/
though the modcms an: not a: fiiult.Using a few difieiexit online seniccs.I’vc never achieved top spccd.although accms was still significintlyfilStCf thzm (hat amilable with my old2.8.8 modem.Many lSPs huve not yctLipgmded thei: own modems to proVidfi‘ 56K accexs. so the fixstcst Spccdumilahle um)‘ be only 33.6 or even28.8 in somemses.Call your provider t0 lind our itsStatus in providing fastcr Service.Somc liavc a 56K telephone num-bcr, although a fcw providers an:trying to hit up their clientelewith a surchzirgc for using thefaslcr Service. If yours docs so,Complain loudly and considermoving to another ISP Lhat doesnot try t0 gouge its customers forthe bzßic costs of keeping uptodate in the constantly changinghigh-tech industry. If they can'tstand the heat..‚!
Dueling standardsAnother fly in the ointment is thedual Standards of X2 and K56flex.First came X2, thcn Lucent‘fcchnologies and RockwellSCmiCOIICILICIOX‘ Systems cieated acompeting K56flcx Standard. Theproblem ‘Ls that sonne pmvidershaveadoptedX2while others hnvendopted K56flex.AnX2 modem isincapable of working when con-nected to an ISP usingK56flex.andvice versa. Ifyou usemorc than oneonline Service. ‚vou must rcmoveand reinstall 21modern every timeyou want to check C-imil. Havcntdevclopers lcamed yet thzit CUSrtomers want compatibility" andCasC-ofuse?But äIfICI‘ all the complaining. thcsedifficulties are likely to be noLhingmore than growing pains.Doubtlcss.56K ZICCCSH‘ will bc avuil-able from 211l lSPs in the near futun:and. hopefully, all modem sum-dards will work with all providers.The smartmodemmakers am pro-viding both types of modems andthe high-tech companies are tryingt0 rczlch a compatible compro-mLscThC faster access ismorewel-coming to the incrcasingly‘ gmw-ing online population of ncwbicswho arri-ve expecting cable 1W’-type pcrformance. 56K i5 nothingclose to wlmt ‚vou am gct with ncable modem-or a cable TV forihat mzlttCf-—but i: is much bctterthan what came before.Telecommuters should be awamthat the 56K technology onlyapplics to material moving fromthe lntcmet t0 one's Computer.Uplmds continue to max out a:28.8 Kbpsffhis,agaimis likely to beresolved in the not too distantfuture. ‚
s
oBy CHRISTOPHERcuw o o
Trevon-Wflson is mad ashellatnbaddrivcrsandis venting his anger thmughxheWeb.‚The 27—year-old‚Ausmlia-bom ‘employeeof aVancouver-arca radioStationwelcomcsstxbmissions to bis “Da. Idiot DtiverAlert”home page (httpt/lusersamiservacom/-gdaymate/drive).ExclusiveformotoristsinBCsLower Mainland,the Cyberspace snitchsähei5fan Internet ofpeopleSeendri-
One section is devotedto idiat ‚driverhis-‘ tories,broken downbymonthsg
-_Fcbruary, for exanxple‚.Wil(son_’a. sitel7'teports—most of themzon
Februarv 14.-fm_m people 1655toward t_he spirit of Valenüneis
DayNo namesjardejnenfioned, bin ‘in alleasesfiles-containavctnd‘' eßdesmption,"."
plage nmnbcr;'
FebruaryPÄivat 10:15"pnafjdaxt‘
'
colomedAuifisooo sedan,withBC1“plateaLj(}'DG_-963‚ on‘ ' '
roadargätfsttiaet
360'511“et-trafficand 105AAvenue in Surrcy.Wilson‘s com-ments:The driver, ‘ an idiot,"who jumpedthe concrete median "t0 save 20 seconds,screwed up [thc] er's suspension andunderside.‘True erlmeThe scenarios cited in this section, how-
cver, are a lot lcss serious than thoseappearmg onWilsorrs‘DaKILLERDrivers‘115L Here, he holds nothing back, explain-fing in often graphic cictail cases whexe dri-vers have becn charged with dangerousdriving offenscs,which often involved thedeath of anothermotorist o: a pedestrian.Among the exampls i5 Nathan Cook, a
ZZ-year-old Wncouver resident who wassentenced to two years in prison afterpleading guilty t0 criminal negligcncccausing death afta- his vchicle struck andkilledJosephWoodside, 23,last September.Says Wilson: “This gutless wunder ran
fiomthcscexxe oftheaccidmnlttumsoutthatthisexamplcofvcrminhadbeempar-tying’ for two days, drinldng alcohol, andconsumingcocaine."Rotinhell‚NathanIvanGcnldCook'O
J4E‘A:
i‘:
i:iiJ‘.
conältinued from page23within a collabomtivc fiamework.
Teamgfmexxmmwouldconsistofboth subjectand tcchnical cxpertsfilheit tasks
w includc dmmatization and simulationsof cqntcnt, dcsigx: of social groupings to
enhance learning, development of telecom-m tions and lcaming-suppon Software,
‘ tion of hardwarc, fisal and timc
budgäts, and evaluativc mechanisms tbr stu-dent ' dstafffeedback.
stat fismden:goalsandobjectivesIhe leamerhas t opportunities t0 ptactice a skill,
‘ LmateriaLand demonstmte understand-ing
'
concepts preserxted. Multimedia pro-gramq’ that suggest off-üne acfivities allow aleamÄittouansfernewknowiodgetoaxeal-üfe
J äas in the 01dmodcl of teadler-dixcctedl if students cannot see the relevancein they are studying,thcywill likely tune
_ultimcdia programs need to answersuch as why somctlamg is being
andhow it will bc uscful.
'‚ edia applicatioaman overabmdancc ofbuttoäxs, hat spots, and popup menus some-timesToverpowem sound instructional design.Infacßsttldiesshowthat too muchlcamercontroldecreases acadetnic pcrbmzance.
ptoduced multimedial curricula risk
impmpcrly paced or sequenced contenLAknowlodgeofhowmudlpmcticcisnccckdtomaster a topic is essenüaLToo much studentcontrol may result in studcnt frusu-ation orconfixsionIoo little control may spawn bote-dom.
"
Like many areas of Computer technology,advanccs inmultimediaprogxamdevelopmcntcontinue to racc ahcad. Standards governingproduction of educaüonally sound pmgramscontinuotxsly play catdn up. lt temains to beSeenWhether mulümedia designwill mature into a nighumn: or educationalpanacea. O
continued from page26(‘man in-‘the water’: fineSo why get a 56K modern now? Why
not? Most are priced at about 5289, thesamc pricc as a 33.6 Kbps modem andjust a litdemoremana 28.8.GlobalVillagcmaybe starüngamodcmpricewarwidlarecent announcement that its 56K lineWould starr at only S219.Check to see theresponses from compctitors before youbuyfconslmers can only. beuefit fromthis Situation.Modem companies gemal-ly offen- incxpensive upgmdes or trade-insaswell.You get fistct access, even if it luasrrt
quite hit the 56.6 Kbpsmax-k yeLWhcn itdoes reach today's pinnacle of accös
speed, though,you’ll be thcte! O
7
wggggg‘ HOMIFCOMPUTINGR MOBILECOMPUUNG
4N'wT°<='="°'°8v '"°- mmrtnm mlnlnllawrlslalln—
Unit 130 -3771 Jacombsm1.. Richmond vsv 2ms i I m _ jpemän? MMXcProcessor‚ I -ower ose
_processor w _ _P
- < _)“ m m ”
‚ f
BUSINESS,SOLUTION&PROVIDER I ä‘„%°‚f‚„2‚°‘s“3(‘„ß‘g;WM „ m ,* w a s Asmenmesoeokers Mumm:mmnunsen
HARgggggggNgggggsis f * PenfiumIOOMHZTCPEDORAM
vEquipmenf Troubleshoofing a.wmdows 95 Fnmnced Keyboard * 1-0GBRemwobb “ Ü ”Dme
. . . M5E'9°"°”?°“W59 I * 11 3"DSTNaoox600SVGA/128 anVideo-SefvaceAnalysis &Recommendcmon
r Monno;extra? w o * Toben Pod 9.Ponnt of Soles Lease for Sfwmonth s1999 Lease for S79lmonth s‘\99HARDWARE INTEGRATlON
°Hc1rdwore Installation s:ConfigurafionHARDWARE SALES
h‘ _ i‘S3599-CustomManufoctured Servers 8cWolkstoflons Ü F Ü Ü Ü Ü ‘ 5 Lease f S125Imonth' . . remallnrlslallun
°'
soErwARE RELATEDSERVICES V E t w a ,‚ ‚Mode-m°DatabaseDevelopmenf -|me|Penfium p] 3jjMHZ MuIti-Functioncard° InternetSfie Developmem ;; * IntelTmon u‚ChipsetMBw/25bKB Cache-Point of Soles E: :_
* 15mg Ego (‚ans S! e
e‘4
" -------------- * PCIo4 anVrdeo o Ie o1 /2MBDRAM- * 1.286sEIDE HD/l ßzliAßrFlgfpg/V1 59.!’ _
NOTEBOOK IPCUPGRADES, SERVICE&REPAIRS *flgsgeecgde
c „ROM Palmghht— * ’ -ower cxse_ ” '
Maple Ridge, PortMoody customers can call: * MonnorExtra ‘ WOW !'
(604)644-4655Ask for “Sunday Lau" A ;_
Authgriled Rgsäne; for ; Canon All rates are based ona 36-monih business iease (O.A.C.). Fmal lease rates.payments and optionsmayvary,
httpzl/wwvucomputer-plaayencom/ 4 MAY 1997 4 COMPUTER PLAYER! o
O O O O I I O O O O0o
rush up on your NetiquetteCompiled by KEVIN LINFIELD
Shmoozinspeedo
Thehnunetbringsanlvdenewmeaninghflnelvlorfing‘!Noweverybcssimssuvegavmessofsizeortypghasüneopponmityto‘netwotlflonthewoddxlargsxLOMPUIE! nemomihe Internet.ThefactistanadianbxzsinessiswakingtmronnevalmofhterrmAccssandPrz-senceatmumnece-
demed rate, recogrizingttieimpaa ofthehlafinmnaatkefingtocomm ‘n-
tionfiu-naimshtagirleenevxdingyowmatketaeabeyondnationdbomdafies.
eventhotasafndsofdoflasonyoulelefllolwäftdfaxbillfißidflflfsflfifllßbeginningtmsfionLnucbupuillfikpltümlnagiwhwe
.|. m I. l . I .
theirhmnztneedsandpwvidirlgflrerightmnspondingmmnetsolufim
ungiaisauscvimbunsxcssnadhcscnacaapagwlbsuviczshcbfingCorp-nmeüalwlcaounts/Dedianedkczsskcotntsg/IebhgeDesign/Webhgestorage/Wnual
WebSewers/OonfinrdavneRegistration/V‘ htemet
Training...adiud1mom!
rormommrucmuonabourmagmortoreceiveafleecnnsmtation,cfllus 3:66:83,32.
Fabrik Communications lnc.‚ an “c-mail Con-bectivity’ company in San Francisco.ammaßmmmmomnmmmm
ficaturing 12 tips (o improvc your busi-hcss cmail, frce of chaxgcYou can order- aEopy from httpz/lWwwfabrikcom/ Ot Call(4l5)-439-6600.Formorcdctails,[email protected]‘
Blg screen,blg differencePhilips Elcctronics Ltdannounced their ncw0.26 mm dot pitchBrilliancc 17- and 21-inch monitors, wichestimated strect priccsof 51,199 and 82,999respectivelyr. Both05errcsolutions up to 1600x 1280 and are avail-able through autho-rized resellers. Phonc(416) 754-6245 for
man: dctails.Eizo/Nanao has annomiccd their new linc
of 20- and 21-inch Computer monitors.fiumring resolutions of up to 1600x 1200 a:
‘J5Hz, thc estimatcd street price is 52.599.
Pnintca u !1’ . | ! v 1 ; ? v
Phone 1800-8006202 orhttpzl/wwweizocojp/welcomc/Optiqucst reccnfly released an affordablc
ZO-inch monitor with an estimatcd strectprice of undcr 31,1001: features a dot pitchof 0.28 mm and a maximum screcn resolution of l6()0 x 1200. For monc information,Call VicwSonic at 1800-8888585 or visithttpz/lwwwvicwsoniccom/Captive audlence?PointCast Canada has announccd
PointCast Connections,a frcc mcans to pub-lish t0 PointCastCanada's vicwcxship.Bascdon Microsoffs Channel Definition Format(CDD,publishing is claimed t0 be frce,easy,and based on opcn Standards. I-‘or momdctails, visit httpzl/wwwpoirltcastca/Now, a really blg screen!Fujitsu has launchcd what it claims is thc
world’s first 42-inch colour plasma display.Providing an cffcctivc display anca of 36.2by 20.4 incl-Au and weighing a mcrc 87pounds,it offerswidc-anglc vicwingof up to160 dcgtees. For morc information, contactCommcrcial Electronics Ltd at (604) 669-5525.Visit China from homeWelleslian International Information Inc.
has rcleascd China Navigator: TbeOfifcial China Traue! Guide on CDROMfor Windows. Containing ovcr 500 photognphs, morc than 1 million words o1description, thrcc hours of narratcd mate-rial, and dozcns of maps, it also offers sur-vival tips for travclcrs. Morc informationcan bc obtaincd by visitinghttpzl/wwwwcllcsliancom/dragontour/ orCalling (905)4709002.
visit
MyCom ComputersCANON BJC 4100 . . .S293, BJC 240 . . . S228HP690c. . .S382, 870CX|. .
27%:M I U ÖJ X Ä I C F Ü H I K I2
ä ä fi 9 ä ä % ‚H 5 3.ifiä..662a, 5L. . 452a, 6P. . . 3948 e e."
i 5636 DUNBAR s1. (DuNBATEL: (604) 264-9883 FAX: (684) 264-9881Tues -Sal10:30 am-6:30 pm,ä fi fi ß :.E? .fi-fi.fißfimfiäfiflfiifibflß!
fififiäfüffiß ’fiiüflääfifäfiä °UPGRADE T0 ‘rnusPENTIUM
17 V S OPTIONAI- _. " Iew onic . . . . . . . . . . . . . . . . . . . . . ..+S498P°“t!"'“'12° ' ' ' ' ' ' ' ' ' ' ' ' ' 3553P466, o MMX 17'ACULAMPH11 . . . . . . . . . . . . . . . . . . . . . „+3310Pentium-Hol) . . . . ... .-----S648 „ . usnSportster33.6WNoice . . . . . . . . . . . . . . „+51662
Intel Vxman.‘ ‘ 33.6WNOiCe . . . . . . . . . . . . . . . . . . . . ‘l’168 pins DIMM&USB avaflaäie) 16M 72 pi" E00SJMM ‚
CVEDRRSJ. . . . . . . . . . . . . . . . . . . . . . . . . . . . + S38
16M E00Mem 1_44MBF 13m9 4, . . . . . . . . . . . . . . . . . . . . . . . . . . . . . + S75p C | SVGA + M p E G 2M L 1 6MOD 4 EIDEHD i 3B 32 PnP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . + S58penfium CpU w/Fan SVGAMPEG PCI W/ZM i 5B AWE 64 . . . . . . . . . . . . . . . . . . . . . . . . . . . . + S188Labor included S816 + 12KCD-ROM Ä 130wSpeakers . . . . . . . . . . . . . . . . . . . . . . . . . . + 54515"MPRII LR.NI.Monitor 32M EDO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . + 311cOptional:WD 2.1/ 2.56 . . . . . . . . . . . . . . . . 32981333 Med Tower Case w/CSA 230W er MmenniumMM__________________________+ 5155gggPgggeggggyäx/ta ----------- -31% gmgdfiegggfseg Mvsnous 4M ......... ;................ .+s165' ' ' ' ' ' ' ' ' ‘ ' ' ' ' ' ' ' "
‚ TVTuner..............................+g128
P-120/133 / 150/20031188/3182818 863182273
sun 1:30pm-5:00 pm, Mon. Closeda.41s:A116.)
6 COMPUTER PLAYER! D MAY 1997 b http:Ilwww.compäuter-playencom/i
o EPSONTrlcera Color Ink Jet"imaging evoIution"3- Computgr Warranty Repair_ &Parts SalesLook|ng for a Scanner
Epson e s n o o o c ..%.or an Ink Jet Printer?Lowest nricedseanner able to
::::‚°sf:.:';s:‚':.::r.'% svss""5""‘s z‘ EPSON Stylus PROXL'
EPSON Expression 636 _A
13"x 19" Photographie printerTop rated high end business Scannerenhanced image for the bestOCR results.
A
EPSON Sty|us1500°°°°"'°"*'°“' ' 3° b" 31195 17"x 22" color CAD Printer°°"‘"’"'“°°"""°e EPSON PhotoPC500Polariod SprintScan35 LE co|or Digita| camgfa EPSON StyIus400For35mm slides and negatives __ _ A rea| so|ic|printer.12 MB image size 5UP°"°"PWWWQuant! The best personal printer choice.1950DPIoptical-3o bit S999 for brilliant documents 2°°“‘""‘ m ’i‘ 3'° For both Windows s.Mac 1440 DPl...you've heard about it...Polariod SprintScan35 + 64g x 43g D p | 0 0 W 0 0 m 9 i" 3nd 599 i“
:;"„j’3';‘„'‚';;2‘1‘‚’fe°""“°9°“"°5 EPSON StyIus600
2700 DP|°PtiC3|-35bit 52385 EPSON StyIus800tg’Density range is 3.4Minoua Quickscan 35 1440 DPI Color Ink Jet PrmtersFor35mm slides and negatives28 MB image sizeDensity range is 3.0
Agfa StudioStar14 inch scannlng surface600 DPI optical-30 bitDensity range is 2.65
Granvllo
Eye
Candy
now
available
Agfa Arcus IIBest descreening Software. ' 4 x 5 m32.2.2.1: :’:.:;°::;äfi‚°‘* 9AM—5PM 13,122 ArtpadsAgfa DuoScan 12 X 18 D0 hat buy anythlng alsoNowavailable -and at a great new price_Density range is 3.3
EPSON mk Jet Professional Photoshop Scanning Seminar
Tuneflp Three hour evemng course&_
Next class IS In MaySPGC|3| Call to registerS40 - i S75
AGFA Minolta Polaroid Wacom EPSON203 1836West 5th Avenue -Vancouver -733-5702
Corel waitingfor Sun to show
0 0 ByCHRISTOPHER GULY 0 0
Conel Oflice for Java suitc includes CorelWordlbrfect, Corel Quattro Pro, CorelPresentationsJnjbCentr-al,and Corelcbart.The beta version can be downloaded at noCharge through Corel‘s Weh site(httpz/fwwwcorclsomf).Accordmg to company offlcials, thou-
sands took adväntage of that offcr the dayi: was made avallable (April 2). Another8,500 developcrs „attendlng thc JavaOneconfctence in San Fmncisco the same dayreceived their own versions on CD-ROM.By Summer, COIEI hopes to release the
commercial vcrsion of thc suite. At thattime, the Ottawa-bascd company hopes tobundle the package with Java Studio,which consists of rcusable software com-ponents known as“Java bcans” that can beintegrated to cerate a complctely cus-
« MOREL« „z » w.
Banking on ]ava’s popuIarity‚ Corel Corp.recent1yreleased the first office suite written specifi caliyin the aH-encompassing programming Iangauge.
@ ‘ 7 =@Ü ä@Gääfiäflwwwmltranencallnteractlnn
CATIONSCOMINGSOON.’
tomized application.Developed and owned by Califomia-
based Sun Microsystems Inc., Java wasintroduced into themarketplacetwo yearsago.Although thc programming languageCan be understood by any Computer run-ning on any System, reading it requires aCode Sun offers through Internetbmwsers.The existing Java-reading codc could
pose a problem for Corel in the future.While it can decipher Cortl’s Oflice suiteduringbeta testing, it won't be able to rcadCorel’s more sophisticated commercialVersion.A ncwly updated Code, however,whlch Sun is working on (Iava 1.1),will.As a result,Corelwill have to sit tight on
the commcrcial launch of its Java-friendlyoffice Suite until Sun i5 rcady to release itsncw browser. O
cpntinued from page28SmaIl-buslness Ofice opensMicrosoft has announced the availability of
Mtcrbsofl Ojfice Suite für 5mal! Business.Included are Word 97, Excel 97, Publisber97i Outlook, Automap Streets Plus, andInternet Explorer. Suggested retail price isS609, or upgrade from S549. Contact
' rosoft at httpJ/wwwmicrosoftcom/Pocket your CD-ROIVIs31011 havc pmduced ncw self-adhesive pock-etsi for can-ying CD-ROM disks. These clear,d
1
blc slceves easily attach to folders andnotcbooks and should be available throughofficc supply dealers. Contact 3MCanada at(51,19) 451-2500 formore information.Plfdtlng up the pace
1 ple Computer has released QuickTime3.
‘for Windows and Macintosh. QuickTitne
Offtltrs the ability t0 capture, edit, compress,an playback digital media. Formorc informa-tion,visit httpz/lwwwqtxicktimeapplexzom/HIbh-voltage Web graphicsMicrografx have released Webtricity, a
rolfiust graphics Studio for professionalWcbdcäigners and Weh cnthusiasts. Wbmcityoffline advanccd GlF and JPEG supporLWCbWxzards, common colour palettes, advancedimägc mapping, 3=D animation, and digitalwajtennadcing, it can-ies a retail price of8219.95. Call Micro-gxafx at 1800-3608464or jvisit httpM/wwwmicrografxcom/ formoie details.
Flne printersEpson Canada Ltd. has claimed it has dou—
bled its cun-ent inkjet nesolution Standardfrom 720 to 1440dpLThe Epson StylusColor600 and Epson Stylus Color 800 both featurea newMicro Piezoprint head,QuickDry inks,andAcuPhoto halftoning.For morc informa-tion.contact Epson at 1-800-463-7766or visithttpr/lwwwepsoncom/Hot newWeh pageshttpzl/www.scacom/Third/hch/SCOUNIXgut-Lissltouldbesuretodteckout
thissittzwhichisanewdynmnichaxdwarc-compatibilityWeb site for SCO UNIX tesellcrs,integratots,dcvclopers, and end usets.
httpz/lwwweaglewingartcom/‘Thjs is the home page of EagleWmg Indian
Art, an Intemet-based gallery that cteates part-ncrships vvith artists and collectors specializ-ing in handmade Native American art andcrafts from the southwestemUnited States.httpzl/wwwcyberfiber.com/news/1111s is the CyberFiber Newsgroup
Directory, Where Usenet ncwsgroups areavailable on or offline. ‘
http://observe.iw.nasa.gov/Did you miss the “Comet of the Century,"
Hale-Bopp? If so, be sure to check out NASA’sObservator-ium for cornct pictures and infor-mation. O
"frnnom IIoifPgntium Systemi’MMX Readyntel Pentium CPU w/Cooling Fanriton l1ChipsetMBw/256K PipelineCache
„ nBoard2xEIDE,b<FastComPort,hanoed PrinterPort&FloppyControiler
8Mb EDOMemory3.2 GbHardDrive (Mode4)1.44Floppy Drive
ä‘SVGA ‚N1, .28dpimonitorlIWdeo cardw/1MbMemory (exp. to2M)
13"minitowerw/230watt powersuppiy104keyWin'95Keyboardinouse&padAMD K5-90 . . . . . . . . . . . . . 3858X86150+ . . . . . . . . . . . . . 5948-100 . . . . . . . . . . . . . . . . . 3938P-120 . . . . . . . . . ‚ . . . . . . . 3948[-133 . . . . . . . . . . . . . . . . . 3988P-150 . . . . . . . . . . . . . . . . 31008117-166 . . . . . . . . . . . . . . . . 311880-200 . . . . . . . . . . . . . . . . 51438
Priceson a l lItems!please
WeCarry Computer Parts& Accessories‘e d0 TRADE-INS too1Systems comewith 2 Years Pans &__bourWarmnty_ prices are subject t0 change without notice.
WeSpecialize in: PCUpgrades &Repairs,Installationof
Low Soflwure,CDROMs,&Modems.
ca l l
Zoltrix 33.6 Fax Modem . . . . . . . . . .589ACER 33.6 FaxModemw/voice&speaker phone . . . . . . . . . . . ‚s1Acer 1e bit Sound Card PnP . . . . . . .53813'Tower Case w/Power Supply . .
ä * äääflifiä4NQ
2 BRIDGEPOHT
ST.
EDWARD
SHELL
ROAD
BECKMAN COMPUTER170-10400BridgeportRd,Richmond,BC,V6X 3R2 (Entrance at Beckman Place)Phone: 303-7982Fax:303-7983Open:Mon-Fri 11-7Sat 11-6 (ClosedSun&Holidays)
0 COMPUTER PLAYER! > M A Y 1 9 9 7 D http://www.computer-playencom/
#45 E. BroadwayVancouver‚ BC.V5T 1V4TeI:(604)875-8859Fax:(604)875-8611Tech:(604)879-6800http:l/www.atic.ca
Sportster 33.6k Voice int......Sl35Sportster 56k int. o/r „5205/240Sportster 56k ext. ...............„S265Sportster 56k int.wNoice....S250M0torolar33.6/56k Voi...Sl45/200Cretive 33.6/56k voice....S90/Sl60
MOTHERBOARDS
Slnce 101989
Intel P5 l20/l33...................Sl40ll80Intel P5.l50/l66/200.....S2l5/3l0/380
www.at:ic.RM72bit: 4/ 8/ l6M...... .....„530/56/9872pin 32 I 64M...................„5198/530PaI-ity 72pin 4 1s116M....S4s1801130Pdi-ity 72pin 32 164M.......„82551580
Vancouver
PIIÜII SISIIIS inIntel P5—120I133......5950I980Intel P5--15OI166..51050l1160Intel P5--200mhz..........S1380Intel VXpro 512k Eidc 2S‚lP,I\4Iv1X Support16MEDO 72pin 60nsFD 1.44, 12GB eidc HDMode 4PCI 1MB SVGAw/MPEG14” SVGAMonitor colorl3” Tower casew/power104win95 keyboard3 buttonmouse w/pad
i: “e! ASUS Intel P5 MMx166120o.......„S395/660 'n 1M14M .....................„S10 129‘. Intel P6 l50/180/200«-.-S250/560/695 D
I16I 32M................„5110/210 "x
IntelATXMarl 2 512k USB MMx„S160 Intel PentiumII-233/266...S1190/1290 DIMM 641128M .............S485/1250 |nte| P5 MMx 166___„„‚s1695IntelATx Tucson 512k SBl6.MMX.S250 Intel PentiumPro 200/512k....„S1380 sDRAM (10ns) 16132M„5110/225 |nte| p5 MMx 2oo________51940IntelATXVenus P6.........................„S235 AMD K5 75190/100...........„546/60/83 '
ECCDIMM 32164M......„S225 1570IntelATX PRO Dual P6‚UWscsi....„S710 AMDK5 I2011331166.....S9011001170 ECCDIMM 128M ................„S1460
" " "
Tyan Dual P5 15121:AT...................„S330 AMD K6 MMXl66 1200„83801580 soJVideo RAM IM ...............„S15 IntelHx Malz 512k Eide2'575,"Iyan1131231726133"113151.;
.......„S4323
IBM 6x86 15011661200...S125/1651215 5 „M EDO 72m 60ns=
S|IS . ......... .Am Hx 5 1 1 m mAT,„x 5185/195 v‘DEO CARDS MONITORS FD 1.44, 2.0GB e1de HDMode 4
. PCI s3 3D 2MB SVGAw/MPEGCA HXSIZ MNIXAT......................„S160 SVGA 1499/1599/17”....."5220/310/540 15„ SVGAM .t lT2 512kMMXAT ..........................„SIÜÜ :« ‘- AC6‘. 1599/1799 17„ATX T
0m er c0s aceWalker 555A’5l2kVX,k5 k6...Sl40 . „
»""""""""""" . °"’°‘“ a ”“’ P°“""
P11’: ( P ö fl m mmotheflmrd’ 5550 9 Ü m m »m MAG DXIST /D700T......„5450/785 104Wln95 keyboard""""CL 5440 1M / 2M __________________S30 [45 C500/M500...............S445/5l5 3 buttonmouse w/pad
HARD DR|VES CL 5445 1M 12m /4M_______540/55/70 NEC XVl5+/XV17+........„5590/950( l2 0d _d S125)’ ‘ N .............. X ‘P001 01 0----------------+
555m1..- ääliäiääisäfi7äzzz:::zzz::::äfiä 5.5.5 0323535?............532363513’ 1331141133355__________
.533),1.311.76...... ..................S225123s ATI 3D 2M / 4M -----------------4590/170 Sony 200SX/SF----------------45900/980 ' °'°° m " " ""+
2.012.5 ................... ....S2501300 g;i113 ghCZfiEQ/Ijfivflä-{g-gfigggg Sony 17SE2T/20SE2.....Sl200/2450 “m”“a m ;----------------"+5150Quantum 1.212.lG.......S245/278 r0_ r 0 o- sunisang Iscie/Gli...........S4301470 ’ü. P sQuantum 2.5 / 3.2G......„5300/340 31T]älhnglvgälenzgM sumsang 17 Glj/Glsj_______„5730/950 a IQuantum 3-8 I 6-4G-----„5400/530 “I”? H413? ä).
-----"5195/265 ViewSonicl5GS/l7GS....„S4401780 |nte| ps 1501130___s1330/1090WD ..... l ennlum (l-e‘ 10"" Viewsonic
wD 15 /3_1 /4_g_______531o/340/45o Monster 3D 4M retall..............„S340 ‚ Visonic 1,810,815 "älgm/zßo-----------
Seagate Matelist 2.5...............S320 FIreGLl000 613000 301-56500500opfiquest VGGS/Vwgm‘ 5660/760 ggägägfiofiilpfimfl
ATX
833:: S C ÄNNERS Nalnao /Mitsubishi/Panasonic/IBM.. FD 1.44, 3.2GB cide HDMode 4Quantum 4.56 Uw scsimsuso HP5P/4C.................S520/1000 äß MXS‘“1“°3D2W“MPEG
Quantum 9-06UW scsi----„S2200 Microtek E3/E6........„5290/650 F’R|NTER3 ‘ÜATX “ w ”“S? ‘WATX P°“’°‘Seagate4.3/9UW scsi...sll50/2480 Microtek 156,3013„„s370/19s0 F“J‘FS“ 8725 104“m95k°yb°m- - Epson Es1200c1ProS990112s0 M äfisfi’: “ m ”“ m ”M?“
Panasonic PC-DVD, DDIJOHTÜ, RCHSYS Illfillity CCD...SS 8SOÜWGHI’, etc. ........... P lMUL-nMED|A gt/gxägggg/zosg/gzgxgg Tyan Dual P6 systems
f’: _ n „ HP T1000 I E (800M)....Sl60/l98 i
4V /5S_ [3630 Tyan Dual P6 ATx sysfgms„. HP T2000! E (2G).........S2l0/265 H!’ I --------------;HPT3000 f E (3 2G) 3250/310 Amcessary f0!‘HP .. ln stock ASUS DUal Systems
16bit sound card ................„S30 ' " " " ‘
HP T4000 1E (4 G)........s4701520 Intel Dual P6 systemsDitto 2G Traven i/e.....„5200/250SoundBlaster 16/ ide....„565/68
SoundBlaster 32pnp.........„S110 .Awnwonvisnio------------4240 iää‘fi‘f„‘ä"ii.f‚’ä‘ififf:gaaafää Eäfiääääfiäßäißäöiääflfäää NETwoRKsAWE“6 ° “(‘Mm---------“S30” Zip disk /Jazdisk .......„818/110 ‚i
°
m m “m fl m fl m 536,395‘, Bilrother -16bit isa comb Ethernet...........‚.535CD‘R0M "
Dlgotner HL730DX 660....„S480 ffibiflfgfSmfofmem“----------
8 , 1 m eine_______________„5110/130 CAMERAICAPTURE B ther HL760DX 1200....S590 ",2;‚G,„f;1„o:::::::""::314o16x I18! eideu-------------5165/220 Miro DC30........................„S1350 B.m" "L125""""""""‘mm0 „3coM PCI 36900 oomb M512512x /16x scsi................„5230/280 Casiopc Came‚.a_ 5530 o“ 3coM pcl 3c905 100B___________ „S12516xTeac scsi......................„S360 Km!“Dem________ 5730 _ BNCffenninator/‘T..........................„S3
D wmTER „m,___________________________527„ -S i Ins23g gigggq;......‚.330 „fioxal
1011120105011............515120135— - us l ........ ub Sport /16 ort .................. 98/190C US“V m " F" """"""""""S285 s lus 800 (l440dBi)......„S580 -Novell Usersps 110 .......„500011500
Panasonic 4x2x /ctrI/sft......S560 L: k NT4.0 Server 5 I10 .........S890I1100Creative 4020i lctrI/sft........S580 „exm3|‘ anWkstn 4.0 1lioense........s2so1soHP6020i/e..................„55901730 g 2 Inkjet 2050.....................„S320 -UPS 280/4501600.......515512001340writable cd-disk....................„s8 g 0 tra N 4/16M.....S3880/4920 UPSSmart.600I1000..........„53701550video cd (fashionmusic)......„S8 —tra Lx N+/Net..S3290/3580 ‚
Speakers ‘0 '31ß .-M0usell‚ogitech2B...............„S8118b Controuer l CASEz o? D 0
itech 3B 1Msv2.1A..............S32 SCSI 152011522 ...................„8901966ow1sow116ow..........s2o1221so ö .2m A 113115119123”........„548/53/65/100 PCI SCSI 153512920...........S13s119sYamaha M15.......................‚.595 Q o AIX 17723”.......................„5951120 PCI SCSI 294012940Uw...S24012ssYamaha SubwooferMTl0.Sl35 O h u‘ lMKB/Fujits|l8725/4725...S20/30/60 PCI 3980 Z-chanel SCSi-«-----------5680Alm 52/45500--------599/120/450 E ß 3 M};Natura! lTouchPad KB.....S88l75 Scsi cabIe/Wide scsi cabIe.....Sl0I20
f‘
x„zu
4
nun’.‘—‘Y‘.SHOPCQF O O D SERVICES
(EST. 1 9 9 0 )
IIIIIIIIII
VANCOUVER’S FIRST ONLINE GROCERY STORE iIIIIIIII
d;ho o BySANDRAMINGAIL o o
Vmluxalttalityiscomingofagaltsccnlslikcevery edumüonal pmduct coming t0
matrkct invites IJSCIS to indulgc thcmsclvcs inworldsAll butonc ofthc following titlcs
cntploysVR t0 somc cxtcnt.One flxing: bemermakcsurcyourmanoryclfipsancuptomcdxifllenge!Aapugeom (Softkey)axptom virtual neighbourhoods while you
lcafin about COIOLII‘,light, pcrspcctjvtzand com-'tion.'I‘hisCDcombincsthcbcstofanan
rcfigtcnce üfle along with handswon activitiö.Eaehncigttbomhoodfoctlscsononeancorx-ccpLmmletsyouu-yrdatedonscremgames.In colour neighbouxhoodyoufl lcamhowcolourcanbetnsedtocreateillusionsofligttt.Clitzk on a finnous painting for an explamtionof 110W thc art thoory has bccn appliccLThcntakpaqtfickdctowanduyacolour-nmdngganhe or playwith shadows.Ar! studants will apprechte the teseanfil
of uns tiflc.A dambasc offamous‚arüsts and locaüons mdudcs a conwnimt
a‘/ engineA timelim: fies world cvents t0thctcvolutionofan.
#lO4—17688 66th Avenue, Surrey, B.C.V3X 7X1‚q OVER 10,000HAPPY CUSTOMERS AND GROWING...I BUY DIRECT AND SAVEI BRAND NAME GROCERIESI DELIVERED T0 YOUR HOMEI SAVE TIME -SAVEMONEYI HIGH QUALITYMEAT & POULTRY 7
q N0 MORE LONG LINEUPS!I SATISFACTION GUARANTEED
THE ULTIMATESHOPPINGCONVENIENCEHCall 576-4000 t
‚_‚_—;P
— — — — — — — — — — — —\
ÄOrder by Phone, Fax, or on the InternetAt: A‘-
IglhisCDcamstopmarksforscrcmdesign.www.shopco.ca vssvowmouscremmmusnmsmI __ I realxty scmes, or simply CIICIC on the mdezt toS100.00MlmrnumOrder : qutckiy uavel m your area of interestffim, the
| onfcrcmvidcoguidefisalwaysradytoassist.Ranked 3rd fastest growing company in BritishColumbia by Business In Vartcoltt-‘erMagazine i
itskids’ SoftwareAuniqtxcanduscfixltiflc.TonIiedePaolafs ‘lIIeArtLeson(MECC)T1115 clcctmnic storybook, writtm by well-
loveddfildrerfsauthor/flltlstmtorDc Paohwillappcaltomc pnrscltoolscnüülthmdickmmughthcstorybookpagcbypagxzasfi-imd-lychamctm‘s.Ad1iIdn1ayWisht0ex'pIorEtIhCb0okontheirownlnmiscrasqheoyshecandickonanystorybookpageflnensclectsinglcwordstohat thcm nead aloud-standard täte for mostelectronic books. Unfortumtcly, complctcphrasescannotbecxploredProbablyttxcmostappcalixtgscguncntsofflte
CDarethe lrimactivificschfldrmmncreatcLheir own desigrxcr shccnan onsacctz potamface, or a chalk dxawirmgAll activiücs ncqtfixebasicmouseskillssudnasdtaganddtopor
outyomdxilqäcreafitmanddisplayit onyourfridgc!shortvidcoclipsofDePaolapmvidea
bdfind-flxc-scmcs gtimpse of a pmfessioml a:workwhich isccrtzixx to deligtntyotmgtäns.Onemirxorcaveat—thcprog1an1 isnotmüretylddptoof. It's too easy t0 inadvcrtmüy mit theprogrambydickingonttnewmngspotofflxescrecn -MycityßicGraw-Hillkyerson)Thissimulaüonmpttsmtsaboldmmnve’" ' t0
encourage sodal awarenss and community
TANGENT COMPUTERS i5E39 11%‘ {Z}
0
C)—i
Pleose ccall for lotestprice 0 Features: IntelPentium 166-200MHz
1. 16/32MB RAM Expandable t0 128MB2. 2.0/3.2 GBHD3. 28.8K Voice FaxModem4. Communications Centre5.MPEGWdeo Card 1d6. 12X/16X co-nom “male7. 14"/15"/17" IBMMonito8.Lots ofSoftware
'
30 1MBPCI 64 Bit SVGA Card
f0 15"N1L/R SVGA Monitor0 19"Case/230Watt PS0 MitsumiMouse/Pad:0 Windows 95 Preloaded
r n o t l l l g n
‘0 Powerful 100Watt speaker—Standard 3 Year Express Exchange Warranty-Reliability and Ouality You Can Trust—Easy 10Learn and Use ior All Human BeingsÖFeatures Depends onModels
0 1YearWarrenty onMonitor.Keyboard.Mouse.Speakats
Weofter competitive prices onall IBMComputersIBMandAptiva areregisteted trademarksoftheIntemationaIBusinessMachineCamomüm (Prioessibiecttodtaltgewimatnmtice!)
N E C ('93Intel Processor dealer
Excel -ValueTangent MultimediaPentium 133 System
for S1888
Latest Pentium HXMain Board5o16MB EDO RAM, 512 KPipeline Burst RAMi0 1.7GBHD, 33.6K IntFaxNoice Modem
i0SB16 Piug &Play Sound Cardi. Japanese 12X Speed CD-ROM
0 1997 Encyclopedia CDBundle
1 2 Years Parts and 3 years LabourWarranty‘ Prices subject tochangewithout notioe
Ouality &Service is nur Name!HEWLETT’‚ n e n n e 0611011
Authorized dealer Authorized dealer2221 West Broadway‚Vancouver, B.C.VSK 2E4 (Free underground parking)
Business hours: Tue.-Sat. 10:00am—6:O0pm‚Sun: 12:00am—6:O0pm;Mon.:Ctosed
Q COMPUTER n u n : p M A Y 1 9 9 7 p inttpMlwwwxompwuter-player.comli
(e04)797-99189 Fax: (604)737-9923
The TechNomad Tour:Thp
o o ByALAN THWAITS--Like one of Tolkiexfs hobbits. I’ve embaxkedon a journey thatls takenme a longway fromwhere I began, and that will hopefully be abeginning for others’ journeys.As with any journey worthy of the name,
planning for theTour has involved almost asmuch effort as will the trip itself.The TechNomad Tour, as you’ll remember
from its introduction in the December issueofCPI, was designed a5 a testbed “self-poweredplatform with remote access capabilities.”Geek jargon aside, that means (hatI'll be send-ing and neceiving e-tnail and digital imageswhilc on a tluee week, 2,000 km cycling tripthtough Omario,Quebec,andNewYork State.Using a palmtop Computer,a cellular phone,
a digital mmera,and powering the whole sys-tem with a solar-powered battery eharger, I'llbe C..nada Computw! bicycle-based rovingjournalisgfiling articles to my editor asweil asupdating the TechNomadTourWeh page (seeInfoBox).Mobile,connected,andunplugged-workjngthe Netwitlnoutanegifyouwill.All together nowThe techno-tools I’d originallyenvisonedas
forming the “engine” for connecting withhome base an: still the sameWhat Pvc beendoing in the months since theTour ideawasbom is getting those tools to work togelber.ThecmtteofitallistheteamofaPsion
Scries 3c palmtop Computer and a MotorolaDPC65O cell phone. Psion’s new PsiMailInternet application is the Software enabler,allowing me to send and receive e-mail with
im.
Ioad goes ever onelllciaclgoes ever on and on
‘Outßftom the door where it began."Novi- far ahead the Road has gone,
thvertpfollow it who can!fthem ‘a journey new begin...lL-Tolkien, The Ilaad Goe: Ever an
photoitmgesasfileattachmmtsfirmmypalmtopßeftxrelsendflloseimagesfllneedtomove them fiom the Kodak D625 digital Cam-etmviaaserialswzppingadaptormbkztoanSSD (SolidStateDisk)stomgeuniton thePsion.To dial up my PsionWorld access provider,
I’ll be using a Motorola PCCI (PersonalCellular Connection Interface) unit betweenthe Psion und the cell phone (necessarybecause the computer is digitally based andmy cellular Access uses analogue lines),and aMotorola CELLect 14.4Kbps cellularmodernrunningon a PsionPG-CardAdaptor.All of the above goodies run on battefies,
mostlyAAs‚with a seattering of other types.I've replaced the cell phone’s lithiumbatterywithaöAApaclcthe PCCIunitrttnsona9volt lithium, the DC25 camera on two 3 Voltlithiums.Because running a modem connec-tion on a palmtop Calls for a lot of batterypower,and because part of theToufs philos-ophy is to be “off grid," I've eschewedrechargers and AC adaptors in favour of aSolar-panel-powered batteryChargenUsing batteries, throwing them away, and
buying moxe was rejected out of band 2s
being environmentally inappropriate.Solar flairThe story about the solar-pancl System is
almost a saga in its own rightffhars beotuseit’s beingdesignedandbuilt specifimlly for theTeehNomad Tour. Suitable commencial unitsan: available, but the inexpensive oncs Ilookedat wae terribly inefiieient,and the efli-dem oneswere tenibly expemive.Theanswerum to buidamitumwodddo the
5L”- l
l.‚.1E‘epombk:over the six to eight hours I nor-
PiemfilMihrxictookmtlteiobgmdl-nsprodnmeda
Option 1 uses a solar-panel set made bySo ' ‚ I t ' s fairly big (l3by l3 inches), buthas ‘
Outputwhenm:by direct sunlight.lt doesn't, howcver,work very well in over-cast eonditions.Option 2 is a unit based on ahighffficiencyPanasonic solar-panel set thatrespdnds to a wider band of sunlight levels.lt willWork even in ovemast conditions, butit is final],which means it's harder to set upto to the sun.Also, it produces abouthalf output power of the Solarex.The‘ charger board that controls the amount
of current and voltage that goes into the bat-will be mounted mderneatlt the solar
paneLso it’ll be protected by the side fiamingandatcovetfllebatterieswillbe inholders thatwill g) into one of the bike’s rear panniers.80th solar-panel chargers will have seen
road testing by the time this issueof
THE TECHMAD OUR
CP!hits the street. Prior (indoor) testing cov-ered Overall design issues (like how to attachthe unit to the bike's rear mck),whetlner touse a low-power microprocessor to controlthe Charge-pulse circuitry (the decision wasyes), 2nd Whether rechargeable alkaline orNiCad batteries are going t0 be the drug ofchoice (the jury's still out on this one).Testing, did you say? My life over the past
months seems to havebeenentirelymade upof testing for theTour!
Boldly golng where no bilte hasgone beforeThe Tour‘s sponsors and supporters have
been both generous in their Support andexpansive in their advice,but the answers toall of my questions haven't always been obvi-ous.'l'hat‘s because no one, to my knowledge,hastriedtodotltingsexactlytltiswaybefore.Lots of touring riders have connected via e-mail while on tour, but they’ve used laptopsand landlinesA palmtop Computer and a cell
üuTulltf[IIIII.
ä ‚man5 Erefiesvis-aeconfiputerp that stems from urjcomrentio'
p:. i; 1
‘ "ulfimate in entencri ’r
ou forfcranggr ‚Level ‘cfhprjgeecgmputing.
Wavetable933.6/14.1r moderno Totalrmage 3D _c Cordless mouse crnd jdgs'fck_Subwpofer
A’
from ‘Super Yeor, ‘S'uper sound, ‘super, e
«warmem. ‘SuperTalk or ‘Super Leaming
v Thurgauo eoox60!o Uprosppmqurpufirv Flug ErPlag reddy" s; __„
p
0 Super SharpWaterproof Black7ink
HomeAutomation.d
n
d
11u
Tukeiddvuhome un Aptivu fromlBM und you're gefiing much more thun un ordinurg cumpuf‘a: ttechnologg und enterluinment feutures it's the perfecf PC for work orpiuy. Ap
rAlefs gou {um lightsund uppliunces on und off uutomuticullg Sogou cun sei up routine. 0
n
0
33114.4modernv Total Image 3Do Voice enubled Hqme Directoro Video Phone,
’
0 3 Year Express warrantyAlnctudääinstructions.isufiwore. one lump module.Töne uppliunce module undi one seriul interfucemodule.
LEXMARKmThe Lexmurk 2030, printer is un eusg choice for greut eilig anno:printing. duruble performunce und convenience. Prado es dgnucolor imuges und crisp bluck text. with its dual cumiedesij”provides‘the convenience ofhuving bofh color und bluc "qgsuciiva;
Jetprinter 2030o Thermul InkJet o 100sheet in-pui imo 600 x300 dpi edge shurpness v Colorf-‘inem 2 Driver} _ w w
o Up fo 3 ppm Output o LexmurkWorkshop" D-ROM Ä go Flug 8 Ptug reudg c PowerSuver feutu ‘
0' -“
0 Windows 95 o I gear Exchangeß
A
NowAtemAfYUR0
DEXTONCOMPUTERS%
> 3112 BoundurgRood e BURNABYn
-"'_u‘Ä'd_Q44433-9866n?
ATECHTecmszonoexes .109.2 cambi" street-o VANCOUVER .
V
0
"
gg77-1s12 604-986“!„mzyzgwm:mc.gwggg‚111’ t1st streetudqg„ny
I \ / I L _ J —ß / I E E C D I / Ä
TECHNOLOGIESANERD FRIENDLY ZONE 5ms: 1992
365WEST BRDADWAYÄ L L SOFTWARE LIETED I5 NEW A N D FULL VERIDN
NERDZ ZÜNELinuxApplixware (NewVersion)Autocad Super IjbraryC++ Super ljbruryCaldera Open linux BaseCICA (2CD's)CH rtHeaven Il8:BockC or Clipart ExtravangazaFree BSD 2.2ExportCollection ClipartHacker Gironicles 3HOBBES 05/?Linuxmousepads, t-shirls, etcHTMLColorClipartDelphi PowertoolsLinux BibleLinux Developers Resourcel.inux in a Nutshell BockLinux Journal MagazineLinux Programming BoakLinux ToolkitMidi Collection 97MonsterMedia i7NightOwl 23QRZ Ham RadioRad Hat LinuxOfficial 4.1Linux Red HotArchivsLinux ToolkitRunning Linux 2nd EdBockScience &Technical Lib 8:BockSimtel DOSSimtelVlfindowsSlackware (NewWsual Basic Super LibruryVssual Basic ToolsW|n95.com (4CD's)
It's Not Just for Breoldast Anymorewas»
IOI DalmafionsAlgeBlaster IllAnimals ofSandiegoZooArthurs Birthday SupriseArthurs Teacher TroubleGormen Sandiego JRChemistryCrayola Art ShJclioDKDinasaur HunterDKEncyclopedia o5ScienceDKHistoryofWorldDKThe Way ThingsWort:DKUlfimata Human BodyDr. SuessABC’:Dr. Suees Green Eggs&HamElmos Preschool ‘
Freddi Hsh #1Freddi Fish #2Harry8:HouniedHouseJames Discovers Matt:Jumpstart FirstGrade‚lumpstartSecond Grade‚lumpstartThird GradeJumpsturt FourthGradeJumpsturf KindergartenJumpstart Toddler
Just Grondma &MeJust Me&MyMarnKidworlts DeluxeLittleMonstarat SchoolMatt: Blaster llMatt-nMuster (Trig‚Calculus Etc.)Matt-i RabbitDeluxeMathWorlcshoMavisTyping/äuess/AtlasMixed up MotherGooseMuppetTreasure IslandPüiama SamPhysiuPlayroomPuttamGoes to the MoonPut? FuttGen to the ZooPult FuttJoins the Hzrude —Reader RabbitlScience Biester JrSheila Rne the BraveSmFarmSimTown V
Tonka Construction-IfitETonaisefithe HarnToy Story
'
iieasuie GalaxyWord Biester?'
3D Ulm PinbdlCmepnigfttlitt!HourL _ I I
PHnNE e72 -näanEWL
EAMES
PRDDLIETIVITY 54 M.“Ouhhm‘:Cwsstime Saloon
Adobe Illustrator’ €22)’, Jlclxmes8:Duncnr:Anthology
Adobe Photoshop 4.0‘ - 7'-Adobe Pagemaker 6.5’ SoenaimBorland C+ + Ver 4.5 Civiizfllio" HT00“?Borland DelphiWin
Click|art65,000 pic’s
Core Draw 7‘Corel Otfice Pro‘Conel Printhouse am „gh,CmmdCorelWF‘ Suite’ Destruction DerbyllFirstAid 97 Übbl‘?Lotus Smartsuite 97 m?"McAfee Anfi—Virus 3.0 nur; NukemanMS ’
3a‘:Eulärnmutonium' l U I) "I OÜIIC
C52Öifinhääfifpm» 0"“”"""“°°MSVisual C + +'MSWindows NT4.0’MSWord 97 ‘NortonAntiVirus‘PartitionMagiePrintArtist 4.0Quickbooks Deluxe 4.0Quicken Deluxe 5.0Quicken FinancialSuite
‘findarlicorradmedpudrngingseom
C- mand G:Conquer G:CovenC mand E:Conquer ToolsDoggerfulDarl:Eaflh
FlightUnimiiedWin 95Fl ‘ CslniimgrellGnomeHeines d MigirtG;Nlagic llI04 lndepmdence DayIFQQImperiumGulodicumREFERENCE
Leisure Suit LnrryColledionLeisure Suü Larry 7U9Linz: l5LodeRunnerLordd lhe Reulm IiMIA?AbmrnsComptods Cook Bock
Comptons Encyclopedia 97DKUltimate SexGuideGroliiers Encyclopedia 97Grollierx Encyclopedia of SciFiInfbpedia Version 2.0Land Designer 3DLeamjo speal: Chinese Monopdy
Monly Python HolyGruil
W Python CompleteWusteYS’
Napoleon 8:RussinNcsmr II '
NBA97Need I Speed 5ENeed f:Speed Il
C2D R D M KITS
60-80 Watt SpeakersSoundblaster I6 PnP soundcordComptons 97 EncyclopediaClwessntaster‘4000‚MclvisTyping, USAtlasWorld Atlas12 SpeedKit 52198Speed Kit 5139-32094 -öSpeed Kits SCALL
HARDWAREJBL Subwoofer (Avail. Fordemo) I2980Watt Speakers 29Creative Labs S816 PnPCrealive LnbsAWE32 PnPl2X Ploneer or Panasonic8XVarious Brands4X8; 6X
R e s e l l e rI r b q u i r i e s‘ fl / e l c o r n eTaummbannmflyngugudh In nnlaofcampunrnlandpmdlsßaadhawaPST#.Doclor Prico Es!Avuilablo
Mnnday-ThurulaySatnrday
EDu:aupmc man-ahn- ln .95anlmuiplufivhmnolbtmJlown.
11a‘:p-icdinsmart-da:d1pnviom
10m610m710m6
' adpiulübmdixabjxrlodlmgcw‘ noücc
tinued from page32amongstyouth.It is somcwhattation,howevcnThc playcr assurncs(h6
while adcqmte popularitymfiräsandrcsoutccsofgoldbamandvolm}was”. (bopcmfive gmup play is encouraged in
i
rofostcrdiscussimofiwlossixkcy topics'
lorod: culture, education, etwimnmettt,IegLand social concenns.viewmini-erxacnnents of 26 animatcd
‘os. For tnstancc, one scmc dcpicted aa park setting,who whcn askcd to snapne‘s picnmc, stole thc camcxa and ran0E
wi an accompliccA scrics of “dccisions” amp ted as the story unfolds. Players mustscl
l
a dccisionanddrop i: into thc chompingof a machinc.Fach dccision afiects the
'
’spopularity xating.issue presmted inMy City correlates to
l
e Rights of the ClhildAlcohol and drug‚bullying, gendcr equality, pollution, and
" an: dealtwith at a ehilds [evtlofunder-u’
‚Onljncarticlcsallowplayers toreadtional solutions t0 similar issucs.is little audio guidance to helpdnildrenWhat they see. Oonnections betweencomponcnts will takc somc fimc to
enßepreparedto read through thcrnan-
I or Labs (HoughtonMifflinInt: actlve) ‘
I ‘Labsgocsagiantstcpbcyondmcrc-
ly ting biographical on thrcc fizmousors.Visitors to thc labs step foot into the
opcVicwcr to vicw somc of the invcn-original films. Or operate Watfs steamor Proportional SculpturingMachine.rs role-play these famous inventors amidst
‘ ts and sounds of their laboratoriesAIsoed an: over 100 historic films, pho-hs,Original rccordings, skctchcs, and per-notcbooksThc mvcstipüons azca allowsvisitors t0 conductcxpcrimcnts in variousindudingflight andsoundRcscandlficnchpreciate the dctailod timclitlc.tent is comprehensive and user involve-high. Thjs titlc would complement
oooeoooeeooeoooooooooo
coiltinued from page33phonc? “Can't be done,"the scoffers said!E Kodak's enginccrs had their doubts-alth ugh thcy cxpxvesscd them very politely-abo how Iwas going t0 tmnsfcr imagcs from
25 through the Psion to the ccll phonc.‚"thcy said,“you'll nccdat l as t a laptopg Windows 3.1 and a CD-ROM drive
solar-pancl gurus I consulted suggested- ps I might need somcming a Iittlci
thanapanelthatwotfldfitonmebadrof
‚ 0W thatmycolleaguePierreonce askedif PCImind covcrirxgmy hclmct and thc shoul-dersjofmycycling jacket with solar ccllst).Nqvcr nfincLThc “bcnch tcstfanc OVCI; and
thcyl suggst that thc project is man: than
3 COMPUTER PLAYER! v MAY 1997 > http://www.computer-playeucom/
I
schoolwork science and technology.
LogicQuart (The LeamingCompany)This is a goodworkout for spatial percc-ption.
mapping skills, and dccision-making. Set inmedicvalümesJtüsCD pncscntsa scricsofmul-tilevcl games. Playcrs must cxcrcisc classifica-tion ruleswhile navigating through a world a1m a ß . Collect hiddcn coins, asscmblc jcstctsand qucens, and unlock to (‘h6next level of play. Cleverty dcsigncd, yct prolongcduscmay becomcA morc cmcativc componcnt of this CD
cncoumgcs budding anchitccts to constructthcirownmcdicvalworld complctcwithcoun-yards, archways, andmusical scoresAdd sccmpancls. door switches, bats, and chamctcrs t0fashion a 5D gamc of your own.SlmTunes (Maxls)SlmIimes is a highly creafive combinafion o!
musicandan toolsRcmcmbcrthc plasüc boarcbwhexednildrenplugmdifiätentcolomtdpcgst0 cmatc pictuxts? Imaginc that in cloctrorficfoxm with each differmt colour rcptescnting adifibmnt notc on thc musical scalc.Now add agoogIy-eyedgroup of animateclbug,eadl xtpxt-sentingadifferent musical instrumenLSetthebugslocisc onyourvisualcrcationandyourpic-
Popup toolbars oflier everyttürxg fmm graph-ic stamps and spray cans t0 advanced mcnuswith a choicc of l 1 differcnt scalesNomusicalexperience nocossary-just an attitudc for fun!111eGreen Files LifeSdenoe Hysterie:(Corel CD Home) ‘
‘Ihcrds been an envitonmental disastezi- on ancarby island,and it’s you:mission t0 conductexperiments on plams and soil affcctcd by (bisevent. Board the BlueWhalc ship and take onthe challenge 2s you movc bctwecrx the office,lab, diving anea, and storage mom. If you necdhclp, simply dick on thc intcncom. Or visit the[gam Zone, an online cncyclopedia thatindudcs games, animations, and badcgtomtdtcxt tequircd t0 completc you: assigrxmcnt.Graphic design is crisp and uncluttercd.
Instructions arc gcncmlly clcar and well-sequenced It‘s easy to get stuck at thc cnd oIthc mission, however.More onscreen promptswould havc been helpful. Scientific conceptsan: basic but adequate fot beginners. Junior-high and high-school students will appreciatethc glossary and background data on the struc-ture of cclls and thc cfibcts of thc cnviromncntonoxganisms. O
doablc. Now [hat decent cycling wcathcr hasarrivcd, it’s timc to move t0 road tesüng-btm-dlc all 111c techno-tools togethcx;putfioodcaok-seganddothcs intomypamficmsuapthcCampingequipmmtandsoIar-pancl systcmontotherearmck-and taketkxeshowonflxcmadFlndlng your routesBut where?Weil, thafs bccn thc otber part
of thc prcparation for the Tour! Since Iatefa1l‚I've becn writing away for cycling mapsof faraway placcs, and using them to find aroute that Will ptoducc (hat ncar-pcrfcctcombination of good road surface,minimaltrafflc, and spcctacular sccnery.In this rask, I've had lots of help { mm frimds
and cycling companions on thc Nct, particular-ly on a mailing [ist to cydotourirxg.Wdve covered everytlting from what kind ofaovctolßcandwttattocookonintowbefller
Running old DOS games
ZISIHHUAlan
tastmormwcstzrtcdlookingathowwemrxmakcWmdows95workbcuerbrnmningDOSprogramy-whidlformostofusmansgames.MostncwcrgamcacvenifthcyhstillDOSprograms,am vcry coopctativewithWm95.butyoumaywanttonmsomeofthcoldchsics(cithcr your oid favoxitcs, or new purchasöfmrmttnestotßbtndgctmtks).SuchgauncsmaynmhappilymaWm95DOS
sessionmbut far too many makc specialdcmancisbcbrtthcywillnnhcanbedonc,howevcr’Mfllerekthekon?Wmdowsprogranmstypiallyindudcaseuxp
orlnstallprogxmnttragamorxgoflmflmmaddsanicontoWm3.l'sProgt-amMamgcrorWm95’sStart Menu. Newer DOS gamm any d0 thc
somekindofixistanpmgxamtooopyfilesmyomtnrddrivcarxddmoseasoundmmflneytunflyrbtftaddanicontoWmdowsJeavixxgyuxwiththeneedtognwDosfinrlhcWmdowskflNcomimndxarxdtypesomepeculiarßoscommandmephmsetostantheproglzm.
Ifsnotvcryhardhowevcagmaddanioonwthemndowsfi SurtMmufordmscpmcs.Hcrtfsoncwaytodoit-Right dickon an musedmi ormemk
Bar-thcspaccmdaerigiatoffllesmnnmuYouflseeapopupmermcidronnopcrflq.‘lhis yrsyou a typial tabbod diabguc box-dickondacstznMmuPxogtmmtab.ochoosctticmldopfionbydidchrgonflle
bunorflhbstxrtsxpawmtdwhichxksytmquestionstommnntcdrproccsalätsnyouflbcaücdbracomnnndlmczdleDoscommandtoslnrtlhcplogtamlbraampkzifyomgmcwnsirxstnfledintoaCAGAMEdircctory,andyounoedtotypeGOGAhaEtostaxtigtypeCAGAMIAGOGAME 2s Ihe comtmnd Eine (ifyoukcnotstncwhattotypqyxmmndfickontheßtowselxmnntolookatymrlntddrivc).GickNcxt.vYouflbeaskedkx-abldcrbrflnestnoncut
(StartMenuiconsareanmplßofWm95shofi-cuts), 2nd gtven a uec-diagmm Showing thcEoldcrs dm makc up the submemß ofyourStartMmwsProg-amgroupXoucoukldnbbdicktomidittotlx3 bldet'thax ahmdyexistgadd it to anothcr astingfoldcnordickotxflxcNcwFddcrbvmon.-Ncxtstcpzgivetheiconaname,andpickm
iconfromttnesmndaxdiooncollecticxxflnfisit,youicdonqyourDosprogtamotpmenowhas an ioon ofits own,in yourdnosen StartMmugoupfiiveitatrycümaywoflgtmmm
—-HVIMDFHÄIHVSS‘:ßJHlFlFflEHls;:E2FM—637 East 15th Ave. (15th 8; Fraser) Ph: 873-5900
MON -SAT 11-5 PM
BLOWCQUT PRÜCESUMultimedia Systems
P1@@S699
PÜS3S999
Pfl®@81299
* COMPUTER STATION RENTALS
486 Systems Starting from S199Modems 33.6 win modern voice/fax S75Speakers 60W S19Sound Cards 16 Bit PNP/3D S32Video 1 MBPCI Video Cards 529Monitors Magnavox 14" NI.28DP| S260Floppy Drives 3.5‘ HDD S25Keyboards 105 keyWIN S18Mouse 2 BTN Serial S9
3 BTN PS/2 Logitech S25540 MB S1484x CDROM S85
RENTA 486 SYSTEM FOR S150/MONTH
http:I/www.compuuppgäuayeucom/ 4 M A Y 1 9 9 7 4 coururen nnen: Ü
in Windowsmitmigtntnotlfmitrmyneedexpanded‘z rxOrneedwnmmMS-DOSModC.
DqsprogrunsalndexpuudedmavnorysüneDmploflflnsneedwmfledapmnded
trähismmmrgflhiswasawotkmmmdflntk:ddfirDosoomputusamcssuxxemanoryd-nn
ooufndomybeominedwmaspecaaimmwmboaflttbutöflöorhwroomxnnusfindtxfingany-dinfgttntannmWwflcanannkeitfiomirsstmkofnxxenormcxtctxdedmemoryIfiytxfieuyitigtonmsoflwmeflmqaedfical-
lydmmadsaasmenaorymnsxessorodmorStaifTtcICTheZSthAnniVCISarxbx-onlyaßwamdngnntlyanmplcsüqounccdmopcnthcCAtONI-‘Icisvsfilemnompadmxdmema
:\ .B(ENOEbdSGf„cbtfthaveflmclincgatflfllcnflAndfiafld c t a i ß ) .
qhangc thc EMM586 Iinc t0 rcad:neyice=c:\ 386.1-:x15 RAMlOMIIhßwiIlptuvidclMBofERaSmcmorylfyourpmgnaminsistsonmorcfihflsmmdungcthcämnnbcratttnccrxdtotttcamonmtyoursoft-
Chlysetlqpßflflößtopmvidclflwsmcnmryifyouhavesoftwmettntdanandsit-domg’sohkesawayfiomtbepoolofmanoryflnrsavalablctoyomoflnaptogtmns.Nfixtmonflgweicgomgtotrytofinishofi’
ark.
11.i:411
95-——misscficgandlookatlhcmyswticsofMS-DOSModcskndyouthotigiatwmdowsßmsmirxgtomakedxingasieflmcunflgitdocs-ifyouthinkthisiscomplepyotnshouldlflvcuieditbcbrcmiowdoyoumdustandwhysomepeoplebotlshtMac-s?)Contactflmlisrnaruatdmgisrnafinitfitbca O
flu1xmhmmumm„_____continued from page36nfinorsmakeserxseonmmirxgbilnqtohowm t m i n b r o n g o o d r o u 1 c sIns becn e-nniled from diese who bzw,
alrcady u-zvdled m: mach I phn to ridc.EvoativedscrimiomtnvemacficmecaymS121‘! the jotmngy-in particixhr, there's oncnfiles-kxxgdnscmtoommgoundmeboflmfllsoftheAdirondacksmmdxeMolaawkwiey_ttntfmlongixzgmrirh.‚Youh: invitcd t0 ridc thc TcchNoimdTourwittlme-viathemmofcourselvxsittheTechNomadTourpagc,connectwith itssponsors, share in the ongoing tcsütng ofthetooisJnndkeepintotxchviac-mailwimthistcchnomadasmcmadgocscvcron...
TechNomad Tourhtnx/Iwwwjpsystemscom/prafislnomadhtm
NanflwvaitsisatedtnologyjotmiaistwfmspeciafizaincompufingarxdorfinesxibiectflecanbereadmedatprakcommGdrecLcomO
Olsoibfs al flis buzzabout die band?
Newspapers. Radio.TV, all yourfriends everyone is talkingabout the excitenrem cf theInternet and you fieel iike die
last person on earth who doesn'tunderstand vmat its all abouL
Like any ‘Intel! gent individual. youdon't want to rush into anylhingwithout some sort of basic knovd»edge, but you're asking yourself‘vmere do I start?'. Let us assureyou {hat you're not aione. Tbafs
exacüy why we've aeated, bypopular demand. nur fiee
‘hindui-h Ihebunt‘senden. Our evening course i5anoverview of the Net, designed togiüe you the framework you will
need t0 make an educated decisionabout going on-line. The best pan?nsam That's rigtrt. absolutelyfree with noobügations. no salespitch and nopressure (von may
even have to ask us ior a brochure‘)
OfcoußeJfYOU-IaieadymowwhatywaredoingmdiustwanttogethookedunaskaboutourTestorivelfwewepefledpc
‘ t fi c fl h fi a h fi ysGGz-«Bayufindommmbuthmrybecause
meseclassesamkeptsnalandfllmqidbt»
h
x-„u unnnuncoaoI
infiulnK e v u n lI reported in a previous column that IBMhad released Fixpak l for OS/2 4.0.When Idiscovered that I could no longer boot 0S/2after testing some beta software (hey, thescthings happen!),1decided that since I had toreinstall from scratchJmight aswell installthc Fixpak over clean codeßlas, all was notWell.Due to limited harddrive space on my
boot partitionJ had installed much of OS/2on other partitions. Running Service fromthc kicker disks resulted in an crrormessage(ondisk 3‚no1ess)‚andIwasunable togetService to work again. Solution? I used theother method of installing the Service packand booted from thc two kickerdisksJ thcnlet thc l-“ixpak automatically fix everything itcould find.Theresultssofarareposifivelhave
noticcd only a few minor problems,and theSystem appears to be slightly fastenI've said it befomc and I will say it agnin-
don’t install a Fixpak unless you need to (o r
really want tol).'l‘his one is nine disks (plustwo kickcrs)andfcw (ifany) of thc fixes list-edwouldbcneededforthevastmajorityof05/2 users.Forthose ofyouwhoaiebmve orfoolish
(likeme)‚youcandownload thc fixpak fromhttpzl/wwvusoftwareibnicom/51g Blue newsIBM has oficially teleased a new Version
ofjava for OS/2.As I typc this,Version 1.02can be obtained from httpzl/wwwsoft-Warejbmxom/os/warp/java/javal02.htmIßMclaimsthatthisversionisuptoöopercent faster,more SCCIIIC, and able to run on05/2Warp 3.0 andWarp Server.Other IBMncws includesbeta Software for
WarpServermaidintheintegi-ationofWndows NT Clients}. new Primat)’ InginClient forWindows NT tool will allowWar-pSerVertoactastheback-endscrverforWindows-based Clients. Free upgmdc dueout this summcr from lBM’s web sitehttpJ/wwwsoftwateibmsomIBM Newsflclter enters betaIBM has released a beta Version of
NewsTicker 2.0 for OS/2.'I‘his applicationprovides up-to-the-minute headlines onyour OS/2 desktop via thc Internet.Download a test copy at httpzl/‘wwwinfo-market.ibm.com/ht3/ntos2.htinBewnrnemitisabetaandsomeuseishave
rtedminor problems nmningWm-OS/Zseamlessly aftcr Installing thls
tiomwhile othersnotcthatit launch-es: (multiple browsers when you select ah ' ej tect your dato wlth Blowflsh
t0 keep prying eyes from "Seeing it?ou can encrypt your data files with a
s‘. pIe-to-use program for thc 0S/2 com-' d Iine: Blowflsh 1.6.The program fea-
filenames and subdirectories,andc
(es with built-in file compression. Best
017211, it's free. Download a copy from mypage (httpcl/Wwwxolorg/free-
/) and be sure to give thc author an e-‘ of thanks.FrüeHTML editorThc popular WebWriter/Z editor has
rectently become frceware. The author‘ tain thc Code and provide technical
d registmtion Information making itto useThe registntion information ise: ‘WebWriter/Z User” Code:
e 2259369460269" (without theltes).WebWi-iter/2 1salso from my free-pagc.
(‘m sure all of us keep sensitive data on‘o hzrddriveabuthowmanyofusdoour‘
a variable Iength key, Support for v
s that he just doesn't have time to —
Hot 05/2Web pagesD0 youneedlotsorosninlbrmation?Gieck
out “Same Fundamental OS/2 (Jonccpts‘ athttpz/Iwwmecnewcasfleediun/tasers/statf/pcter/osz/conoeptslmnl Its pages upon pagesofgteat os/z infimnationwill keepevery levelof wer happxThe often-constilted Web page for ganing
DOS ganzes to work under under OS/2 hasmoved to httpJ/wwwjfxnet/«crcomer/oszgmes/ It has sections on disk-based andCD-ROM-bascdgames,soundcaids,DOSexten-deis,andeven joystidts.Shareware of the MonthCanadats own Michael Shillingford has
released a new PM utility that he hopeswillprove a5 popular as hisX-it programX-flle isan “open/save as” file dialogue replacementthat makes saving and loading data files sig-nificantly easiei: The ncw dialogue box 1snow full-screen in height andadds enhance-ments such as drive buttons,file and direc-tory histories, a launcher for filevicwers/managers,anda button to sclect fre-queutly used directories.T0 run X-file, you will need OS/2 3.0 or
Iater, and registmtion is only CanSIS.Download a ÖO-dzy trial copy fnom thcInternet ITP site hobbesnmsuedu in thcwpsutil directory. O
älMagleflaknimmerSchmaus
16MBRAM, 1.6GBEIDEHerdDrive14"SVGAColor Monitor,N1, .28
Pentiumichi ) I33 (m„d„„„rce„‚-fied, .Memog U fi e (Can‘tnmsome pr4/8/16/32/64MB(72pin)....S32J58ll11/2 548
kudrgfihi ÄAST.Afid-Ilnniv
7 slow?Out ofmemory?)[/4MB30 Pin..Sl0/34
N E C mm-Network upportNetworkOgrajggSygem:IntnmetWare4.11 (5/10/25/50/100)......„S858/1169/1888l4800/6488
1 1 iM i n%
NOVELLAulhorizedWindowsNTCertified
1MBPCIVideoCard, 3.5" Floppy DriveKeylaoard, Logitech Mouse‚MiniTower Case Im“‘ J y m mQgons : -Pentium ‘chipl66/200/166mmxl200mmx ....S1308/I568/1408/1668Cyrix 6x86-133/166/200-1- .....S1098/1138/1228AMD k5-75/133/166 ....„3998/1068/1138
least 868/77107111:Pentium Pro Chi ) 20032MBRAM. 2.0GBEIDEHai-dDrive15'SVGAColor Monitor2MBPCI VideoCard, 3.5"FloppyDrive,Keyboard,Ingiteeh Mouse‚Tower Case2 m m ;Pentium’Prol50/180 . Sl728/2068 AMDK6-166/200 51828/2068DualPentium ' Pro200w/built-in SCSI2940UW.....S4098CustomizeYour S stem .
Win95/NT4.0........„3125/278 33.6/56K FaxModem.....S128/24812xCD/SBIG/Spks.......„S228 15"/17" Monitor .......... + 98/39816MB t0 32MB ..........+S108 32MB t0 641x15....................+S218Others please refer to "UpgradeYour System"
l
' i on [aber2 years warranty onpans.
‘Phirdyearpartswarranty/‚addflo,Firstywon-sitewmantygaddfli
132m2( « a u w mToshiba ZOOCDS P-IOO/SMBISIO/DSTN/GxCD.....................„S2228Toshiba 430CDT P120/16MB/ 1.3GBl1l.3"‘I'FT/10xCD...........S3658Toshiba 74OCDTP166mlX/l6N1B/2.1GB/13.3'I'FI‘ll0x .......„S8285AST Pl33/24hv1B/lGBHDD/ILS‘!TFT/28.8 fnxModan/Gx CDS5328NEC Versa2530 Pl33/l6MB/I3GBll0ADSTN ......................„S2828NECVersa263OCD Pl33/l6hB/L3GB/l0ADSIN/10xCD.....S3398SceptrePIOO/IGMB/IGB S2138USRPilotsooo(5121:)PasonalOrganizn’ ...........
IBM,HBNEC‚'I'I„Shmp‚Hitachi,Digital,Canon, Aca, call
16I32/64mbDIMM(hdac).S128/273/538 „ Notebook/primamemory.. call( N o tenough spaoe installnewProgrmns? )850MB/L6/2GB IDE.5199/268098 1 .3GBSCSI 5358/448/11083/4/5/6GB 5398/498/618/758 81GBJan int/ext ............... 3529/629 P ‘
InternetUnggge (InformationSuperUSR33.6/56KModem......„3155/248Cardinal 33.6 Modem/V . 3135/195hitemet Junction IPX toTCP/IPGateway
CD-ROM 12x/l6x..........„5138/189 12x D-ROM/SBIG/Spks......... S238CD-R4r/‘2wSCSI.................„S558 4x! 2x SCSICD-ROM.....S169/2S9SB 16/32/AWE32.....„S78/128/248 Mix
;“
I4‘/l5' /I7' ...............‚3239/339/639\l/2/4MBVideo ....... 3418/62/88
VieWSonic15I17/20' 5428/818/1518 M 0x SGramN4mb.......Sl88/235SONY 15/17/20‘ 5558/9880168 xWRAM214MB „3258/368NEC 15/17/21‘......„5498/1038/2378 A 3D PCZTV 2J4mb......Sl68/208Printer (Malte yourjob looknicely) ‘
HP400t/692d870cS268/398/678 Can 81240/4100/4550 5229/3l8/578Brother 730/760DX...... 5518/628 Epson 400/600/800........S348/4l8/618HPLaserJet 5116p _______ „3538/998 HPL. SISN/SM......9799/21200485( Slo spend lots time waiting?)Pentium-133ll66f200..S348/528/788 6
el33/I66/200....S298l348/428
PentiumMMX-166l200 S628/878 75/133/I66.........8190/268848Pentium‘Pro150l180/200..S578I958/1068; AMDK6-l66/200 ....S698/958TVtuneflwatdiTVon saeen)...s199 Draw4.0 (CD)...........„S69QuutshotGmmPad/Joystii. Sl4ea mousesaia1/PS2S25/35LMMBPanasonic FDD............„S29 E1ca1187CDbundle ...... S99FamilyDoctor ....„S10 BCWhitePage. GuichBooks forMaflISZS800 Iettas ......... S58 Phon:BookKlugQuest S25 CD tilrles ..........l.44mbDisks(10).. S4 CDCIeana’ .....‘knu- 9
h: j fi f
Grolia’Encyl blmdle.S35
Q COMPUTER n u n ! p M A Y 1 9 9 7 p http:llwww.comp iter-playencoml
GroupWise5 (5/10/50) S688/3235/6268 ArcSenre 6. (25u) S645ManageWise v2.1 (5/10/25/50 uset)................„5728/1209/18380499WmNT4 Server 5/ION/orkstation/Ilpg/Lic. .....S888l1098f289/l88/58‘WindowsForWmkgroup 3.ll/Windows95/Add-on...... 585/125/65‘IBMOS/ZWaip Server V4.0.... S799 Lantzstic 7.0.............. S125NetworkHardware: _3ComElink 3c509b‚ ISATB I+/5+/20+/100+.........S128/118/l05/993ComElinkXL3c900‚ PCITB1+/5+/20+ ...... ......Sl55l138/l243ComElink3c905 10/100PCITB 1+/5+........IntelEfllefEXpfeSSPro/IG ISA 'I'B 1+/S+/20+..... .IntelEtherExpress Prol10O PCI TB l+/5+/20+........... S128/118/108NE2000Compt. ISA/PCL...S49/88 SMCEL 16Tultra ......... S128300m PCCanl ......................S198 Xiroom IOIIOOPCCard. S248HPJetDiiect PrinterServer .. S438 Adaptec 2940SCSI ........ S2783ComRemote ...................„S1100 8/l6/24PonHubS148/265/4083Com SwitchHub (12) .......S2790 APC ups 600/900VAS338/4784mmDATTape 2/4GB.—... 8768/888 SmartPrinter StarterKit „S215Cable 257507100750071000‘ (BNC o: TB)........ 515/25/35/120/220Teiminator/‘f-eonnector/Connector ........................................ S5eachASTManhattan 6200Pentium Pro200/32mb/4 GB/8xCD/NTS63l8HPNetserverDCS/Paitium 13332MB,2 GB 4x CDROM.. S3899HTDualCPU Server P133,64MB, 2‘2GBSCSLIZxCD ...... S2958HTSewerP133 64MB, 2"2GB SCSI. 12xCDROM...............S2578Acer A-OPEN Server P-133, 32MB, 2GBEIDE, l2xCD......„S1418Standby Server, Farm-tolerant for any servet ........... ............„S3799InternetJtmction IPX to TCP/IPGateway (LAN to lntetnet)..S388 up
MnpleOnkComputer Solntions Ine. (DomainSie:1990)StfiteSOO, 128lW.Geap'aSLVanoouver,BC‚ V6E3J7 (Nov L a ä )Tel: (604)681-3770 ‚ Faxaaac (604)681-7771Fax: (604)681-3739 E-mail:4:BBS: (604)681-4408 InlandI fi p J
öfiipntyerHardware
{._ bfisinesses joining toqgethei’ in a‘prem[{ium
location to creatLe amarketplace and environment tomeet all their customers’ needs.
Imagine when it comes to Computers, consumers can satisfy all their needs at one place.This is the concept ofthe atPacific Plaza, the hottest
real estate development inRichmond. This concept has been proved n
extremely successful elsewhere. Finally, the first and biggest Computer-
market place in GreaterVancouver is here and you can become part ofit!
SH ISLAND VIAY (-
Calljoe (Chinese) V
at 328-8989 01' g äIngridKrquse (Engllsb) Ia’ f 0 ’details. 88880dlinCrescent, Richmond,B.C.
Developer:
Emest8:‘IwinsDevelopments Inc.
TORAY PD OVEICAL0|2|42)?
6 5 0 5 PARALLEL EXT s 529 acon 10/10057 (3c5o9) (pcz) s 129101111 m) o p r x c k p 55mm 5031 nrp 3 355 3CCI4 100B‘! (3C215A) HUB 51599 USRronxv PD OPTICAL ssoum scsr 217 s 469 ‘"TE‘ 1°’1°°5’ “ ° I ) 9° U5!xouucx zzp 1ooMn pxnannxn EXT s 139 ääägn :g::°“°°?cä:;o 1°?::A?““ ‘ 1° 1 ° ° ° ’
gzfgg usnIOHIGA 219 1oona scsx Ex? s 139 ‚ T , 193, C g „ „ ° (PCI, 5 ( 4 9 USBrennen JAZZ 1ca scsx rar s 439 KTX 9 von: aus s 99 "SRIOIIGA JAIZ 165 scsx EXT s 599 Krx 16 PORT nun S 199 USR- " usn
xrxxrxxrx
256K
512K SE16512K S816
EX 512KEX 512KEX 512RVX 256KVX 256K
RTX (AT)KTX (AT) 512KASU (AT) 512KASDS (P552TP4S) EX (AT) 512KA805 (P55T2P4) EX (AT) 512KASUS (XPSSTZPC) H! (ATX) 512KASDS (1197) TX (AT) 512KA508 (TX97E) TX (AT) 512KA505 (T2971) TX (ATX)A803 (TX97XE) TX (ATX)ASUS (P6875) PRO (AT)ASUS (XPSNPS)PRO (ATX)A505 PRO DUAL (AT)17A?! (815620) TGCAT II DUALTYAN (815635) TGCAT IIITYAN (515630) TCICAT IIIDUALTYAN (S1470) TITANTIAN (S1472) TITAN (ATX)TYAN (516628) PRO (AT)TYAH (S166SD) P30 DUAL(AT)
32MB 168
(316680) PRO DUAL(AT!)
7216872
1811110810 104 KEYBOARDIIITSOII 1.4 F10???15‘15"17‘19‘24‘24'
CASB I/ZOW M’!CASE I/230H H!CASR i/ISWCASE 0/2505 (AT!)(‘ASS W200i M’!GAS! I/ZSOI (AT!) 11MG!
Ißlffläfl ORMICROSOFT SERIE i008!YAIIAHA H7 SPBAKZRSYAIMBA K15 SPEARZRS
S1193139s1498450S179s1a9s229S2293309s3o9530583198669s249323933199179S199532054205450
S 109S 129S 2095 239
CANON RJ-30CANON BJC-IZODCANON BJC-CSSOCANON BJC-240BROTHER HL-730DX (S50 K Ä I L ' I N )BROTHER BL-760DX (S50 lQIL-IN)EPSON COLOR 40DEPSON COLOR 600EPSON COIDR B00HP DESKJET 340HP DRSKJET 400HP DISKJZT 692CHP DISKJIT BZOCXIHP DISKJET B7031HP LASERJEI.‘ 5LHP IASRRJET 5MIIP LASERJET 5NHP _LASERJET Q4?HP LASERJET 6PHP LASERJET SSILEXHARK 2030LEHMRK 2050LEXHARK 2070LEXMARK OPTRA E
M M M M M U D M M M M M M M M M
uU’0
cnxx/mc 9150+’ (um) scvnxx/rau 9166+ (osu) s 179cnux/Inu 9209+ man s 229max. Pan-rxm 1391m (am) s 19sINTEL PEHTIUI 133m2 (RBTAIL) S 21DINTEL PENTIUI 1661422 (OBI) s 34D
s 3° nrrsz. Pnnxuu 199m: ( m a n ) s 4:mm1 . 2 2 1 mm zoom: (cm4) s 4s 3° DITIL PINTIW 200MB: (RETAIL) S 7305 ‘9 mm2 . van-nun 159m: (am) n4 : s 40c5 59 xumzn pzxrxun xssnaz (RIIAIL) llcl s sahS 79 xnrzn vrnrzuu zoounz (cünn 1:4: s 660s 109 1mm . 9 m m : 20mm: ( n u n ) nur s asb5 10g INTEL FERTIG! EM 150 (OB!) 5 260
s 235 rm1. warm 2m 190 (cm4) s 599
S 35 INTEL vznrxuu Po 180 (R:7A1L) s 635INTEL FERTIG! PRO 200 (OB!) 256K S 6955 5’197:; Pznrxuu pno 2oo (nzrnxn) 254x s 760
S79 (
MAY 10A T I 4 M B P R O T U R B O
V I E W S O N I C 1 7 “W . D .
L E X M A R K
512K S1325
2299958P 4C
FUJITSUFUJITSUFUJITSUFUJITSU
äfiwäääääää
SATURDAYSPCIALS( O E M )
33.33.33.33.56.56.56.33.33.33. GMOOOOGMMM
ALL D90348 AR! IN RETAIL BOX
E6 PROE6 STANDARDE3IIISGE LITESEES12S12
PUIJ.LITE
FALTBEDFLATBEDFLATBEDFLATBEDPLATBEDFLATBZD
VOICI/SPRAKER
VOICE/SPIAKER
VOICE
VOICE
600D?!600DPI300DPI
1200DPI300D?!300D?!
0040004040040!»
FLATBED 1ZOODPIF L A T B H ) 1200DPI
FLATBR 300D?!
24522924924999109129
s 949S G59S 239S1899399‘I99G998992794999993490040004040400!
(nnsssrnn) 1.395 (xou/129:) s 239(nnszsrnn) 1.7: (1ous/129x) s 249(ua424:nn) 2.153 (zous/129:) s 279tunssarxu) 2.668 (1ons/129:) s 309rrnzanzn 1.lG3 (IZIB/64K) s 229rrnxaann 1.353 (1oMs/129x) s 245r1nmnALL 2.1ca (1ous/129:) s 299FIRSSALL 2.568 (1ons/129:) s 315rrnzsann 3.1GB (1ous/129x) s 365FIRIBALL 3.9cß (IOHS/128!) 5 439(AC21200) 1.363 (1oua/64:) s 249(aczisoo) 1.53: (1ons/129:) s 269(AC22100) 2.1aa (1ous/129x) 9 299(AC32500) 2.565 (xous/120x) s 319(acsaloo) 3.163 (1ous/129:) s 369(AC34000) 4.159 (11ns/129:) 9 449
scsx(sxoaon) 1GB (12ns/256:) unanu 8 349(axossn) xcn (sus/255x) unrnn 3 415(31055!) 1GB (sus/255:) u.w. 9 sso(321559) 263 (995/255:) uzrnn 9 535(92155!) zcs (SIS/256K) u.w. s 729(32171n) 259 (ans/512:) unrnn s 359(321719) zca (MB/512K) u.u. 3 949(34371u) 493 (ms/512:) unrna s1299(34371w) 453 (us/512x) u.w 31359(2170-3) zca (aus/5125) uaaow 5 B25(2170-7) zcs (us/5129) IIDE s 945(4350-3) 4GB (aus/512x) nannow 51275(4360-7) 4GB (DIB/512K) WIDI 31325
S188*V 7 7 3 S669*
2 - 5 G B S 319*2 0 7 0 I N K K E T S 2 5 5 *
HITSIMIHITSNG 16xPANASONIC 12xPLEXTOR 12x SCSIPIÜIEER 12!21044231: 12l SCSICREATIVEYAKAEATAIAHATAMAEABLANK EICORDABIICDR7116CREATIVE 500241) BLASTERCRIATIVE SWRO BLASTERCRRATIVE SOUND ELASTER M1364 PNP (BOX)CREATIVE SOUND ELASTER AHE64GOLD PNP (BOX)
ZXCDRECORDERRIT4XCDREOORDERINT4XCDRECORDERQTÄ X C D R H 3 R D B R X I T
CRIATIVE DISCOVEM W354 KITYAIGEA IAVETABLI
1:1 amzxrnxssxöu1:1 an zxrnzssxou4:1 anzxrnsssrouAr: anxxrnsssxounxz amIIPIISSIOIIII anxxrnnssroa
annxrnnssraunxrnmsszouzxrnxssxaunno rumaovan runnopno runno
3o ran TURIOATI ALL-IN-HONDERAr: ALL-zu-Iounsanrx ruuzn cxxn
nunnsnxuuHuxxsnxuuHILLEHIUMILLENIUHHILLENIUHHILLENIUHMILLENIUHMYSTIQUE
nxrnox MYSTIQUEHATROX uysrxqu:s3 39 vrnczS1! vzzocxrx ansra LIGHTSPEEDsrs sonzncnapa 54raxntnr 9680TRIDENT 9595
HATROXMATROXHATROXHATROXHATROXMATROX
s s s s s s s s s s s s s s s o
‚E
4:9 9/uwss4:5 IIIPIG
w/nrucI I IP IG
. 4MB 9/pczrv
. 41: i/FCZTVI/PC2!VII PC218!
. I I I ! I/Itflzrv
. am W/PC27Vv/FcztvI/PC2TV
M8 .4!!!
WRAMKRAM
W/NPEGW/HPEG
VIDEO CAPTURE/HPEGTV ‘EINER2MB4624B2MB4MB2MB2MB4MB2MB2MB114S2MB
UPGMDE 10|3|11)!
UPGRADE IDDULEUPGRADE HJDULESDRAM H/HPEGSDRAH H/KPEGUPGRADE lflbbUfiIXP. 0G H/HPEGEXP. 3143
DRAHDRAM
W/PEGW/PCZTV
UPQADBIHBTOZHBDRAII
16 PNP (OB!)32 PH’? (OEM)
4.340
(BOX)(BOX)(BOX)(BOX)(3030(BOX)(BOX)
S3SS5SSSSS5SSSSS
SSS5S5SSSSSSS5SS5SSSSSSSSSSSSSSSS
129159129349
599
259
34912920926939916912523533'.‘1351397065249179149496930
. C O I ' I 10) (G) N h! "UN
P150+ mhz2! 1:133 . . 022591111111221-044 17- 1290x1024 26 0017 s 7a; 1:120 rE-r 92669
AC5“ 1 | " 1024x768 J3 341‘ 5 249 11x16mm 17- 1290x1024 .20 m10 s 669 4:120? 1'711 32949
‘mm i: g m a n 17- 1260x1024 .25 00747 s 479 P133 12.5. s2949„m W „ m m 0 “ A” m: 5 m 091140117044
11-1600x1200 26 0075 s 909 1:133 T?! 53599
“an „x 1600x1200 J5 n“ s s” FREIEN 17 1600x1200 25 m76‘! 5 999 P133 13.5. 53449DAEIIJO 14- 1427111 s 299 510511140 15' 1024x766 1501.11 s 429 „ 1:150 1n- S659911mm 15" 1502B S 399 S 8 6 3 15' 1230x1024 1551-1 S 059
HP133 TFT 56425
D1500 15‘ 15095 5 439 511145061; 17- 1200x1024 17431.1 s 799 m14 1111141611‘ 7 6 0 2133 1'171- 97025 ." m " ”' ""35 5 "9 56449169: 17- 1600x1200 1761.91 s 969 Im:m 760B!- 2120 0.5. 02839
"mmmm 2 90111 15- 1280x1024 10051 s 479 m4 n: '7 6 m - 9132 m 5 5 m
„ A n m ‚o . „ o “ „.9, 94m 15- 1260x1024 10097 s 539 ‘n! ‚ 76031-1‘ P133 I‘?! 56859 _1112x244 14- 1024x763 .29 121-14394 s 249 50l! 17- 1200x1024 2009: sm 99° P1°° T" 52399nun: 15- 1024x766 .29 071536 s 299 san 17- 1600x1240 20099 s 959 35° ‘ P133 T" 53399 .u m : 15- 1260x1024 .29 021531 s 319 5 . „ 17- ‚ m n m 5m 5 m , 660 - n 3 3 TPI.‘ 12.1 935990149x121: 17- 1260x1024 .29 071731 s 579 w, „- 1500312“ mm 5155; e90 ‘ 1:150 717-1- 12.1 53929BITTE-K 17' 1230x1024 15 D7170“ 5 899 u; zo- ‚ M m g o m, 5232, vzasx 2400 1:100 n.s. 519994:19-11:11 20- 1600x1260 .2: 01-20014 91499 vmsau - 66EITACHI 17- 1600x1200 .26 041711 31195 x: 2:1.)“m m 1 17- 1600x1200 .22 04611€! S1360 " m "
61x14cm 20- U°“x1024 .28 1142011 61920 “ w ” : 15' ‘"°’"’“c 16- 1024x166V1131
F i l m 15‘ 1200:1024“ i m 15' 1250:1D24V 1 5 3 2 15' 1280x1024VIWQIC ääiääääääääääi1s- 1260x1024
_n vznsaxc 19- 1260x1024 m"' vzusmc 11- 1260x10241 7 1 1 € 17‘ 1250x1024V1111: 17‘- 1600x1210Vlfiülfl 17‘ 1200x1024VERSE“: 17‘ 1200x1024VIEISIIIC 17' 1250x1014W E I N 17‘ 160011200‘ H E X E 17' 1500x1200
HHHHHH
94480-1885!
3641 s 299 vxxsx 2430er: P133 13.8. 52689qsa s 359 2530 2133 527496655 s 479 vxnsa 263°C!) 1:133 5324916621 s 369 vnsx 603m4 n 3 3 5496915a 6 499 vsnsy 6030: 9133 352391541s s 449 172415144} 6200141: P1661011: S8349V4656 s 5x9 vxnsa. 605019-1- 1:150 S6999V655 S 375 vznsafl 620014-1- 2166m: 96599971 9 m . . 650cm- 2133 53949
5739 . . 13 1146020 1:120 11-1- 53519"73 5 57’ . . „i5 naszoo n 2 0 76-1- 93599"75 57°’ . . w; n46o30 P133 r r r 93925"55 ‘7" . . '
1646050 2150 r r r 54999m‘ 5“’ . . ;‘ 1145300 1:133 53599m" ’5" ‚r. jl 1146160 PIGGIIIX 56419
m’ ä 1033x911 ‘J 200m5 1:100 520992096x1111 1 430cos 6120 92599
ä t fi ä ä ä ä ä ü ü ä ü ä fi fi ä ä ä ä ä ä fi fi ä ä ä ä ü ä ü ü 3 m m
I‘.c49o
T U S H I H Ä 4 430%‘! P120 ‘ITT S3099man». soocs 1:120 11.9. S286911091411111 510cm- P133 15‘ ! 555991051411914 11 GSOCT n 3 3 r r r S4779‘IOSRIBA
'560cm- 9150 2n- 66199
amca 20 1600x1260 25 cm0: S2310m a n “ 1' „ o “ ! n‘ “ o ”
I . °"'°“"31:61:11: 21- 1600x1200 22 4346000 52410 m a n " ., " m " 9 1 6 m m " “ s ”HITACEI 21- 1600x1200 22 4346020 52675 4, 114x14cm 21' 1600x1440 .22 425411030 S3099 i-- — o61x24cm 21- 1600x1200 22 ux4721 325491111144311 21‘ 1600x1280 22 014921 52949 ‚ „_ _111114411 21- 1600x1260 .22 uxsan S3199 „:
"
m s 19x94cm 3133-119: .;.- " m " 1 " m " °- " m " * TRIDENT 1MB PCIm 13- 1260x1024 .26 DIGIflL s 309‘ u m n” D s z “ ,
“ a n ” “ " 1 " ” 5 35°
m 17- 1260x1024 .26 s 579 “ m ” ! ' ‘ ‘10311131.‘ CFI9P3° 5 33°
14114; 14- 1024x766 .26 0x149: s 939 " m a n '“"’° '13’ °-‘- ‘"7’ 1052x1911 i7 enorm s 420n: 15- 1290x1024 .25 0x152 s 449 3““: z 3:: CFTIYBO s 590 Wm; 15- 1260x1024 .26 0.1530 s 469 " w " „Hall! „R71 5 0 s 52°‚w; n. „ w g , “ J5 W M , s ,3, 11x26cm 64x133! 9133 1!‘! 94799
m a n ” enorm s 920141c 17- 1290x1024 .26 11.1700 s 775 5 1 9 ° “ m 5 " 915° T" 55 °”
m a n “ c m 2 ! “ s 98°n; 17- l a h m “ Jg W102 5 7” HITACEI M8166? P166 171 S8499‚m; n- 1256,10“ ja N767 s 949 111mm: 6412011 12120 11.3. 52449 W 3 9 1 ” 3 7 3 2 " “ 51°“1410s 17- 1600x1290 .26 0.7717 51020 14:19:41: 4:133: 9133 rrx 32549 ' 70551!!VOR Chr-I- POR HDRE INIORIPIIOYI1410s 21' 1600x1290 .26 11.1920 S2050141414140 15- 1260x1024 .26 FX-BS S699 CYRIXmm 11- 1260x1024 .29 rx-Cs s 999
1:" 1:23:22: -:: 1.22:. 212:: CYRIX P1661‘ 51529" x .44mm 17' .....„.. .2. 1:14:75 9.... ASUS HXMOTHEBOARD EIDE CONTROLLER INTEL 133m}. 1549NÄNAO 20" 1600x1200 .30 TZ-ZO 52415 ZNANAO 20- 1600411200 .26 710079 52299 256K p|pEL|NE CACHE KEYTRON": 104 KEYBOÄRD INTEL 1zNANÄO 21" 1500x1200 .78 U527 S2299m m 1 21- 1600x1200 .26 112-21 53799 HONEER 12x CDROM"22: 2:" 1:22:22: 9:: 212:: 222::
‘“‘"‘°“‘““ ‘°°s, 2 E o 1117111651712 114151859
1: z " x . ,„ a m 2. - asoumoo .2: « m m sws MITSUMI 1.44 FLOPPY ‘m 3° “ " 5 5 °"M“ °
LoTus s m m s u w e 9e INTEL 200mm 32059PHILIPS 15' 1280x1024 .28 12I5DC 5 S49 T ‚|6VWTH F R E E
PHIUPS 17" 1290x1024 .26 1073 s 969 M")TOWER 7 BAYS S DBLAS ER ’ u U P G R A D E T0
9811.105 17- 1260x1024 .26 14117000-1- s 699 1 1 wD 2 5GB “ARD DRWES M A R T S U I T E 97 INTEL M01
21411125 17" 1600x1200 .26 107 51099 wATr' ' ‘
21:11:25 2o- 12e0x1o24 . 31 20046451 s1309 ‘E: ‚ s.. MS3 BUTTON MOUSE 92911.199 20 1660x1290 .29 209 515491111112431-014 14" 1024x769 .26 1:014 s 340 FAST "O CONTROLLER „ WITH P U R C H A S E 0F S Y S T E M INTEL19x11mm 15" 1280x1024 .24 m60 s 440 X 15 015| LMÜNWOR611114127044 15- 1024x766 .20 01.710450 9369
rI:
6:5.
Harn- .
o o ByLYNNGREINER o o
Quälity Computer Iimc frequently drags oneaway fmm another rubc: the tclevision.And,ocqasionafly, it can bc a tossup which is more
800b tllbe: 111e nextgenerafionocooocnoonnnocouponuoaonooanooooooonouooononooooocccounnnoonnoconuoononoaooooooooouonc’
enyousella0
Soundx4000,‚urcustomerspentium‘n o c z n r o n
“Thewait fortech Support is
_ocurrently longe than 45 mmutes”ervice;«It'snot thatyour customers are liköly to needit. ’
7
0
But isn’t it nice to know it is there if theydof? NotebookComputers are complicaged devices and their owners
mighthave questions orissues that needresolving. WeatSceptreknow this sopromptand couryteous technicalassistance automatically öomewitheverySoundx4000 note-book Computer. Thismeans that theywon't have to ajmlesslywander through an arcanevoicemailmenu so that they canthenwait on terminal hold.But that's not all. SceptrehasServiceCenters on both the eastäandwest coasts. The endresult is that you have satisfiedcustomers; Thatmeansrepegtbusiness for you.
0 ’
’
äFREE"ä caCall now andwewill send you a FREEone yearmembershqp to the SCEPTRETRAVEL CLUB(valuedm24.95)se youmembership immadiateiy t0 takeadvantage of exctusive discounts unavailabie
to911e general public.Whether your plansinclude business or pleasure travel‚ _ you win benefit from instant‘k;worldwide travel savings on
p
For a distributor nearyou call 1-800-788-2878and receive a free one yearmembership intheSceptre"IfravelClub, a 524.95value.
‘i4 topperfimneff; „PCMagazine
“Oneofthebetteronesaroundä.LaptopBuyersGuideandHandbook
n"‘e'sceptre‘n"s”’oundx4ooo"l
’ n; 89019 631b Ifll an 133 o- — _ _ - ‚- "x - OPPY fve; ‚..to_l'5‚f1 ». i . r . MHzPentiun"1‚_ ' ssoxäffltozGßuser’rärfiovable _
o
‚o‘
.0r’ ‘
HDD‚8_to40MB I o n B a t t e r y12.1"1
_Ü _ TFISVGA V iozßhifigraphicsModularDiasign,’’
visitusai;omdexcanada's7„ju1y_941‚xggothamgz’ PXCDJSG};M“
r -
w
T Ü E S E E1 -800—788»—28Y8
1@ COMPUTER PLAYERI > M A Y 1 9 9 7 > http://www.computer-player.com/
%„on’thear this:
compelling.111cm have bccnTV tuncxs avail-ablc for personalCOmputelS for some ümc,butLhequality has bcen inadeqmte until nowffhecombirxation of fast Computers and acceleratedvidco finally makcs it possiblc-or, at least,
acceptable.Canadsrs ATI Technologics hasrelcased an add-on cm! that per-mirs telcvision from any of sevem]sourccs t0 be played on a StandardmOHiIOLTTmATI-Wandconmins atclcvision tuncr, and connects torheVideo intcdäcc via anAMC (ATIMultimedia (JmnneD Connector,present on ATI's Vxdco Xpttssion,Video Xpncssiont 3D Xprcssion,3D Xprcssiom», 3D Xprcssion+PCZTV, and 3D ProTurbo PCZIVmrds(wetcstcdwitha4MB3DXpression+ PCZTV)The (‘m-d needs an ISA slot, and‚mustbewimmafewmchcsofmeVideo adaptcr; since its cablc con-ncction must bc undcr ten inchcslong.Installationms fairly suaight-forward, although thc bulky carddocs need room.It’s I00 long for a‘slotnear thc CPU fnn‚for cxample,and Lhe _-inch thick tuner modulomayget in thc wayofcormccüonson other caxds.Once thc card is in a slonyouCon-nect a nbbon üble fmm it to theAMC conncctor on thc Videoadaptcr, and install LheAT! Playerapplication i.f itls not alrcady onthc systemfflicrvds a shortCablc inthe box that you can usc t0 plugthe carrfs audioour t0 thc inputon your sound card.Then just plugcableTYyourVCR,or an antmna into a plug on thecanLand you're rtady to watchTVThe tuncr indudcs a cable Con-
vcrtcr, so you’ll be ab]: t0 watchall of thc unscmmbled channdsyour cablc company offcrs.There's a chnnncl lockout Option,so you can password protcctchannels you don’: want the kidst0 watch.
Stretchlng the frameThe pictme can bc onc of the pre-sct sizcsfrom 160x 120 pixels t0640 x 480 pixcls, full scneen, orcan bc custom sized by draggingthc fmme edges.On a high tCSOlu-tion monitor (1024 x 768),thc dis-playwasgood to 640x 480‚fillmgjust ovcr half of the screen, butbecame a bit fuzzy a: full-scmcn.This i5 partly a function of thcvicwing distancc-if you sit backafewfeegflmc fulkscrecn imageisaboutasgoodasona regulzrtelc-visionXou can display thumbnailsof what's on each availablc chan-nel, and double-click on thc oneyouwant to sclect,or simply dickupanddownarrowsontheplay-er's conuol panel to surfihcwsno direct Charme] selection.The mrd also capturcs t0 disk sin-gle fiamcs (good) and comintxousVideo Clips (i: smttexsxvmWithaläöMl-izPcarxdafztstmrddisk).You can display dosed-czptioningtcxgszveittoafilozandcvmaskthc System t0 monitor the ( a nandwam you,or statt reconding,whcn
dann
What's onApple TVthese days?
RnsUavid E11
If you thought the Situation a:Apple couldrftget any more bizarre, just wait for today’sepisode of “Melrose Place in Silicon Vlnlley.”VeteranApple watchets spent another monthshaking Lheir heads in disbelief a: the continu-ing corpomte soap opemYou may rememberlast mondfs insmllmcnt in Whid‘! many ofApple's employees ldt the company,either vol-untarilyorbywayofafinnpuslLGoIIcJbrcxample, an: Canadians Satjiv Chahil, PaulWollaston,Andrew Scoulm; und many otbclswhohclpedtobrxildtlnecompanyoverflmcpastdecadefIhey-and almost 3,000 mone-lnveanmetedmeirlaste-tnailsbrthecompany.In lhis episode, we discover thar pcrennial
Apple suitzot; Iarry Ellison, has bccn wrlttnlback imo thc Script. Elison hcads Oxaclc(Jorporation, thc world's second latgest soft-ware company and he's dearly mifiing aroundAppldsheelsmapotcntialtakeovcrbidflliscxlpromised a few weeks ago thax, if he didacquire Apple, its cument directors 2nd topmanagers-induding current Apple boss GilAmelio-wotxldgctmcaxcfitstcrfllanyoucansawcorpomtclcn”Few who am: decply about Apple Would
shed any real-s forAmeliqwho seems deter-minedtodemoxrsuatehowtomkeasomewmttmubled-but cemjnly viable-cotnpany andrun i: stmight into lhc ground.DuringAmelidstenuxe as Apple‘s CEO, the company has lost
momeman 51.5 billim doIlarsAmeIids xeoentadmissionthaxhedoesnotexpectApplemtumapmfitmfilmisaxmmulaxthemrlimdidrrthelpmauers.IDreamofSteve‘!Butwaigthetlfsnxotxajustasßolflayfiwing,
whoseyear-olddcaflmonballasmmedouttobe sonne wcird dntam, rumouns an: flyingthrouglm Silicon Valley that Elison sees hisffimdstevejobsasApplcbncxtCEolnmscyoumissedflnxepisodeJobswasotstedfiomApplemapowersutaggleowradecadeago,buntentmedtotlseoompanyinßeoemberasan advisor when Apple bought his NextSoftwarecomgxanyfixapxinoelyflwmflliofl.Andspakingofprhmelystnnglefiswelcome
ancwdaanctcrmmotlrasnsmldimabizfsPxinceAlwaleedbinTalalbmAbdxflazizAlsaxulhasdisdoscdümhcnowhoklsmomlhan5peroentofApplebcommmstockiheprh-Icefepofißdly bousht ÜICAPPE 91916 00 The-openmarketoverltnelasscvaalwedcsbrammIOfUSSIISmIIIion.“Ibclicvcmexcisscriompotcxltiallbi-Apple
to ptovide lang tetums t0 its stoddnoldexsonceagaimasitdidintlnepastfflxeptixxoe
isfamominfllcmvcsunal"tcommunityforbxxyinglow-pricedstockinuoubledcompaxxicsonlytomakebackhismigitnalinvesunmtmanyfiznesoverwhetxmeyrecov-c1:
EnterlßlmstngeleftManwlfileBigBlueisüsowatdfingApple
TV/lpplesfinanciallaealflioonnldntbemotexmportnn‘tasitcoxudets‘mlßMlx-axrdexzLMacOSlaptopcomwtaltsectnsmatlBMnuyenterthc S1billionMacintoshcompatilzle laptop marketwitluahigh-poweuedsystcmfim
0 0 0 C 0 0 0 0 0 0 0 0 0 0 0 C O I O O O I O O I O I O O I O I C C C O C O I O 0 C I O O I I O I O I O U U O O I O O U O I O I O O O I O O I O I O O I I U O I O I O O I O U O O O
continued from page42userdefixxedwotdsorphmsesappeathxempüonscanbcdisplayedeiflmerovermeprogxmn,asonatelcvisionmorirlasepamtcwirxdxw.Ihcmrdcancvmbeptogmmmedtostartplay-ingaprommorlomürscapfioninstatatspc-
TakeadoserlookatthosesmurfsYoucanzoommonaninnagcdumlgapm-
grambysimplydrzwingaboxaxomndinandevenuseittoxeplaceyourdmktopwallpape:
Thema am adiusuncxxts b: coloux; brightness,2nd conuast, und thc cand Supports scveralvideostandatdsflNISCPALandsoon)Iwasplcasandysxirpriscdbydncqtnlityof
slnrp,butIwouldn’tusethePCI‘Vcatdmsteadofavideotecordegsinccmerewerenoficabledmp-outs in both audio and vldeo in tescrecoxdings.lt'sstillaneattoy:l:hough.O
ATl-TV‚frotnA1lTed1no1ogies|nc 31795119).Formore informellen,V151! httPI/Mnwafitedla/
vulillnmAppldsMacosopcs-atingsystembutmvcnhelessbmrßlgßlueslogoffhenewlap-tcpwouldtsemMtedmologyaxmdfllenewestteleasc of Mac os nmnirxg on m: 240 MHzPowerPC 605C that powers AppIe's new
lfigwcrßookfiooscricsorafzstervasiormowi developmcmHewbuslnessbunclessomccmcshotxldtelltlneAppleslnovsscn-iptwritersmaxalldmscplottwiszsmaymkecus-tomem’ attcntion zwzy fmm lhe main eventsalcs of ncw Macintosh Computers. Apple(Ianadamvcaledwlutitcaflsitssmallßusüaess
hhcintoshscficsflvlfichisbasedontherecent-lyannouncedPowerMacintosh6500and4400Systems. Designed lbr small busin owncrs,
0 0 0 0 0 0 0 0 0O
bodlwsteuxsltanneahnflt-mdata/fixmodcm,al2x—speedCD-ROMd1-ive,andod1ergoodies.
busirless Software induding Microsoft Oflice,Norton Utilifies, Now Up-To-Datc, and lotsmore.The Apple Small Business Macintosh6500/250 has an estimated Cänadian suectprioeofiöfiwwhflcthevusfimbasedonthe4400/200 Mac will sell for about 52,799.Monitorsnsustxalnuesoldsepatately:
Gotlhe hside gossip on lhe sunmaseasorl pmgramnling?Sendyounmoumtipgandcommentstohlacflantßaolcoln.PleasenotellutduetolhevolmleofmfiifividualqmßfiomcamotbeamureredO
O101-1926WeslBroodvtuy,Vancotwer,B1’.V611Z2Tel: (604)739-0438Fax: 739-0436
BusinessHours:Mom-Fri.10:W-l8:00 Sul.12:W—17:WOM P U T E R I N C .
Pentium Special120MHz 133MHz 150MHz 166MHz 200MHzS1580 S1620 S1660 S1850 S2100
. Intel Pentium CPU
l. . 1.44MB (3.5") floppy disk drive
. 8X lnternal CDROM Drive (EIDE)
. 16 B'rt Sound Card
. 2 External Speakers (120W)
. Microsoft 2 button mouse
. IntelTriton VXChip Set, 256K Pipeline BurstCache. PCl-ISA Bus
. 16MBRAM (EDO. 60ns. 72 pin SIMM)‘ . 128GB EIDE hard drive (mode 4. 10ms)v .OnBoard PCl EIDE HDD controller (control up to 4 IDE devices)
. OnBoard 2 UART 16550 Fast Serial, 1 parallel (EPP/ECP) Ports
. S3 Trio 64, 64Bit SVGA cardw/1MBDRAM PCI
. Supra 33.6K Internal FaxModem wNoice \I.34
. 13" tower case w/20OW CSA approved power supply‚ 14"ACER SVGA Non-interlaced color monitor (1024x768 .28mm)
. MSWindows 95 (c0, FullVersion)
. 104 key windows enhanced keyboard
Upgrade t0: 32MB E00MM5110, 1.700H00 540, 2.103 H00 590,15'Acer 1101111014100, 17'Acet- Momtor 5400, AT] Mach542MB 550,
ATI 30Xpression+ 2MB 5130, Malrox Millenimn2MB 5200,MatroxMystique 2MB 5180, l9‘ Tnwer Gase 520*Free Estimale anRepairs andUpgrades *
All Systems 2 Years Parts and LabourWarrantyPrfces sub/‘ecl tochange. Please cail1011778Ialestphbes
'
011111113113HDLUDHDUIEmlamnmlrlmmmm a n
httpd l w u w m o m p u t e r - p l a y e n c o m / 4 MAY 1997 4 COMPUTER PLAYER! o
‘ C S Q B C Q S Q U R Q Q : I — u G ‘ — C C C C S B — — — C — Q —
JJ fi ‘Ära WestminierHwyJHLL ‘i2;i M || I D? Cook Road
ADivision ofMPCTechnologies lnc. I 5 i)”LflässooNo.3 Road,Hichmond 3c vsv 2c2 (In TIME eouAnE CENTRE) I i
Pmk R°°dTel (604)270-4883 Fax (6043270-3812 L215 “LA 4
':;‚’.._..._.. H w TTS i ‘.I e.
„ojgu Ü!)pfcxfnnMICTDSOfl’ v6“ MoNää/ggnxfizägpiagg”.
6PM
‘ Ih is can be Iiazardouä for those who havealreacly purchased er iupgradecl their computer.Proceecl only I‘! you wAsh to invest in acomputer to suite yoqr needs. '
i_______________________________ „_
TheseL guestions gu'de ggujmakingIngRightDecision» PC Other- comvscnous Computer store
Knowledgeoble-DotheyknowThespecificofions0ndcompcifibilify issuesofTheir producis.iResecrch -Arefheyup-fo-dote inregardsi0 The iofesiPCfechnologiy?
‘I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I —4
QCI-Ccndü
i23 Enfhusicism-D0ihesfoffvolueyourbusinessondwilling fo offeryou fheircssisionce?4 Demonstration -Are theyobie1oprovidehcnds-on demonsirofion all ‘rheirproducis?5. Environmeni-Dofheyprovideo comforicbieafmospherewhereyqiuccn siTonddiscussyour needs?6 Service-Confheyprovideyouwiihanassortmeniof services
incIudTwgfreesefupunddeIiverV?
7 Stock-DoTheyhoveoIIodvertised speciols insiock? i8 Wcrroniy-Dofheyprovidea Iocclwarrcniy including fhe useofo seiI/ice Iocner’?9. Hisfory—Are iheyan esioblished firmcopobieof upholding‘rheirwani mies?i 0. Hours-Are iheyopensevendoyscweek f0serveyou? ‚
vowmhmgzlom! voran 1° I 1 Q R Q R Q Q Q Q« H Z I D E J D D I Z I D E I I Z I D
Cusiomers
JOBOPENNINGF o R m IN
COQUTITAM: '
SALES,TECH. SUPPORT:
ONSITESERVICECALLS,ADMHVIWRATION,
ASSISTANTSALESMANAGER(Minünurrl 3yr. Experierloe)PLEASEFAXRESUMEATIHWTONTOSALESMANAGER
AVIONTRAVEI.LTD.".'..If you am looking for SOLUTIONS for you business andSAVING choose PCCONNECTIONS
WALTERWUManager
RICHMOND,B.C.
Eapsule I13 histnriesCompiled by LAUREN BLANKSTEIN
Lastmonth,weran a head-to-head comparisonof operating systems—l.lnux, Macintosh, 05/2,Wmdows NTand Vlfindows 95. Togive you anidea ofhow and why these 05s were born, ourwriters have outlined their histories.
linuHByKEVIN LINFIELD
Back in the early 1990s, Linus Torvalds startedworking on a clone ofMinux, a small UNIX sys-tem. He wanted to write a small‚ academicUNIX system for Minux users.Starting out in assembly code‚Torvalds quicklychanged to C as his operating system becamemore developed. Taking adyantage of the pro-tected mode of Intel's 80386 CPU, he planneda stable‚ multiuser‚ multitasking netvvorkedoperating system that would be free for all.Version 0.01 conslsted of a basic kemel and afile system, but it was made available on theInternet inAugust 1991.
. Wrth the popularity ofthe Internet(especially forUNIX gurus), Torvalds was soon assisted by aloosely—knit team of hackers around the world.This UNIX clone‚ named Linux, aims towards .
POSIX compliance and as such, includes SystemS and BSD extensions.Originally made available asbeta (test)Softwarefor years, Version 1.0 was finally released inMarch 1994.Nowat release version 2.0.27 (withbeta versions above 2.1) lt is one of the mostpopular variations ofUNIX.Featuringsupport for32-bit Intel CPUs aswell as the PowerPC‚ DECAlpha, and Motorola 680005, itoffers the powerofUNIX free for anyone.Linux isreleased under the GNUGeneral PublicLicence, whlch means that it is free to modifyand distribute‚ but you must include (or makeavailable) all of the source code.
IIIacIISByDAVID ROSEN
As the basis for much of the Iook and feel ofmodern-day computer systems, the AppleMacintosh has pioneered the popular desktopmetaphor for its graphical user Interface. *
The graphical user interface—orGUl—was bornat Xerox’s PARC (Palo Alto Research Center), aresearch facility inCalifornia's SiliconValley. Thescientists at PARC found that people recognizegraphic representations better and faster thanthey read words or phrases. Shortly afterwards,the research team designed "Smalltalk”-—a veryrudlmentary graphical system controlled byamousewith pop-upmenus and icons.Already a celebrity (at least in the computerworld)‚ Steve Jobs was invited byXerox to Iookat many projects the PARC groups wereresearching. Itwas there that Jobs saw Smalltalkand got the idea to build the Lisa graphical userlnterfacq a precursor to the Mac interface.While Smalltalk worked fine in the demonstra-tion lab, Jobs’ team recognized there wäre sub-stantfgal changes necessary for a confrmercial
‘u...„_„‚_‚.,...-.‚.....‚.'..„;‚....‚ ...‚...-’
product. The teams at Apple created Finder, adesktop metaphor for computer systems thatbecame the cornerstone of the Lisa (and Iater‚the Mac) operating system. Soon, the Macgroup produced drag-and-drop file manipula-
tlo/landmanyother fundamental concepts: pulldovlfvn menus, the imaging and windowingmoiiels based onQuickDrav/I, the cllpboard, andcleanly localizable Software.111e" Joke is, Plug 8xPlay, Drag 81Drop, and
I I O O C C C O Oo
other innovations are so integral to theMacintosh, they only got names when othecompanies copied them. ‘
itedCom nuters.
‘ x —
UmtedComputers A ‚ _n
l l: oIntelPenttum-I33 JglntelPentium-I66 Inte,129„‚ü ,m pm 200Ire/rammsteinCPU reger/nassem:cm 77mm:Pro-ZOOMH:cm!zsatucu/Triton[I] PipelineCache v’T l l l (‚Epen/IsarPipelineCache I’ IntelMOFXATXMotherboard18MBEDO72pinRAIN v’! ‚MBEDO 72phlRAR/I 1321MBE9072pinRAMVL2 GBEIDE (1110694)H a iDrive ‘Vl GBEIDE (mofle/C)KaliDrive V2.1GBEIDE (Indes!)Kuli Dfive{PCISVGA 1MBVldeoCard (exp.tOZMB) " ‘ SVGA2MBVideo Cnrd “AT!PCI 3D 2MBVideoCall!11.44MB3.5” FloppyDrive V1134MB 3.5“ FloppyDrfve v’1.44MB3.5” Floppy DriveI14”N1L/R SVGA Mofitor s’
1%}?!UR SVGAMonitor “ATXTon/erCase I ATX Power
v/Mid-TawerCme / 230W Power v’. -TowerCseI 230W Power V104 KeyWin95Keyboard1104KeyWhfiS Keyboard v’ EIDECD-ROM Drlve I MS Yen-Z I LogitecbMonat{Qtronix Lynx902BMonse Bla t t ‘ l6 PIIP
Sale Price: 51,#P100/PI20/Pl50/PI66/P200
w’ ’Stereo Speck-r“l
U, KeyWin95Keyboardn69Ver2 / LogltechMaus/e Sale Price: 3-1)5
«i/PadiamE0180: ‚S1,755
salfe Pfice: 51,559a! ,PI33/P156/P2ao/166A1Mu2oozum'5119/1439/1639/ 1619 / 1.959 “WWIMUNITEDCOMRBCC ”tWe/come to Visit ourWebsite:
S9681 988/1066/1198/1338 ‚ ‚am;‚m:„d,0m ‚h69666616166Maar.- s/‚zn K6 166MMX.-SCall F , “‚ntemetAccess, i‚trau/annoMMX : 51,508 t
gDK6200MMX : sCall
J __ k,. _ 559 / 170 aMicrosoft I LogltechM0098 2/3252g [50]90/120 2145215717’Monitor 390[300
379/130 zsow/rzowSpedcer 825/66D256K=512K Pipeline Cache e515 5110/12s CMic/osofiHomeCDpaok. 580533.6 Fax/Data Nlodem S100 e725 /MsNe_rure51o I86 EWind0w-s95 / MS0ffi°e97 5125/ 420
StorageDevices Prmters Displays / SOW/d__ Powereom 33.5‘ 1o canoneaaomcn:Portable 5296/389 14"/15"I17‘Monil:or 5226/316/616FHNDHVGS- entrinnen/n: 6o canonuczaco/noocoror 5226/296 Aoer15"/17"NIIJR 5366/666w e m / z u s : 5265/295 Cardinalfßßlrlt tut/Data 5216 canonLPß/löosflfidpitaser 5346 MAG15"DX1595lDX15I’ 5406/470WD 25/3.1/4.0GB 8325/333410 Supra 33.6 PnP 5126 HP eszc/azowavoc 5395/450/660 um 17-ox17ss/7oor 5615/676WD2—1‚/4—3GBUSCSI 8735/1085 evcaas I. HFSLISSIEDDOpiLaGOr 5535/3660 Necwosoo/usoo 5476/56Ouamum 12/2168 5245/290 USR33.6 r m / v " . 5135/145 HPSIEMOoIorLaSer 51715/2476 NEC 17-m o o / x w 51666/1666Quant/m 25132GB 5325/ 365 USR 33.5 int/exd. ..‚ruhflß219l245 Epson 3514005001600 5315/4201590 Sceptre 17-26126P6P 5616/665Quaninm 12/2163SCSI 8325/430 usgsskinuen _.reusnsz/so/zso Lexmark205flCoIor 833D Sony15'100SX/SF2 5530/620Nhmr1-6/20/5JGB 5260/290565
J
LexmarkoptraE Laser 5665 Sony17'zoosx 589638996063_316065 5375/695 rd HPsPlciccolorscann/ar 8510/1130 PanaeoniePß/Pfi S fl o fl mSeasflzl/ZJSGBUSOSI 5465/700 ’ ‘ 0a MicmtwES/EGIESPN 5296/666/655 ViewnnkMTGS/PS 5826/926Seagihdfi/MSGBLJSCSI 51120/12m u-mxsee/slz 5415/710 VoemonicGT770/PT770 X / fiBackup/JAZ/ZlPDr/‘vers: mQJxJA 331mm: cßwfifer: Opfiquesflsvfiss 542a
ColomdoTiomirlt/eid. 5166/216 ‚m.P1 " 5390/625 cmmmzx 3320 Optiquesnsw-rszereomnzao 5646cormaaonoooim/exz. 5236/296 „ M , ‚ ‚m w , “ „ e s , “ „ p m g w , “ „ m p m TridentuntlflEßim/ZH 545/65Dimozsa int/exv
5210/52: M u m m ” “,K2„-‚„‚75„275 vamanamsx/mnt/mss-so/aoeo 1 1 1 / 2 1 1545;:zrproounomepamr/scsr 1 A n9: mmJAz1GBsCslrm/m 5666/666 ägfgfl- s1 Pen- herab. ATI3D2MMRP8G 5140
SCSJCOHWWI 72pIn4M/8IN1 EDO 830149/106‘ p “ fl w m w z ” ‘mAdapbc2920/2940 5165/246 np/„gaggpo f 3175 Pioneenzxeroe/scsr 5125/226 kTlwPmTurbofl/W 3260/385Aaapoeezemu/zsaouw 5266/316 Jngvxwfzgsxl m“ 511g”PanasovIic8x/12xEIDE 3116/125 ATMIHnWonderW/fl 8340/305Adapngcssqo/‚uagqomu 5475/569 ‚m-rx„5‚2‚( 1. ‚wx „u; Aeenzaanamsursroe 8125/1501205 Diamondsflß-DZII/N 51400/190
GASSSVX/Hxs.‘'
5145/135 Lini13"Ihßid15“Tovo/er 553/59 Düflmfldsflvmvznf“ 323'340Networks‘ Asusfzp4s1zx e. „,5 Full-Tovwr19"/25' 868/115 w s fi q u e M / M 5100/210A S U S T H Q K
’
„so jrATxTowar 395 w i e / i m m u n 5246/330Asus Txs wgndowsgsKeybmmuuxaw 322 SOundBIasteHGIäP/‘IP 875/120PamreomPclßflcnetu/orkcatdsß w A147°12K
- S205Fwwsnsunsbwmm ‘so/Sa S B A W E H / “ G m p fl p 525,305aooupcracsoo/sosrx 5135/125 „m: m: _ 52:1): “Nmnnwoam m „mmmwsmm „ s , “SGOMPCßCSOOCotnb 5175 omcat t um 53 mmm v flm h dmmm flm Kosssumm „a,lrrlelProlo-r PCHOBT 5166 IrIUeIV44OFXATX 5366 m m p m z s m m 515 „ m u w n g s m s p fl m ‚m,
Weals/o carry Iaptop Computers!ComeVislt Our
102-950W88!Tel:
BusunessHours:All Listet!PrieeAxel
http:/lwww.computer-pl
_H304 Fax: (604) 736-1676lStore or Call Us for the Best Price!
‚Väncouver,BC (Broadway 8/06k)
‘Ari:9:30am-6:00pm‚ Satz 10:00am—5:00pm,Sun:Closed‘ashDiscmmted, Price Are SubjectedmChangewithout Notice.
layencom/ < M A Y 1 9 9 7 4 COMPUTER n u n : ß
lllinrluius IIT
continued from page45
ByALAN ZISMAN
‘VlfindowsNTwas developed in the early 1990sas Microsoft's effort at a ”New Technology”operating system to replace DOS and Vlfindows3.x, following the end of Microsoft and IBM’sjoint effort to replace DOSwithOS/2.Since IBMwas working on 05/2 Version 2.0, what was tobecome Windows NTwas initially called OS/2version 3.0.The NTdevelopment team was led byDaveCutler, a well-known operating-system devel-oper from Digital Equipment Corporation(DEC). The first Version, released as NT3.1,used the popularWindows 3.1 user interface,but replaced that system’s reliance on DOSwith a more robust, fully 32—bit base, provid-ing powerful security and multitasking, alongwith long file-names, and an optional NTFSfile system.NT 3.1 was criticized for high hardwaredemands‚ slow performance, and for a scarcityof native applications. Perfonnance wasimproved with versions 3.5 and 3.51, whichretained the Vlfindows 3.1-styIe interface. Onthe other hand, even in the InitialVersion, NTwas designed to support multiple processors,
and to run ona range ofprocessor models.NT4.0, quietly released in the Fall of 1996,replaces that now old-fashioned Interfacewitha virtual clone ofWindows 95, while retainingNT's traditional power, stability, and security.MostSoftwarewritten forWindows 95will alsorun as native Vlfindows NT software, greaflyincreasing the number ofapplications that willrun atpeakperformance onthis operating sys-tem.
113/3ByKEVIN LINFIELDBack ein the mid 1980s, Microsoft and IBMworked together to plan the successor toDOS. Vlfith the enhanced characteristics(including the protected mode) of Intels80286 and 80386 processors and the avaiI-ability ofcomputerswithmore than 640KBofRAM, DOSwas showing its limitations.OS/2 was designed from scratch as a stable,pre-emptive multitasking operating systemthat could take advantage ofasmuchRAM asa computer had. Atext-mode version 1.0wasreleased in 1987, followed bya graphical ver-sion in 1988.Other enhancements included anew high performance file system (HPFS), theability to run multiple operating systems (viaBootManager orDualBoot),and the ability torun DOS programs.
and Microsoft differed as to the future, 'on ofOS/Z, however, and after a Iong_al battle, IBMwas awarded exclusive own-ipofOS/2. In1992, IBM released OS/2 2.0
fV turing a new 32—bit kernel, a new GUI, and
5 cellent DOS and Vlfindows 3.x support.MMatVersion 4.0,OS/2 isdaimed tobetheuni-
Inetwork Client,whetl1er you are accessingmntemet orona client-server system. lt isstillofthe best platforms formission-crificalappli
cqions (infact, virtually all bank machines run/2) and with its excellent Java suppoit, OS/2ld always have a place in the computing
11111111115 3/1Erlllllllllllllfi-BSG:LYNNGREINER
A indows-Iike graphical user environment (ing rious black and white)was first developed at
' Xerox Palo Alto Research Center (PARC),al: g with the pointing device now called the
' se. Apple Computer and Digital Researchnced on it in the early 1980s, and in 1985,rosoft launched its first kick at the can,dows 1.0.product didn't catch on unl:ilWindows 3.0,its colourful, icon-based interface, was
la ‘nched in 1990. Inspite of its sluggish perfor-v e, instability, and infamous crash-causing
U (Unrecoverable Application Enors), it sold
over 10million copies. Vlfindows 3.1, intmducedin1992‚washeraldedastheendoftheUAE(sortof tIue-lhey renamed it the General ProtecüonFault), and offered somewtiat perkier perfor-mance, improved stability, son1e 32—bit code, andbetter speed.Vlfindows95, inlmducedwithgreatfanfare in1995,completely ievarnped the interface and moveddoser to full 32—bit, allowing applcations to tätebetter advantage of lfne new, more powerful hard-wareavailable. lnpartbecauseoftmwayitharxfissystem memory, it tends to be more stable thanWindows 3.1, can run more progiams simultaneouslywittlotitcrastiing, and isa moregraceftil net-workdient. ltdoesnot, however, havethesecuityand the feamres that prevent applications frominterferingwith each other {hat Vl/indows NTpos-sessexalttioughflnisismoremanbalancedbyitsbetter compatibilitywith older DOS and lMndows3.x appllcations. _UntilWindows 9Sand Vlfindows NT, theVlfindmvs3x "operating system"was actually anopeiatingenvironment, a graphical interface mnning underthe MS-DOS (or PC—DOS) operating system (theoperaljngsystemcontnnlsüiebasicfuncfionsoffiiecomputer, and interprets user and software com-mandsforthehardlnrare).windows95 isahybrid(for compafibilitys sake) that loads a number ofDOSmutjnesurhen itstartsup, birtitisstfllanoper-ating system. 6 .
“Laptop Magazine
CNSWrack:BookPentium 166MHz10X CD-ROM2MBVideo RAM12.1" Active Matrix LCD13GBHardDrive
53,89516MB EDOMemory (Ext. to40MB)16311SIETEO sound systemW/FM SynthesizerInfraredFileTransfer, HPIrDAcompuam
NOTE BOOKACCESSORIESPCMCIAPRODUCTS:PCMCIA 33.6 Fax/Modem .......... S175Ethernet Card 10BT&1082 ........ .. S145Combo Fax/Modem 33.6&Ethernet Card . S395MPEGZVCard S275Notebook Memory8Mb/16Mb 5120/3240
(April 97) 1.00GSHARP und TOSHIBA Notebook Aulhorizulion Derxler.Notebook bbgrade urelcomel Call for delnils
INTERNET DREAMERIntelPentium 133MHzCPU256KBCache Memory16MBE00MemoryCirrus Logic 2MB VGA Card16BitSound Card12XCD-ROM1.7GBHardDrive33.6 FAX/MODEM CardWNoice15"SVGA Monitor.Nl/LR1.44MBFloppy Drive15“Tower Case W/230W PSMicrosoftCompatible MouseVlfindow 95Keyboard _60Watt Speakers veßswtl"Vlfindows 95c0 saß
31,595
3DLOVERIntelPentium 166MHzCPU512 KBCache Memory32MB EDOMemoryDiamondStealth 3Dvon Cardw/zus E0016BitSound Blaster12xCD-ROM1.5GBHardDrive33.6 FAX/MODEM CardWNoice15"SVGA Monitor N/1,L/R1.44MBFloppy Drive19" Tower Case W/230W PSMicrosoftCompatible MouseVlfindows 95Keyboard230Watt Speakers/W 4"swoof,5eVlnndows 95CD
32,095“(Prices & specilications are subjecl to change without notice)
uc
.................................................... S325
MMX FEVERIntelPentium166MHzMMX CPU512 KBCacheMemory32MB EDOMemoryMatroxMyst3D2MB32BitSound Blaster12xCD-ROM2.5GBHardDrive33.6 FAX/MODEM CardWNoice15'SVGA MonitonNI/LR1.44MBFloppy Drive19"TowerCase W/230W PSMicrosoftCompatible MouseVlfindow 95Keyboard230Watt S eakers/W 4'swoofVlfindows 5CD200MHzMMXCPU...+ S230
32,395
MQQITOSony 15'Sony 17'SX/SF ..................NEC 15'‚M500)/17'(M700).Acula 14 /15"/17" ..................‚Cirrus Logic 544664bit 1M/2MATIVidecßoost 1MBATl 3DXpress 2M/4M SDRM ..ATI 3DXpress PC2TV2M/4M .........ATI 3D ProTurbo 4M/8M SGFlAM
2MB W/Games ............
................................. S5153890S535. S300
.............. S43
Sound B, ter 32pnp ..........SoundBtiter32pnp AWE .16bit soupd Card ................Speake 60W / 230W .................................. S25
S59531,11031,145S585S53
S177S195
o COMPUTER PLAYER! b MAY 1997 b http://www.compiuter-playeucom/
supra Int.aoice Fax/Modem 28.8US Robotics 33.6 lnl.Voice Fax/ModernUS Robotics 33.6 Ext.Voice Fax/Modem . .Acer 33.6 Voice Fax/Modem ................................... S99*** TEKRAMPRODUCTums***
1
PentiumP5V30—B4 Pentium VX, 75-200MHz,258K Cache, MMX ReadyP5V30—B42PentiumVX, 75<200MHz, ................... S154512K Cache, 2xDIMMS, MMXReady _P5H30-A4 Intel Merl, Pentium HX, ....................... 5179256K Cache, AMI BIOS, ATXP5H30»A42 Intel mm2, Pentium HX.................... S189512K Cache, 2xDIMMS‚AMIBIOS,ATXPSHSO-WS. Pentium HX, ....................................... S330512K, w/Adaptec 7880UWSCSI, MMXHeaoyPentium ProP6F40-B5 Intel 44OFX, ........................................„S289AwardBIOS, w] stepping volrage regua/ror for future CPUP6F40-A4 Intel Venus, 440FX, .............................S3302Mb, AMIBIOS,ATX
S148
M230 PCI BusATl Mach64, ............._................... 52842MbEDO VGA/TV Caplure Card 8. TVTunel w/RM264 PCI BusATl Machart, ................w/2Mb EDO, HardwareMPEG, DPMS forpowerCYB120D Cyberdrrve 12x CD-ROM .........(RetailBox)
18-120Serial Port InfaredAdapter ........................S60
3J 111
111
j
2.1GB HD wo nxcoaomfäEIDE AC34000
2yearswarranty 4E|OD%BBDE
3279 5479 31091 3559 132942515119
F ä H1M o N r L Y S P E C I A L S
17"MonitorProview
1280H024N1LR3 yearswarranty
„PUT
Epson400/600/800
720dpV1440dpiColor Printer
E1“212195?
RemovableHDUSRobotics540MB_ Ext P3‘. Voioe/Fax/Modem
Bxfmtermanzip100 33.6 lnt.Sxcapaciycfzinfio _ Full Duplex
S499 S137
Im:m m 075CPU5121Pipeline‚SaappvrtSDRAM8MBam RAM13211212311131.09911151m114121)DRIVE111013543.5-1.4413I-IOPPTDRIVEPCIl-‘JDEw/zrzossocmr5511m,
Handle!CämuLogicam 9/1143m.m)13-mm1 :CASEW/230WPOWER sUPPLrÄfimam’104 WnosKzybmzdMEDIAMoUsmAD
S 6 3 9
9m uman...“wer26.,‘4
IntelPentium°133MHzperformanee11492-133v/25dKPifdiaszw/mmnmvxawm m m m m d , 111111115110 2.97215".
P1991729 Puts 81:92:14 efiflm„e909171121Pentium 166MHzMMX‘
5512195121047. IHunßlJHXsugpv-MDRAM -m-nsozmuxcpu,3211311110 RIIIÜHIÖOAI’510211212919», 1441-1959193»Lmwßmflm”L‘m"”’m”
Pcrpummsauampy/zossmPcmuummspuadasoegu/zfissw 1E I n, u‚Mwn. .I)Ifiubncaihmlldhflßs-Dgmnfld) Mafifßfiwmtflbfißw/mm”S3 7133312 v/ZMB EDOI-aunlffg IfQFxAIIIIHGuI/ZSWPnso-SnpfiyIFCSAHWGMv/ßhfiwsflßfl! zuaoswJrzybuue-Maüa Monat]104-7719557210.KtybamiÜMdinMouuw/fad 174973km1117123090243svaammr
.H'I7ÜP15' 1280*1024.28SVGAMmilur „X3135cmzougfig,’IOXEDECDROMdv-ivalflirsmmdhl} 60v Spmbm sauaflntasuszmw/mmtc,200W Span:m" 741912326171: Iäx/Ilfndan " * " * Uflqfliäist Wtke/Fax/Aladm
S 1 3 9 9 s 2 6 9 9 ‚\S2269
IntelPentium Pro 200MHzI n t e lPentium Pm 200CPUT-inm w/Built-ü:EIDECtri ÜBu-tI/O,256KPBCache321I1BEDORum (Lag. 1281MB)2.5GBEHJEHerdDrin:L44IPLBFIappyDrivsS3 3D 21MBE D O Rum w/Alpg’19"TawsrCm:w/230WPSI5"M ] .LR.SVGA Marxism-IZXCD_.ROMSaum!Bias-rar l6 PMPw/80WyeabnI04W» 95EnhuncedIGybawdMkrmfimauszW/jfiad
NotebooksToshiba430CDT P120 16MB 1.3GB11.8TFT500CDT P-12016MB 1.3GB12.1TFT S535051OCDT P-133 16MB2.1GB 11.8TFT 35789740CDT P466 16MB21GB 13.3TFT 58299
SHARP9300D P15016MB1.4GB12.1.DSTN10xCDROM 1331993m1115116111116311.3TF110xCDROM331m154399
IBM ThinkPad365ED 5X86-1008MB54OHD 4xCDROM DSTN 82099365XD P1208MB 1.08GB GXCDROMSCTFT 52880760E P133 16MB1.086816BITSCTFT 56799
33689
PageMart Pager
o134.95116-0111|nlt|F-166 512KHpa
3JComputer isIBM authorized retailer
saurer BEFCE!
let'sTalkModernUSR 33.6 Int. Fax PnP . 5130.95
Think epu/MotherbordThink SaVEngS
AMD 5x86-133 PcvfisA 256KIm: P-75 512K 55.11., Bunt ( . 6 . 5189.95IntzI P-12o 512K H941...9...:ca.5256.95Im!P433 512K Huhn:an Cache 5299.95Incl P-1so 512K 9.9.1». Bunt a d .5339.95
a...am man. 5469.95Im!P-zoo 512Kman.Bunt o 6 »5579.95655.5»:GA-ssehx 116m1512K s1 59.95Am Tribn Il P/I-P55TvP4 51 2k 5189.95Im!P-1 66 MMX/ P-goo MMX 3419/8699
CALL FOR AMD a.CYRIX CPU.A
8159.95
MITSUBISHI Momoas
992cm;DianondScon TSHX 15' .28DianondScan 17HX 17'.26DiamondPro0B7TXM1w12no17-25 51129.95-DimwondScan 20H 2D‘ .28DiamondPRO0911Xm 21' .28 32299.95
S539.9531039.95"‚
C o r n p u f e r
SI989.95 ÄAEMBER d‘BETTER BUSINESS BUREAU
TVVO YEARS PARTSAND LABOURWARRANTYON 3J SYSTEMS
Uskalomvmruw 5137.95USR 33.6 Ext.V/F/M F/D 5245.95USR 56|<|nt.Fax/modem 3229.95Supra 33.6 1„1.r.‚1.ac‚/.„1.S112.95Zo|hix33.6 1m. Fax/Hoden: 585.952019121316111. wand/vom: 94.95Zohix 33.6 5.1. Fax/Modem5129.95
smwt,#14MB 72Pin Simms 1:.4MB 7 2 m EDO 1'8MB 72Pin Simnls8 M B 7 2 m H30‘1 6 M B 72Pin 1_
1MB 3OPin Simms4MB 30Pin Simms f‘
1 6 M B 72m1. E001}: 105.953 2MB 72Pin EDO}; 213.95
s 25.955 26.95S 53.95s 55.95s 105.95
S 3.95s 30.95 äääääs
Zokrix 33.6 PCMCIA 5179.95IBMMwmm DSVSDv/F/M 3119.95pucxscmumn “ m a nWABNIXG P'°"‘"' "I m" UR"2
In livingColourTrident 9440 PCI 1Mm. lo 2M s 32.95S3Trio 64+ MPEGEDO 1MB s 43.95Gnu: Login: 5446 21.1:Mm s 54.95s3Vige 3D2MBMmb 36995/89995AnPmTurbo 4MB San. PC2TV 3254.95DiamondSudth64 2MDmMp2s 3109.95Diamond512118164 2Mv.“ 3D 3199.95Dinaond59.11154m, v. “ 3D 5279.95Mann:Man.2111/41:Wuu 519935/528935MainzMimque2M/4M 515555/52199:
NECVX15+ 15'NECVX17+17'
Viewsonic 17PSSony 17'SX 1
Panasonic S15 15" .21
Panasonic PM17 17' ‚.1
Provizw 15‘ .28 FLATSCREENPmview 17' .29 FLAT !saeen
SONY 1oosx .25M:SONY 15517u.25w
Parasonic 517‘ .27 LRN1
533.225: g a m m a "9SVGA 5223.95
5309.953559.95
MulfiMonioHindu 8x CD-ROMPanasonicCD-ROM 12x 5135.95PmmcD-ROM 12x 5129.95AczrCD ROM 16xMann; 16XCD_ROMAcer CD_ROM 13XPioncer SCISCD-ROM12x 5199.95168i!PnPSoundCndFuId-Aaln S 34.95SoundBlastzr 16 (PnP)SoundBIastzr 32 PnPSound Blaster 64 retail
5119.95 1.44 Floppy Drive S 27.951.0968HudDrin 5235.95 T
5159.95 12GBHudDm 5249.95" " 9 5 1 7GB HardDa» S259 95 1
5199.95 ' '
21GB HardDrin 5299.95 '
32GBHard0.9.0..“ 5368.95 i
1m) 4.063 HadDm 5479.95 ;523535 Quantum 33GBSÜSHD5499.95 «
THERESTPBICES.’
1EC o r n p u t e r
\ _ . _ _ _ _ ;
5 3 0 5 Victoria Drive,Vancouver, BC,V15P 3 V 6TeI:(604)323-9859‚323-9815 Fax: 32 -1 1 5 7Internet E-IVIaiI address:jane@direct.
VBus. Hours: IVlon-Sat 1 0 a m-6 p m
E9111Pniut aDual SoftwaresCanon 910240 61.366991...’m4.;5225.95 MSmm0“95 512°c. LBP-46O lese oodpa 3345.95 (“h5mm”52132400 72odpa
r 65323 9s Msm“ P” 97 °°"’ f5‘)‘
‚'
Corelwotdpufedstfie 7.0 7959“"231ü: m 5 ” MSEnmna 97 539'
“ä?1561er;‘i3HP Lexrnark
iauthorized retailer. call forthe bes:price
V
CD WriterSonyzxm-snöXrmdCDR 3429.95Mitrumi 2x write 6x nadHJE 5655.95Tümaba41min 6 read
‘539-95 MShome bundle 97 535
Language Leaming :Chinese Mandarin S29BortandCH:4.5 S59Duke Nukem 3D S49FirstAid 97 S49McCAFFEAnti-virus 3.0 S39S879.95
DBIVERSGHAPTERI
o s / 2
MDI INTER
mraaqaaequa-aan. max-ums ’
I SIL4RPNOTEBOOKPC-9300DPentium 150, 16MB, 1.4613HD, lOXCDRom, l2"D’STN.Windows 95andMultimedia included. ONLY S3580 cdn
I OVERHEADPROJECTIONNOTEBOOKPentium 100, 16MB, 2.lGB HD,SXCD Rom,OHP TFT LCD 10.4
I PCMCIANOTEBOOKMODEM (IARDGVC 536, 33.610305 0m S318 cdn.
I 56K1.514HVIERNETMODEMCARDRockwell technology, 33.6 kbps also ONLY Sl18cdn
CALL USNOWAADGETCONNECTED!
i‘ MDI Internet Inc.Suite 7001080 Howe Street,Vancouver, 15.0.V6Z 2T]Tel: (604) 602-9168 Fax: (604) 602-9108 —
http://www.mdi.ca Email: [email protected]
Presentation Kit,Windows 95andMultimedia includedONLY S4680 cdn
NET
Take your notebook and modern everywhere you go!Weinstall all the Software for you, justplugyourself in and you are ready to go!Greal for Business travellers MDI INTERNET hasGlobalRoanling InternetServiceWith over 150cities all over theworld.
‘Q COMPUTER-PLAYER! p MAY 1997 > http:llwww.co mplter-playeucoml
Smart-Suite 96finally arrives!
--ByKEVIN LINFIELD o o
or ycnrs, Lotus has becnpromising its OS/2 uscrsan upgrade to SmartSuite
2.0 for OS/2. We've seennumcrousWindows rcleases and havcpaticntly bccn waiting fora slew ofnative 32-bit OS/2 applications. Weil,that wait is (kind of) over. Ycs,SmartSuite 96 for 05/2 has beenrclcased, but...By lookjng at the Smartsuite box‚
first imprcssions are that it comainsOrganizer, Freelance Grapbics, I-2-3,Word Pro, and Approacb. Reading thcfine print, you will soon discover {hatthc box only contains two nativc OS/2programs: Word Pro 96 and FreelanceGrapbics 96. The catch is, Lotus hasalso includcd SmartSuite 4.0 forWindows 3.x for 05/2 uscrs to rununderWin-OS/Z.Installation of the SmartSuite 96
package is in three parts.You must firstupgradcwhatever Version of OS/2Warpyou arc running (OS/2 3.0 rcquiresFixPak 26 or latcr-includcdon thc CD-ROM)—and OS/2 4.0 rcquircs FixPak 1or latcr, which you must downloadfrom thc Internet), install thc twonative OS/2 programs, and thcn installSmartsuite 4.0 for Win-OS/Z. I"knowbeta versions of Organizer, Approacb,and 1-2-3 for OS/2 all exist, and I 'mquitc disappointcd that Lotus did notfinish them bcforc rclcasing this prod-uct. Loms claims that they will be partof SmartSuite 97 for OS/Z, duc out laterthis year, but I thjnk (hatOS/2 uscrs aregetting tired of waiting.Shut the WlndowsI’m going to ignore thc sct of
Windows programs, a5 Smartsuite 4.0is old news, and focus on the nativcOS/2 programs. Lotus claims (hatSmartsuite 96 i5‘TheDesktop SolutionFor You And Your Team,” and a5 suchincludesTeam Computing fcaturcs sucha5 TcamMail (lctting you mail a filedirectly from an application),TcamRevicw (lctting you controlrcvicws of documcnts and prescnta-tions), TcamConsolidatc (a mcthod ofcombining thc rcvicws into onc filC),and Tcamsecurity (allowing the authorto control who has acccss to a WordPro documcnt).Smartsuite 96 has full Internet and
intranet support, allowing users to load2nd save HTML documents (Withoutknowing any actual HTML Code) andeven post Fheelance Graphit: prcscntn-
WWIILZEUEII-IIIILIIIIM/CIIMPIIEIIIIIE
Enioy your tour to thesites ofmany local
Computer stores andßrowse tfirougfi our
many features includingHat Deals Corner
New product ReportsCool Links
Monthly PrizeDraws
‘ Come to visit us_ atwww.zeven—|nc.com/com u undeand enter our Luc y raw
SPONSOROFOURBIGPRIZE
.4 . ‘E. L‘. ‚ m 3 , .
III IEIIII‘ PIIII II |I|VWVWZEVEN-NCOOWBLISNESSIPNETHTM
MeetAdrianne. Shewasbom with asthma—achronic disease affectingmore than 100,000British Columbians. Butthanks to the B.C. LungAssociationß work inresearch ancl edueation,more youngsters lila:Adrianne livefu", active,healthy Iives. Andbetone what they wer:always meant to be. Areal handful.BRITISH COLUMBIALUNGASSOCIATION
H: (604)731-5864 u: 1-800-‘665-5864
rom page48continued f
tions in HTML formats. Using thcscproducts has been made easicr 2ndmore producüve With the addition ofLotus Smarthtlasters, Assismnts, andthe InfoBox help (und information)tools that Smartsuite 96 forWindows 95 users have used for ovcra year.
I
Which makcsme bclieve (hatLotusis finally trying t0 have Lhe Same
fimctionality betwccn thc Windows2nd OS/2 versions of their products.Freelance Graphit:2nd WordPro forOS/2 are just like their Wmdows 95
' 4- counterparrs, acept that they offerdragand-drop support, REXX pro-grammability within Lotusscript rou-tines, 2nd support for OS/2 4.0'sspeech navigation 2nddictation. Let'shope that the Samewill be said aboutOrganizer, Approacb, 2nd Lotus I-2—
'
3 When native OS/2 versions ship inSmartsuite 97.Bug free, but still a bit trou-blesome
Fortumtelyfor OS/2 users,there donot appear to be any major problemsor bugs with these two programs.Somc of tbe annoyances appcar to bea resultofEBM's Fixpaks (somctimesWord Pro will give an error when
RO_
exlt the application) and the pro-j‘ s are very feature-rich, meaning
usetsshould take the RAM requiremcntsto cm:32MB is a good lower minimumfo this packagefhe Commcnt Notes (orsti pads) arc a great idea and extreme-
eful.c thlng t0 watch out for is that Wordmuses LWP 2s the filename extension
forfits documents-the samc 2s the IBMW las Word processor (which is includ-ed in every copy of OS/2 Wal-p). If you
switching from IBM Werks to Word
Fuji,be warned that Word Pro can’: han-dle;IBMWerks files and you will have tom I‘
ually convert them-and ideallyde
Vgistcr IBMWerks. .
. e Smartsuire 96 package includesLhrpe min manuals: a Getting Started
guiFle, a guide t0 Word Pro 96, und ato Freelance Grapbics 96. Lotus
in ‚uded extensive online documenta-tio__ 2nd the l6-bitWindows Version ofAdobe Acrobat Reader, since the docu-m " tation is in PDF format. l’m not surewliy Lotus did not includc thc nativeOSNZ Acrobat Render, but users cando nload it from httpJ/www.adqtbecom/Nohespect?
I
c Smartsuite 4 for Windows CD-comcs in its ownCD jewel casc,
butfz the OS/2 CD-ROM was hidden in ap V
white paper CD sleeve as if i: were
YO
1135196611;Jagda
. .651: 3mggxtzseoup-Iagmju osw/z mgp._4.o<
added as an aftcrthought.My conclusions about this packagc?
Too little, too late. I’m tired of waiting forthe full-blown suite. If 1 have t0 runWindows programs underWin-OS/Z, I'mnot sure if it would be Lotus Smartsuite4.0.For the time beingJwill continuc touse IBM Werks for my word processing2nd spreadsheet needs. O
I1
NANTRON SYSTES LTD.THE BEST DEAL ISHERE !NOWWE OFFER YOU FREE INTERNET ACCOUNT,DETAILS IN STORE.iP5-120 8136s INTERNETBRowsER '
IP54” 31398 0NLY51158IP5-150 ä|mflh1xwg+pmmggncpu+pmg
cgoL PARTSSELE'I'IONSM0 ERBOARDT NVXPENTIUM512KB F9C 752(.‘0.....7.358TM
* H I G H E N D *
iP5-166 5212821 88223824381988
S2038„sasnx TRI'l’ONHXPNP MIB.512KBPIPELINEBRUSTCACHE.32MB EDo RAMEXP‘LTo 128MB.2.593 EIDEHDDMODE4.1.44MBFUJITSUFDD.ON BOARDEIDE/FDDIEIO.2USP(16550) 1P(EPP) 1M(PSI2).MATROXMYSTIOUE4MB 3DMPEG.15' 2a NILRGRFLATMONITOR.(ADD321a FOR 17'MONITOR)‚FUJITSU 104 ENH.WIN95Kra.33LOGITECH P312MousE a.PAD.19- MIDCSA TOWER OASE.12xEIDE CDROM DRIVE.SOUND BLASTER32 PNP cARD.zoowSTEREO sPEAKERs.usR33.5 INTvo|cE FAXMODEM(UPGRADABLE1o 555K).MICROPHONE INCLUDE.FREE INTERNETACCOUNT
NHXPENTIUMMZKBPXNTXPENTIUMSIZGPBCEZD.
iP5-166 S1528 ‘IGMBRAIIJZGBEDEHDQIAMIBFDD :iP5-166MMX 51588 ISIIÜWIIPIECPIIWPMIIWBIPSRIIGS T
ip5_2oo 51648 MINTFAXHOEIGBITSOIINDCARD| P 5 _ 2 o o M M x 51848 ESMIBVDEOJPIHLRGRDIGIIONHOR
cx6xs6-166+ 5133s “ämm'°’sf“snxä’n'u‘ä‘r’äol%*.m’
CX6x86-2O07I- S1438 FREENIERNETACCOUNT.TRITONVXMMX DIMM PNP MIB .12x IN'I'. EIDE CDROM DRIVE. 512KB PBCACHE . (ADD840 FOR16X). 16MBSIMM RAMUPT0 128MB . 16BlT3DPNP SOUNDCARD. 1.768 EIDE HDD MODE 4 .(ADD 840 FORAW32CARD). 144MBFUJITSUFDD .60V‘!SPEAKERSACPOWERED. PCI 64BIT 2MBMPEGVIDEO . DESKTOPMICROPHONE. ONBDEIDEIEIOIPSZM PORTS . 7 MPCCDROMTITLES '97. 14" .28NILRGRSVGAMONITOR GROUER ENCYCLOPEDIA. 104KFUJITSU8725VVlN95 KIB ANIMALS‚ HOMEOFFICEASS.. 2BLOGITECHMOUSEWIPAD CHESSMASTER4000. 15' MID TOWER CASEWICOVER USANDWORLDATLAS.33.6—lNT. FAXMODEM . (MICROSOFTHOMEADD 538)
RIICDUG I I - I I . _ Y ' F Ä Z Y Z I ICDIG:1- 2 v v 1 4 R c 1 : V V R I T E R — P J \ 3 I < A 3 E s s s o2- 5 4 0 2 x 4 1 3 I N - r n E n n o v A a L E H D D S 3 6 5a- vamunnuasonna v v l n r l - A B L E c 1 : 8 0 - 9 9
1745 NANAIMO ST. (Near 1st Ave)NCOUVER, B.C. V5N 5C1wEoIII=IFE R You TOTAL” MSOLUTIONS! TELfiäomääflhfgfilTFEÄKJQOäKfiSBrBGS1
Iter-playencomliß COMPUTER n n s a 1 > MAY 1997 p htlp:llwww.compu
UJhu will prnduce the I15 uftht future?0 0 ByPAULANGYAL 0 I
On page 45,youwill find capsule histories ofthe major operating Systems. In this art iclql
increasingly networked enviroriment, NCswill get their functionality from the network(any network) and therefore (hexewill be noneedfor any local opemting System.Oorel,the
thqplient-side beta Version of its Qfiice suiteforJava (server side to follow), completewithWoMPerfect, Quattro Pro, Presentations,CortlCbam and an e-mail Client (hatrunsany-
ment (see httpJ/officeforjavaxorelxoml).There's moxt:attacking the soft underbdlyof
the WinTel Camp, Sun oflers an inexpensive
will attempt to chart the future of the OS. Canadian Microsoft wanna-be, just teleased offering virtually unlimited deploy-l f I was the Oracle of Delphi, the clairvoy-am in ancicnt Greece‚I wouldn’t risk my job i"
and high StandingWith Zeus on this assign-menLThings are changing so mpidly in theComputer industry that any pnediction pastthe next 6 months can be as accurate as try-ing to foretell the winning lottcry numbcrs.Since the dawn of theComputer e111, the three
main components that make a Computer havebeen the hardware (the box), Software (pro-gtamsxand theOS (the subprogxam thatmakesit all posible).Fienceiy unique ancl singie-tnind-edly proprietary, operating Systems wen’: dievehicle Lhatcreateda capüve dient base,museddevelopets to write pmgmms on their specifi-cations,and influencedhardmre developmmt.Distinct Lrends are cmerging.OneOS Camp,
Microsoft, attempts to keep or expand itsmar-ket influence and dominance by incorporat-ing new “netwotkcapable” feattnes, promis-ing the kind of crossplatform independencewhere Lhere is no competition. Microsoft'sprimary goal seems to make Wndows NTdominant in the networkedWorld (a5 Weil),with machines nmning on Intel processors,mostly PentiumP10,whether full-sizedPCsorNCs (network Computers).The next release of V1195, Code named
Memphis, has been delayed until next yearand the accelcrated development effort isgoing into pushing NT rclease 5.0.Microsoft's strategy is clearly visible: to main-tain its grip on its installed base and createnew tools in its own image (likeActiveX) asto make departure for other pastures unde-sirable. lt might work, or it might not.
Separation anxlety?The other gmup. represented by basically
Est. 1988 Helping people&combuterswork together4. ‚i
Aretä 166-1}Cyrix 6x86 P166+ MHz Processor
16MBEDO RAM256K PipelinedCache1.44MB3.5"H;2.1 GBHD (10m/s)12xCD-ROMf
Ess1868 16 bit PNP Sound CardMatrox Mystique 3Dw/2MB SGRAMUS Robotics 33.6 Fax/MpdemNoice
104Win 95 KeyboardLogitech 3 ButtonMouseVwndows 95 CD SRZWorks for Vwndows 95
17"Hyundai DeIuxScan 17MB ColoiiMonitor with SpeakersMiniTower Case
Warranty 2 Years Parts«& Labour32,099
I:
Hyundai DeIuxScan 17MBOnly S549
While Quantities Last“everybody else,”embarks on a Separation ofhardware and OS, romofing alternatives in _ _ . .bothwimmeproifiiseofsigtüficantperfor-‘ IBMPC34O H'ghl’g'i'ts IBMPC35O Hlghllghtsmance bonuses. 3 p‚„„‚-„„‚ „ m m Ä o r uum 166MHzum:orzoom-Izuuxln this context,Apple‘smarriagewithNeXT 3 25610-2 Cache f 2ämügflgmo„ M ,
is more imeresting than it appears from the 3„ , 5„„„„„„„‚ a PCI/ocalbusvldoo 1MBt?rhoIIerwedding invitation. Rhapsody, the new 3 2-568 harddfive gäfiggflm”MacOSbabx has a prodigal feature: thanks t0 g5und6.” x o 1 a b i u w psogmdcgm
the gcnes from its daddy (the NcXTStcp OS), 3 US-Robotlcs33.6 Fax/Modenyvolco 3o i c oit will tun on PCs cqujppedWith Pentium or g " m m "
Pentium Pro chipsAnd it Will be quite a bit a 3 YearsWamJnyPaItSGLaQouI P155MMX. 16MB .............-. S33??( “ m m 3 ‘°“ m !m“ ‘°8° 9°’“m” P166 .................................. s2,749 P200MMX’ 32MB """""""" s3 i
faster thanNT 4.0 on the Same Intelmachine. i
So, on one hand we will have the new, "
mvwvedwdows-On im oflwnm dual‘ LxMARKoptraR+platform newMacOS, the Rhapsody. Different 2
17„„ a m “ORTphilosophies,but we are still talking platforms.
133MHzP°"""""QP’°°°”°’ ozsApenuaGrillePitdx3 1 1 1 m m svGADts 1280110 Hz
8 0 0 m 90min?‘ü’
"mthisisthe „ging...Fm“ü": Km‘; Kmg °f ‘h6 OSmm8’ Sun?’ Only 3 iäiifiaam bcst primeron 3:33:35:Javasofnwhichwants t0 replace 31loperatingSYS s3 399 a manage: 9s "Q
tcms by making them obsoleteJIruqJavamight' 2Wg???“ m‘ mark“ '
be nothingbut cute little applets for some,suchasatidcertaperumxingacrossawebpage.Microsoft stmdfiasflydecries its true value (Gatcsat the San Francisco Software Dcvelopefs
‘Üefififetencezjava is no HolyGrail)‘,defining it a5just anotherprogramming languagc.The truth of the matter according to Sun i5
that Java offen-s much more than that. In an
AretäComputers2445 Cambie St,Varicouver, B.C. Tel: 873-2440 Fax: 873-9167
http:I/www.computer-piiayeucom/1 MAY 1997 4 COMPUTER n u n : Q‚.1|i „
0 0 ByJACQUES SURVEYER 0 0
hese are dog ycars on thc WcbffheI.__________ __.> functions and featurcs of Web: page editors 3nd other tools: changing rapidly, so arc thc needs} Of uscrs. With intranets growing fast,JUI] l thcrc is the need to gct at legacy docu-1 mcnts (95 per Cent of an organizatiows
information basc is typically n0: in dam-bases, but in files and papcr documems).Likcwise, a broader class of uscrs wouldlike to supply or update pagcs on the Netand they don’t neccssarily Want t0 learnthc intricacies of HTML.This rcview ofWeb authoring tools takcs
a look at these cmcrging Wcb-uscr com-munities, trying to match tools t0 users.First timers and HTMLphobesAn illustrator colleaguc asks thc right
question: "why should I have t0 lcam thchieroglyphics of HTML?”Unfortunately, although Wcb. Word-pro-
cessing, and dcsktop-publishing vendorssay thcy have heard, gctting to thc Webwith any fidelity is not casy. Word 97,Quattro Pro 7, Word Pro, Excel 97,WordPerfect 7—none _camc closcJust one pro-gram,Microsoft Publisber 97,could pub-lish to HTML with fidelity.Yes, Astound, Powerpoint, and Corel
Presentations do a fairly good job of pub-lishing slidcs t0 the Net, but only usingframes and/or monstcr GIFS. Yes, CorefsVentura and othcr Barista-cnabled pro-grams produceWeb pageswith fidclity, butonly using Java, not HTML.Even Publisber97 sometimes has to convcrt heavily for-martcd tables and text to GIF images.Bottom line-uscrs wanting t0 stay in
Word Pro or Excelor even Pagemaker arcgoing to be frustrated ifWYSIWYG (whatyou sce is what you get) is importantwhen publishing HTML to thcWeh.At least therc arc easy-to-lcam visual-
pagc editors, right? Strikc two! Thcrc arepowerful page editors, but thc big casy is
XMAGED UHGRADES
ääl-H’
__IEwl
\ l
33:3cE COMPUTER OUTLET ä118-4800, No.3 Road, Richmond, 81C. Canada V6X 3A6Tel: (604) 278-2633 Fax: (604) 27812661
T"
17iÄTTN: Electronic hobbyists4Smart buyeArs,Build your OMMTT Esystfem orupgraae "your. Ssystem from 23s m33s m43s. WETAKE TRADE-INS TOO!!
äWe have Lawhugeiselection of new items in-stock.
351%
äaflä}„ o “ „ O m a s o NEW AND USED COMPUTER PARTS & COMPONENTS.
o WE ALSO PROVIDE SERVICE, MAIANTENANCE,REPAIR AND UPGFIADE OF COMHUTER SYSTEMS.
saturday o WEPROVIDE SERVICE FOR CHANGING POWERggggagng-„gggg: SUPPLY COOLING FAN AND MONITOR REPAIR TOO !
closed o FREE ESTIMATES BEFORE ANY WORK REQUEST.
Monday-Friday11:OOam - 7:00pmnlll-(‘U
F
E15im
MONITCTJR
MOTHER
BOARD
RAM
COMPUTER
ACCESSORIES
AFLOPPY
DRIVE
CASE
INTEL pENTIUM SySTEMS UPGRADES SPECIAL (New Items) hat-dm find_.AsymetrixWebPublisber (PConl)Cl H P e ( P C a n d M c )P_120 S1050 PJGSMMXSHlOO uumedm1 n : o v .. 64 Bit PCI Video Card Y = “f” _0 ' ” ? a8 3 v_30mm Bhste,16 pmg&p|ay 3 Wim 1mm“______usw/Sao Symantcc s Vzsual Page (Mac only), andP -133 S1100 P -200 S1450 . —Speakers (Amp s.power) + S250 5 Ergonomh Keyboawunsü, Thunder & Lightninxfs Weh Factory
P_166 S1280 FZOOMMXS1660 Modem/ Fax 1 m Autbor come closest. Check out a dcmo-33.6 SIRV ' S110 5 ' ', Wim Intel CPU 8‘ fan Memo”0'439 +
1V 3:13?
first and figurc on brushmg up on* Intel Triton Chipset Motherboard -32M E00RAM (72 Pi") + S120
/256K PIPE UNE B t RAM Hard Drive COMPUTER ACCESSORIES HTMI. pros_ _W Urs -21GB Mode 4 + 55 "mm 573° & “W Okay, for thc HTML pros who could usc* 16MB EDO RAM (72 Pi") M3333, i511}: P°W_e" SUPPW‘ a littlc morc assistancc than Visuala: E Monitor V
'
I
:ggggng {anNotepad (Windowf simple {ext editor);„ 144MB (3 1,2..)Floppy p
ÄOSVGAN1LJR .28dp '+ S110
‘Efivyfgfägrd 6'therc are tHz-ee very good HTML assistanfst _ _ _ _Set df IDE/Flop” cables from whnch to choosc. SoftQuqdSPCI 1MBVndeo Card (exp. 2MB) -ATI Mach64EDO 3Dl2m + s11o =
„DE Cm—
„oTMeml „o 50 ‚cm5 „m, an cdim,* EIDEWlth 2X 16559. 1 Para P011 ßfitfiäfih64 EDO 30mm V+511° 'g:‘a::?gPY (Sitz: packed with four toolbars plus many diai*14"N/I L/R SVGA .28dp,Monitor _33mm BJC_4100C „5,99 —3.5' or 5.2% um Cleaning m o
Iosues t0 Show"! HTML editins 61101€»a: 13v:Mini Tower Gase pMouse 2 :mgäsecäg (Set)
Not far behind is Anawave HotDogt 104Wind s 95 K b0 rd —Microsoft/Logitech (OEM) + 530 Hangwwe. 3.0 with its HTML previcws avnd wizards’i _
0W ey a CD-ROM ’ -Screws, Studs. Edge Connectors. for plug-ins, Scripts, audio, vidco, and soMOUSG 8:Pad - 16x + 535 03m5’ "an 5““ on. Thrccs arc Wild as Brooklyn NorttrsTWOYEARS PARTS s.LABOURWARRANTY FOR SYSTEMS HTMLAssistantPro 3 *5‘h6 Choke f°rs=t_:cum an Pofic
‘v ting up to speed all th; latestHTMLtagä_N062h ‚äund y ‘ :ü’)avgveapgiesgrau/EIS and features. In shqn, if you prefcr t0 fid-_M; guarantee onavaflablily o!Sdvgrtised iiems -AI! brand „vewegems have 2 yea/ warranry dlc with HTML,you havc plcnty of
A M03! «Iems have Jumrred qagnruty «efirs! come Inst sen-e basrs. _ ' - AI/ used parrs ' cornponen have 30 days vlarranly. webauthoring choices_ --AI! sales aIe final.‚
. - AI! obsolere & dazwage Ire ‘have nowananry.
EI * 5 } : «c 5E-nnH1g E2. I21 g 7%fi x . L‘Mac User‘:1% fäiäflääää‘ Tn MacwfiilxriblfQouliwfdlflmt°wifig
4-
i3 COMPUTER PLAYER! > M A Y 1 9 9 7 > http:I/www.comgiuter-playencomIz‘
i’
continued from page52pioneers in Web-authoring tools-fai- theFirst and some of the best visual tools, thcymay be right.Adobe PageMill lcd the way towards
WYSIWYG Web-page editing. Followingthe desktop publishing approach,PageMilI hides the dctails of HTML tags.for the most part,with drag and drop posi-tioning of Web-pagc elements. PageMillprovides powcrful and easy-to-use editingof tables and frames.Symanteds Visual Page picks up on this
theme and adds more extensive editing ofproperties, and frame templates are han-dled more gracefully. NetObjects Fusiontakes the template theme to its logicalconclusion, allowing image, colour, andfont themes or stylcs to be applied t0 anindividual page or group of pages.Even ona Mac, however, these visual-page editorsmay be easy for the pros, but they imposepretty substantial learning eurves for mostusers.
Webmeister ToolsIt's a sign of the times-the best Web-
authoring tools are on the PC. Adobe’sPageMill 2, Corel's Web Designer ].2,andMacromedia Back Stage Internet Studio2 offer strong WYSIWYG page editors.Corel and Macromedia throw in a bushelof clip art, animations, sounds, and othergoodies. The best Web-authoring tools,however, arc currcntly Microsoft FrontPage 97 andNetObjects Fusion 2.Look at the list of common features:
I. top notch WYSIWYG page editorsable to handle frames, tables, andforms, a5 weil as images and text withdrag and drop ease of placement andrevision;
2. site view with the ability to add, edit,and delete pages, verify links, andpublish selectively;
3. ability to import a page or a site withall or someof its asscts (images,soundfiles, and so on);
4. modiflablc pagc templates for the pre-liminary layout of a new page with acommon,consistent imagc and style;
5. simple database connectivity with theability to make forms and pages inter-active through built-in or user devel-oped Scripts ot Java applcts.
These featurc sets alone would allow a
p
Wcb creator to dcvelop a complctc 50-pagc smtic sitc in one t0 two wccks—twodays, if presscd. To modify that site andmake it interactive,however, the two toolssoon part company.MicrosoftFrontPage 97 takcs a wizards
approach-cverything from Initial SiteSetup Wizard to WebBot Wizard for crcat-ing form-bascd pagcs. Thc intexaction isweil thought out between the wizards andFrontPage's two main viewers:Web pageeditor andWeh Explorer (a site view thatcan launch other editors and/or wizards:see Figure 1).For example,aWeb to-do listwas created automatically by the InitialSite Setup wizard.This is a robustWeb-development envi-
ronffhe drawbacks are a substantial leam-ing curve (about midway betwecn a word-processing and a DTP prognun) plus theawkward table- and frame-editing func-tions. Finally, Front Page takes advantagcof Windows-only fcaturcs such a5 Activex,Vßscript, and active server pages, soWcbmastcrs should be careful if crossplat-form portability is of eoncem.NetObjects Fusion 2 takcs a templates
and hide-thc-HTMI. approach. Fusion hasno HTML tag editor, unlike most of theother tools. Users develop a site from thetop down. First they select from over 70templates one with the buttons, fonts‚ andlayout they want to use throughout theirsite. If there is no template, Fusiorrs styleeditor helps set up one. Then, users addpages in tree-view fashion: each new pagefollowing the templates layout. Move apage and Fusion takes care of updating allthe links.This is what I like-helpful yetWeh and image smart.At any time, one can switch to the page
editor for adding tables, images, para-gxaphs, and so on. PublishView allows forlink checks, site-wide spcll checking, andother site testing, as well as publishingfunctionsAssets View helps to manage allthe images, audio, Video, and scripts.Fusion was a bit easier to set up and
learn then Front Page, has much easicrtable and frames editing, but workingwithout any HTML tag editor took a whileto gct used t0.In sum, either of these tools will allow
Webmasters to quickly set up some veryattractiveWeb sites.True,Java applets,CGIScripts, plug-in special effects, and otheraspects would have to be rcfined and
http:/lwww.computer-wayencoml 4 MAY 1 9 9 7 4 COMPUTER PLAYER! 3
deieloped elsewherc. But these are thet Webmasters (and even the SOHO and
office user) should fire up to create,manage, andmodify theirWeb pages.
LebÜPacyDocuments
tote and more users are being con-
fropted with the problem of legacy doeu-mepts: setting manuals onto the Net, for;alldwing customers to see a catalogue of
designs (whichmay be comprised ofelektronic and/or paper images, fonns,drqwings, tables, or other things); ot trans-
ferfing brochures developcd in Wordct or Pagemaker onto aWeb site.wc havc already seen,application pro-
grains like Word processors and spread-shqälcts do not reproduce documents inHTML forma: with WYSIWYG fidelity.Special translator programs like OfiiceAcfjess HTML Transit 2.0 do only nlargin-Lbctter (these programs do offen" the
adyantage of large-scale batch translationsanthe ability to map DTP/word formatc s to HTML).Spif you arc a SOHO or office user andyoii nced to get a lot of documents up t0
the;Net withWYSIWYG fidelity, you havelhrjte choices: import the files into aWeb-pagÜe editor but be resolved t0 a lot of addi-tioipal cditing; import and usc Java-cnablcd
pages; or import and use specialviewer-based print files.qprePs Batista technology,which is illus-
traqed in Ventura 7 (and soon will bcimplemented across CoreI’s product line)offers the first alternative. Output ofBaijista Weh pages is just another printmenu option. Barista pages can be viewedwith great fidelity (see Figure 2).FhtureTense‘s Texture works in a similar
mannenThc advantage is,no viewer has tobe; distributed with your Web pagesbeqause the etnbeddcd Java Code can beused in any Java-enabled browser(Netscape Navigator 3.0 and above,Microsoft In ternet Explorer 3.0 andabävc, and so on) .Agdobes Acrobat, Corel/Novellts Envoy
format, and HummingßirdsCommonGround are able to accomplishnearly the same fidelity, but a! a price: theyrequirc cither special browser pIug-ins ora viewenAnd all of the special file formatspresent an editing problcm, becauseHTML editors don’t work with these spe-_cial formats. In general, faithful translation
j:n
Es
l0on
i-‘sillffleMob:angelnz.513a.llttpt/lwwmflobmmn/Mannnoch;In 3. 860.IIwnl/wwuanawnaonlAsynelflxWehHitlisten S134.htqn/lwwwmsyneuucom,noouynuorunrutmbtmnuanzs.http/lwwlmbvuoknorfimn/GutHaag:2. S143.httyrJ/wvumdnrlzcon/cmlWeh Designer 1.2. 8129.httpzl/wmmeorelcom/( u !Hurt 7du: I a lsh , Adobe Auch-t, und[an].5843.lhnnhglkdConnnofinnd3.0. S305.Intwl/wwulannhgbklun/U g a n d aneu-g:Haie!z.am.51.367(E)httpcl/numnaan-ufinon/neuennurPage 97. m7.hujnl/vumnflaonfbcon/Metoblamfinden 2. S740.Hflpil/UUWJIGOHCGLCOII/saaqnduonun: 3.S164.htqn/lwrusnfttpndxon/sy-amvxwdrage 1.S127.htqnl/wuvnsymanteecon/finde! i Uptnhg Weh facto?! Jahr. 860.httpt/lwwnlleoxon/Mm toutesy of Schande.
of legacy documents to the Web will con-tinue to challenge users’ ingenuity.ConclusionAfter being promised so much Web-
enabled application suite software, thedelivery, with the exception of Corel’sBarista-powered tools, was a letdown. Sotoo, was Netscape's upgrade to NavigatorGold, called Composer. Composer is stillmissing a framcs editor, image hot-spotediting, and simple GUI amenities such ascustomizablemenus and toolbars. Lookingat the big picture, however, it has takenWebauthoring tools 3 years t0 arrive atsimilar feature and excellencc levels thatdesktop publishing tools have takcn 10-12years to perfect.
Jacques Surveyer isa consultantwho isinterested inyourlegacy document-to-Web solutions atibsurvflinforampnet O
IIGOIWGI.
I O O O O O O O I II
o o ByROBERT LVSAAWYER o o
Here’s a trick that'll malte you moncy:every time you go to a party whcremore than 23 people are present, betsomebody a dollar that two people in
. the room have the same birthday.Youwon’t win every time, but youwillWinmore often than you'll lose.There‘ll be a newVersion of this trick
a fcw years from now:betüngwhetherany two people watched the same TVprogram at eight o’clock last night.Right now, with only about 50 choicesin even the best-servicedTV markets,you need just nine people to have abetter than even Chance that two ofthem watched the same show (assum—ing all choices are equally popular).But soon we’ll have a. thousand
choices-meaning people will bave tochoose almost at ' random. With thatmany choices, you'll need a group of58 people before the chances are bet-te r than 50:50 that any two of themwill have tuncd in the samc shownind,of course, the odds are only one in athousand (hat the person you to whomhappen to be speaking watched thesame show you yourself did.For half a century, television has
lechnulugg and themade up the background of our day-to-day lives: cveryone knows Lucy andRicky, Kirk and Spock, Columbo, 1.1l.Ewing, and Seinfeld, Kramer, George,and Elaine.But tcchnology i5 about t0 change all
that.We’re on the verge of having notjust a few dozen channels to choosefrom, but many hundrcds.Even if you'reonly lntcrested in English-language TV,you’ll have your pick of Canadian pro-gmmsmmerican programs, British pro-grams, Australian programs, Jamaicanprog1ams‚and dozensmore.And that's not all:multimedia produc-
tion capabilitieswill soon be within thereach of evefy computer user, andcable—TV companies are moving to pro-vide Internet access. Desktop TV willbecome a reality: just as anyone todaycan publish his or her own electronicmagazine, so tomorrow every homewill potentially be aTV Studio.What happens to culture in a thou-
sand-channel universe? Pm not talkingabout highfalutin’ art-Pm talkingabout shared cxperiences and sharedthoughts. _The answer is that culture crumbles:
the more choice we have, the fewer ofus will malte the same one——and the
_people rcading the
fFoofls Boom, Bus: and Ecbo(the number-one bestselling
:the bad or poorly conceivedgideas in that book havc beenfgiven considerable scrutiny
fewer things we’ll share.As a writer, I'm ambivalent about the
ibookstore chain called Bcstsellers.r You've seen it: little shops in mallS (hat7only stoclr the top-tcn titles. My books;never show up in therc; neither do-most of the ones I cousider Wortli-Iwhile.But, still, there is something to be said
for having huge numbers ofsame
works: the good ideas in David
book in Canada last year) arenow shared by a large percent-age of the population——and
and roundly debated.As traditionell publishing dis-
iappears, though, thafs goingEto change. Everybody will be reading‘something different, downloaded froma different Weh site. New ideas won'tenter the culture, and analysis of whafsbeing presentedwill be spotty at best.Each" member of the Seinfeld cast is
getting S1million per episode next sca-son. ’I'hat makes economic sense only
Guest Colrlnnlst
Robert
enrl nf culturebecause so many people watch thatone program. Now, Seinfeld, 60Minutes, and Traders are all terrificshows-but without big audienccs,they can’t survive.Fragmentation is going to result in
more choice, yes‚ but the choices willbe of lesser quality. Instead of oneSeinfeld,we'll have countless no-budget
home-produced shows, evencheesier man the one depictedin Wayne's Worlds.Marshall McLuhan may havebeen right in the 1960swhen hesaid that n e W tcchnologies wereremaking the world as a globalvillage-but now we’re on theverge of seeing that villageBalkanized- It is possible to havctoo much of a good thing: wheneveryonc is a creator‚ who willbe left in the audience?So, enjoy Seinfeld while you
can. lt may be one of the last broadlyshared cultural experiences the humanrace ever has.Robert |. Sawyer ofToronto won the Sdence Fnctionand Fantasy Writers ofAmerica's Nebula Award forliestNovelof199S.His Iatatnovel isfrumeshift, pub-lished byTor. O
® M O T O R O L A
StaLB/Iaf"MACSTGreater Vancouver's Best Selectio ofMacintosh Software
TIONi
UMAX suPERmacCorrputerCorporation
NoPayments, No lnterest for 3 months on any purchase over S250with the Mac Station CreditCard!
PowerßookM00SeriesStartingS2249
AuthorizedDealer
Performa 56400/180with Muhiple Scan I5AV
per mont
Base-d cn pvrchose uCredrr Cord (OAC!o repocd 04er u3h mourh Ievm o! an nnunl inleresl role n! 2b 93’.Feriorrm 6460/ I80Apple Mulnple Scun 5AV regulor pr|ce‚ 5049
ll
Performa t:b400/180nderlS99
per monfll” [cmonly]l
S129
the Moc Slot-oh
ulor price. S2099
MAC STATION 466-0190
22353 Lougheed HwyMaple Ridge‚ BC
http://www.mc1cslation.com
Burnaby, BC207A -3430 Bri htonAve
4205224 / 80 Q63-MACShnrx//www.macsßation.com
Burnaby Store Grund Opening on May 10.Stop by and check out our great speciais!Bring in ‘rhis ad and receive 10regular price on your choice of in-stock sottware.
O.so oft o?the
o COMPUTER PLAYER! b MAY l997 > http:llwww.computer-playeucom/
i
LIMITEDTRAVELBUDGET.For Iess thun udollur uduy, Iet iSTARinternet tnke you virtuully anywhere inthe world.
We'll give you customized Internet soft-wure that's eusy touse; help 24hoursuduy, 7duys uvteelf,‘ und imthe speed und relmbnltty ofthe most robust Internetnetwork in(anudu.
„ . Ä (‘(25[BH/AR u’1 *
11135111?!a1?’
Call ustoduy!1-888-G0-iSTAR
I II 'I' E R II E I’ I II C.CANADA ' S INTERNET COMPANY
www.isl'ar.ca
'I‘hc. Internet is Scattcrcd with many Cyber-seeds guten’ thmnbscan use to sew theirspringtimc gandcns.Alberta-based master gardener Donna
Dawson's I Can Garden is onc of thc largcstWcb sitcs. complcte with gardening cata-logues, Clubs, public garden eventnotices and seed exchangcs.Anothcr big site i5WcbGarden. produced by
Ohio State UHiVCISiIYS Vu-tual HorticulturalDcpartmcnt, which offen-s over 5,000 links toinformation sources in Canada 2nd the UnitcdStates, as well 21s its own Suggestion; for bothcommcrcial nurscries and amateur gardeners.Published by Victoria landscaper a.nd horti
cultuml teachcr Clydc SnobelcmThc VirtualGardcncr offcrs tips and featums for home gar-
Guidc t0’ Gardening inAtlantic Canada,whichfcaturs a qucstion-and-answer fonimihrough
. mesamcmainlixfl-(‚Webcmwlerscanalsofindthc CanadianOrchidOongmss.The Univeräity of Regina ofiers over 1,000
links to internaüonal mrdcning sitcs throughits Internet Directory for Botany. Vancouver-based, nun-profit society City Farmer fmtureslinks to information on such cnvironmcntalconscrvation issucs as composüng, a5 wcll a5community, school. and rooftop gardens,through theirWeb site.Fordiseasesandpestsflmtcanmmyourgar-
den, visit thc TexasA and M Masten‘ GardcncrInformation site.Perennial growers should check out the
Plants 8c Bulbs! sitc, whilc English-garden
_foranintcrnati nal "
ofgardcningn c "ks,a n dseedmtalogues,aswell. connections to major „global gardensugh thc link.“Down thc Garden Pathf‘f en Net, meanwhile; runs Lhe weeklym:“Thc Ardcnt Gardcncr," and feagurcs an
oriline garden shop, Floräs Bast.00m4: green thumbs have even taken to theNct to boast of thcir botanical achicvcmcnts,
induding A Walk through Colin‘s Garden, inwhich visitors can takc a walk through Colirrsvittual garden paLh and see the wonders of hisoutdoor crcations.
Cyber-seedsYou can also buy plants and seeds over the
Nöt, from such online Wcb mcrchants as:Gärdens North,m: Herbal Touch, Rainforest
Dill’5Giant Pumpkin.'
jThere an: also sevcral spccialty grdening
sitcs on theWeh, includingThc RosePageffheMuseum of Garden History inlnndon,111eInternet Bonsai Club, Firegirl (Which special-izes in chili pcppcrs), Thc Gaflic Page, TheRhododendmn Page, and lhc Friends of LheDayliljcs home pagc.Gardening cyber-chatScveral gardcning-rclatcd discussion
groups can be found on the Net, includingrecgardens, which is divided into scvera]
subcatcgories on orchids und toscs,and hasan archivcd section for Frequently AskedQuestions. Other discussion groups includesciagriculturc, scibiobotany, and altfolk-
Pleose visif our V/eb-SireRPCI 00100 1.100100 1"RFC svsTEMs‘ 1111111111011_‚m, pemwm® „ m , „wem, 141:11sound 001d a6x00-12014 S149F120 31240 —
14mEDo 12m1. 512x m;Cache 2Powe15peake1sw/ACadapl1 529
P-133 31290 I 4334314131132 31v‘; "°”°"’°°°“°" 34°-2senu1‚1 Parallel 1Mouse1=or1s m m b b h ü p w S139
P-150 S1330 _‚c. 6., „„„mbam w,M, 59014 um111/244m1 5240M66 31500 -Mognavox 14' arge Monitor Dscovery 411444 I01 398- y r '
Nr.10 104 Ke W1n95 Keyboad |5m3mm cm 34a1-200 01100 warme
513g8x CORom-IntelPentium ProBoxadProcessor 12km CD-ßom 3149P10-180 m’1241452341VenusMolherbrd Admlec scs1 002cm cmw/50111km 58532300 12'593510291124 043e
13:02:15,;mgg10gg‚„11„3;1;°„;>0 We ore‘ o member of
2131330 jfiggfigfigfefiegfigffigffingfiufl Befler BusinessBureouk fi 3,3325“w °"’"°“’°' J DRNES 81CONTROLLERS
11gFgisea e102 305/233MONHORS 8‘WDEO CARDS 31194/4911205 3395/2410Mognavox 14' NISVGA .28 S240 2.1911 13.2" 1111m scs/ 3435/3550scepne 15- 111 LRF101 SVGA .211 5375 439a scs1 51200Sceplre 17- u:1141 Screen NISVGA S470 2511395102141 nolebook 5395Somsung 201 91s Monilor 31400 12MB 5.25‘ Fbppv 0111/9 S60SONY 100a 15' 5400 144MB 3311090101112 S35NEC C500 15' 5495 sy0es1 230141141110 w/1 da11 S398112c xv11+ 11' 51030 6000918001118 mpebodmp 111/1009 619551/94 C010 13A 11.111 545 Bockpock 000m0 00101191 0011 bockup S195cmLogjc 9/54 cum 1/2103 pc/ 555/345 e 8.09 lnL/extlope bockup 51230/51370Matox Miennkkn 3021110/4110 WROm 10 5279/5359 "P 1051010 50005 4611096 bockup 31350Mukox 11011404 2110/440 5924m 1101 5195/5229 V111 E105 6010101101WI101110410 540Diamond s1eo11n 30 1191 VRAM 214110 5240/325 V11 F105 C0011 111/ 51111011000 V0 345Diamond s1ea11n 30Edolhm 21/11/4115 5149/5199 Adcptec 15221510 SCSI C1111 _3125/2105Moplec 2342/1v0 scs1 Comroller n1 350
Map13: 2940/294UW PCI SCSI C0110! 3295/350
n
44MOMERBOARDS (101951 Design)
44400-1001101 254k w/CPU, /an3444041433291 256k w/cpu, fan11-100 254k w/cpu, f0nP420 512k w/cpu‚ {an11-133 / 150 512k w/cpu, ran 3395/544011-144 / 200 512K w/cpu, fan 6630/3925
Pnnfers1310111421041 Loser 335gB101her-WL660 Laser 3350014mm OL-4W Loser 4000m 5425HP400 Color Deskiel 269112 492c C0101 oesk/et 600dpi i399119 820CxI C0101 Desk/et 600dp1 3499HP8706H C0101 deskjel bflüdpi 3680HPLaserJet 5L600dp1 3570HPLose/Jet 6P 6OÜdpi 1040‘HP LaserJel 6M? 6U0dpi 21200jHP LaserJet 5 600dp1 31740HPLose/Jet 4V/4MV 32300/33990‘Canon BJC-4200 l RJ-30 3315/3295
NETWORKINGVflndows N14.0 Server w/5 licence
3960VVndov/s N14.0 work 5101100 350Novell 3.12 upgrode [10 use/J S1490Novell 3.12141 5 user] 3880/880.Nove1I3.12/4.1 10 user) S1880‘Novell 3.12/4.1 5 user) 32620/24801 1e2000+ 1 Ethernet Cord S100B 16bit Ethernel lOBpse-T Ccxd S49ycoble. connector, 1421111100101 81Crimping 10d
wv/w.1pccom.coms.3F’E'L‚CI'C2 ‚|2; r']‚"""’
ß
Werepair :-M0nit0rs-Systems-PrintersWeupgrade laser printers
continued from page56lornhcrbsAX/eb gardeners can also subscribct0 scveml e-mailing lists.
#11110[iI(anGardenhttpz/lwwunlcmürdenxom/WehGardenhttp/lhortwww-Imgmhlostntmcdu/hvp/Webgarden/Webgardenhunl‘lbeVlmnl Garden:httpzl/gardenmagcom/Guide to Gu-denlng InMimik (und:MtpV/wwuxfmudalsn/Ieceaflon/Gardenfilg/gg_horn|.htmlCnnadhn orthlrlCongnsshttpz/lwwwxfmcxdalxa/Recreaflon/ordfldsfls/mchtmllhrlversltyofileglm Internet Dhctoryforlotnnyhttp://herb.hlol.ureglna.ca/11II/b|0/botarrynhtlrllCity Farmerhttpt/lwwwxltyfannemrg/Texas AundMMama"Gardenerhttp://1ev|athan.tamu.edu:70/Is/mgPlults k Bulbs!httpzllwebJdlrecncom/wbulbs/Indexhtml111ePlant Trackerhttptl/wwwaxlsnetcom/pffl/111eGarden Garehttpwwwunpnirlenetorg/ag/guden/Garden Net
FLAT
* N0 SETUF FEE‘TECH SUPPORT* LOWUSERI LINERflflfi
Parsley, sage,rosemary, und CD-ROMsWhat virtual garden would bc complctc
without a bed of CD-ROMs fmm whidn topluck?
'
httpfi/trhmcom/Gldflflfl/AWü dwufli(ob'sGrießImwl/watartsumwbonl-anoodlgufluuhtdGarden Normh ü p 2 / fl I W fl I /‘Ilre IlcrbdToudlhttpfl/wwwkvllcxonl-berhs/RührenGardenhtm/lwwwjsomeon/nlnforest/Mann!DII‘:Glant PcnpklnIüpz/lhnfiasnnnnmn/ndjflrgs/ßgnfihs/‘Ihe lose Pagehttgn/lnwvamnedul-netfles/rufq/rofnq-topjrtnlThe hineincf Garden rüsten inLondonhttp:llwww.cornptrlhk.cn.ül—nusgghThe Internet Bonsai ClubIrttpzl/ßpamwaymedul-dnn/baßflhflnl
httpJ/havernlosmom/«mdmzh/rhodooihmlFriends offlnhtqn/lwwunprhnerretxorn/dlfdv/fluyfiplmnlrecgndaulahmhttrn/lsunslteunoneül/bndon/Weh gardenlng e-rmlllng llstsh t t p : / / a g /Ortho slteshttpv/wwvrucarderflngxorn/Irttgu/lwlnnorthmmm/
‚.1
'EVERY BOOK III-STOCKn
NEW ARRIVALSJ,
wi
i
Pagfirteflh 4 g
5 0%OFFSIIGGESTED PRICE
Pairlerll-girleVIIM: yoIr to1h nexl Ievel!Sug. ’55-" 0 ‘/2I’I'ico ‘27"’TrouileslroofingMalwareSysfoms)2nd Iflioqw/CD-ROI
Aly Ietwarkilgproblms, 1mm prinflng Iosinplifylng upgrcles (n beellminled
will: Irelp mIlris Bock!Sog. 560" 0 ‘lzPr-rce ‘30"
w/CD-ROIForibosewbolmuieorlymusierodihehsicsfifls
I.'ngo!:An Advaneecl< Glicle w/CD-ROIFor nuhimediu developers, lingo! willIet yoI efrlore
IIIe Ianguuge’: Irueower an versuliliiy
. n I9. 561-" o ‘/2Price‘30"’
Nflxflw' 1100 Interne! .
’
will: Indem 95,Delueirlifiol>w/cn-norr
I1you've only ins! nnw ioined theinformation superhighwuy, gel ontherigln Irnck quirkly und eusily!
Sug. 539-” 0 ‘/2Price ‘I 9-”All. US TOlL-FREE 0
it's ihe nume o1our store8. it's nur commitment 1oyou!
I -888-663-0063HALF PRICE COMPUTER BOOKS -Alderbridge P|ace
No. 3 Road a? Alderbridge Way, Richmond#122 -4940 No. 3 Road V6X 3N8
Open fill 9:00Wed, Thurs, FriVisir ourWebsite {under consfruclioru) hfipf/ha/Fprice.compuferbookacom/
Mail orders welcome! Call 231-1922
jVISA
j
RATE lNTERNET ACCESS*9.95/ v9.95/
‘N0 P1211615 TIME F553
im man:o: CORPORATEsmcmsj Weh page puhiishhxg
’33.6KBPSHODEMS
277214 ü?’rffifiöftflt?97:84:15.95:www .uewsenoufis—cm1‘.2mm . .FTPHIIEHIIET LIEHTSPEEI]
422-1190ifliflfifivßfilflüfiflflflifilfiälflä-Üfiiifl
* FREESOFTWIRE 1
i;
Ö Wehsie11058329O Domainname tegistration
E-MAIt"Corporateam!Familysarvim”
Need anum:e-mai!accoumforan empioyeeor family mamher?Wäouldyou iiite yourmm domainname o: permanente-ma addnass‘?
P09acsounts-53.06}monthE-maiiaiiasaam:e-maiifoiwanflng:
51‚DMmonth
http://www.computer-nlayencoml 4 MAY 19197 4 COMPUTER PLAYER! o
continued from page57LandscapeArcbitect, produced by SoftKcy
International Inc. for Windows 95, lcts theuser crcate two-dimensional landscape ren-derings from a gallery of such items as gar-den filmiturc and cvcrgccrxs. Once a modelis cteated, you can vicw it from diffcrcntangles andviewpoints in ö-D.Furthermore,LandscapeArcbitect lcts you
view your horticultuml sccnic in dificrcntseasons in dificmnt ycaxs.Forcxamplc,if youwant t0 know what your garden will looklike in the fall of 1999, you sclect theEnvironment command fi-om the Edit menu,dick on the Fall mdio button, dick on theForwaxd button twice, click on the wcathcrdrop down ljst and selcct Sunny (if that's thecondition you want) and dick OK.You willgct an idca what your mees and shrubs,including thcir aurumn colours,will look likc
ROMs include the Complete HomeGardener, whid: comcs with a full-coloursclcction of over 1,000flowers, trces, vegeta-bles, and herbs, and automatimlly highlightsthosc bcst suited for your tegion.Expert also pmduces the more specialized
HomerGardening,which lets the uscr selectspringtimc blossoms bascd on their colour,blooming scason,sun exposure,andmoisturerequiremcnts-as well as VegetableGardening,Which-fcamrcs tips on soilpropa-mtion and maintenance; planting, spacingandharvesting;and nutritional informaüon.Books that Werk, locatcd in Palo Alto,
Califomia, havc thcir own gardcning CD-ROMS for Windows 9S. GardenEncyclopedia 3.0 fcaturts a database of over3,000 plant xecords (all with accompanyingphotographs) and a multimcdia ‘how-to”guidc that ShOWS tcchniques on how t0sclcct and care for plams.
before thcy cmzcr the ncwmillennium.ExpertSoftware alsohas a collcctionof gar-
deningCD-ROMs, including itsown ö-D land-scape-dcsign product. Exports featums a 30-minute video on the basics of lawn caxc andmaintenance. and a “hclicoptcr” tool t0 givethe user a birdbeyc tour of thc final dcsign.Thc Florida-based companfs other CD- _
gYour own Web Site| Have you been hearlng everywhere you turn "see our web slteat http://www....."? Have you thougnt lt would be too| expansive? Or you don't Imow haw to go about lt?| Let Maximum Internet show you now you too can have a web
Ibe Ortbo Home Gardeneric ProblemSolver serves as a troubleshootcr t0 idcntifyand solve gardcn-related hazards, such asaphids and root rot. It also includcsa person-al journal to create gaxfden-maintcnanccSChCdIIICS and brings you full cimlc back totheWcb. O
slte for a5 llttle a5 530.00 per month! You don't even need to| own a computer t0 have a slte, we can da all the creatlon far
Maximum Internethttp:lwww.max—net.come-mall: [email protected]
mm-r
_ GuordP0100 34.4.21' PRI-S l4'-l5'Momlo 960.00
JRS COMPUTERS INC_Suite 288.811» Park Road.
you or you may want to do lt all yaurself .Domain name reglsterlng and hostlng avallable.Relocate your Website. '
We also can connect you to the Internet, and provlde you withyour own e-mall address a5 weil, for only 529.95 per monthunllmlted use.SELLING SOMETHING? place an adduon the Internet classlfleds,with photo for only 55.00 per month.
Cllp thls add and Call today for a free consultatlona: your offlce today.
(604) 940-8921
Check the quality 8c’ SGITlCC. Call us for acomplete quote on System upgradespartsand products. Vl/o will custom make thesy 1 c m t0 fit your bud ct '
„.5“ :__ .—-.
Net pollingresults face scrutinyRclpse on election nlght, coukl "litt
eleaslng results on tlunlnter}net before federn! riding
the Pacific time zonc.m.a nne o:314m o: a ‚a....555: Something fishy online?pfison. If you get caught, tlnaqtls.
i 0 0 ByCHRISTOPHER GULY 0 0
‚ choosing the ncxt govemment.äacqucs Girard, director of legal Services
People living in the Newfoundland,‘
Atlantic, and Central timc zones, begin vot-ing at 8:50 AM,whjlc those in the Eastcmüme zone start at 9:30 AM. Mountain timcvotlng commcnccs at 7:50 AM and 7 AMin
Girard says the potcntial for rcsult lcakscomes with the Maritime vote, which repre-Ö sents 11 perccntof the scats in the Houseot
j Commons andwhere voting concludcs a fullthree hours before Vancouvcritcs fmish
Cämdafs new clcctions law also forbids theand rcgistrar of political parties at ElcctionsConada, admits that no oncWill be assigned{denforcc clcction rules in cybcrspaccfißutif ‘pomeoneCalls us and says they saw results01i a site at 8 PM, and the polls are still openuntil9:30 PM, thcn the personwho put that0o the Internet will get a visit ftom onc of01h invcstigators.”hmendmcnts made to the CanadaElbctions Act in December staggcrcd thehours of voting on polling day by region.Alfhough all Canadianswill havc 12 hours inwpjch to cast Lheir ballots, gcography deter-mincs how early in the moming you headfol- the polling station.
disscnfimtionof publicpolling results48 homsbefote election dayThat also includcs the Net.Whctc the Net remains muestricted,howcven;is inparfisanadvcrtisirxgcandidatcsandpoljfl-calpartiesaxcforbiddcnfromusmgcifllcrnewspapcr. Indio, or tclevision ads t0 atmlctvotes48homs bcfomtlmevotcflheymnpostasmany Web noticcs as their hearts deckt,though.As for thosc worried about not havingNet
access to clcctlon-night results, ElcctionsCanada will post thcm all on their ownWebsitc (http://www.elections.ca/) a: l0 PMEastcm timc-l 1:30PMin Ncwfoundland O
lTHECURSR STICKE?Quickly convert "n;your arrow keys ‘f '
into a joystick
Q
_ 0 Easy on the wrist‘ and fingers; _ ' 0 Fits most standardTSupports dlagonal .. keyboardsmovement4Fast game playingA
speeds>l
Send cheque or money order to:CARON VEHTURES#238-9458 Prince CharlesBlvd.‚ Surrey, B.C. V3V 136(604)582-3837wumncaronventuresxomma [email protected]
Scroll web pageswith ease
ÄaomxvBAcxGUARANTBEi
GOVT. & Cfllll’.I’.0.
WIEIJÜONIIEzu 232a ‚__
P fi c g :..-‚ m.Richmund. im im‘m Tel ; man) 273-885
:AV5 " («'- ' ' '
A‚ _ _ ’ . i‘ .
I
A i m ? ’
- _ ;fPcrfcct 386/406 i Fully Loaded System: \ äystegfi/Fvxgflflgärrfimän‘ j l IntelPentium Pro 180MHZS2750: - : - . 5u5 n 0 r Dar ä. , : a „ _A: t "QQECÖC“kühn:1 lA M D K5‘l O0 S1.639 _512K Pipeline: am.“Gicht: : - IntelVenua ATXMotherboardfOCuGIare/Guordscreenmfier n 1 a A M D K5-l33 S1660 46m ' O KA ‚ : ! -52 MBEDODR/«Möons5 °-°*“°°"°""°’°°*'°"'°'V°""Y“ ' . 5 - - ‘ — - 5 Ä D M’60"’ 4 i -144MB FDD 21GB EIDE HDDM-4.Glore/Gxacrdsldboo ! l 0x44 0o oDP 53g 1 ; Pentlum“ 120 S1695 -144MBFDD,1.265EIDE Hoo‚r‚1—4 « g ' =g ’. ‘ - — — — — » — v — — — g - . „ « _ ; -AT! 5DXpre55|on+ PCZTVw/2MBSDRAM: l u: A - A -Pentluma 133 S17 40 W/ZMB EDO.MPEG u_.—.. .g upgrooemuth 58b PC:Momzrbooro l n _ _ ‚ 45,10 k05DN" L/R D/C Man I 13|Dgytek 05D N/l, L/R,_D/CMomwri rmäumgofl IPentlumä I 50 Sl f775 _133m6?MidfiowerCaggwith’256WP _
I-;:7'_i:/l|d-V1\;o:35AgXiasedw:th
250W.r — !Pentiumfi 166 S1925 _Fun - ‘ “J‚ 5" ' ‘Y 03'‚ _ _ l
4 Jltöu Wm95Keyboard . L „Ch 5 5 m, Mi pentiumfij9o s4g5 5 gentlum’; rlzggMMxS1P78 -
Lggitech öcßöläcönüsphnouseI-733m 12x supecgzD I35’:amg ‘ | entium 2020 - 59x4 rive —5o ndB! 5te 52 PNPi "Cf l Pentium ZOOMMX222 0 - 60WSpka -Yarttaha 594517 Powered Spks' I 1 ; —115R556KVI Int.Voice FaxModem -USR 55.6/56K lnt. Voice Fax ModemÜ i_ mm _ f _ _ __| CXÖXSÖ 155+ S1699 -Mndows95 caFuII.522 o_-wa_ngc_>yg»__saosco FI-gll‚jß2_______h___ _n-v noGeeJ-‘lensecallfotthecmrent -
HLNIKinn!
2Facl:(604)273-3l86 wn\ ' .n. Ä [HI
wQ c o w u n a n u n : > MAY 1997 p http:l/www.compjuter-playencom/
F
B C T V
Walk -Run -Kids ' IK -BBQ1:00’pm Iriday, Inne 20Thundcrbird Stadium, IIBC
„.10help raisemoneyforAlzheimerB.C.&B.C.Athletics!
i9 m m
EVENT INFO: 940-0881
' Deluxe mid tower caseZ’ Pentium MMX motherboard’; ’ Support up to 20OMhz
‘ Support new USB devices-_' 512K Pipeline BurstCache
i Intel Pentium processori 16mbEdo Fiam (up to 256mb)PCI 64bit 1mb SVGA card&Mpeg
f ‘ 1.28gb Eide hard drive3 i 1.44mb floppy drive2-112x CDrom& 16_ bit stereo sound‘ ‘33.6k voice fax/modem
'11"l"l'i'41‘I"i
L MSHome Bundle 97_;_ FAX/MODEM
5USR im. 33.6/56K 9149/219
. OEM SOFTWAREWindows95 CD fuIl SR2 S129 Hp5g2/37g
3399HP5U6P589 HP5P/4P/4C 3539/680/1049 Viewsonic 773/5
Canon 240/4200 8239/329 17GS/PS/PTBrother 730/760 3499/599 NEC vx+15/17Epson 400/600
; Diamond Supra int.33.6 S119 Lexmark Optra E‘ Netcommander ISDN S320 Panasonic KX65OO2Cardinal ISDN 128k S265 S|MM(30/72Pin)
'80w stereo speakers &Mic.' 104Keyboard &mouse &pad' 14" .28dpi Svga color monitor
15100-81389 P133-s1449P15o-s1499 P166-51599P200-S1798 MMX 166-51699MMX200-S1998 CYRIX/IBMscau
ACT
ext.33.6/56K 3249/279
m wi/PRINTER/SCANNER
P166-s1 Iease 3651m*DeIuxe mid tower case‘IntelTriton MMX motherboard‘Support up to 20OMhz‘Support new USB devices‘S121i Pipelined Burst cache*InteI Pentium processor*32mb EdoRam(up to 256mb)‘ATI/Diamond 3D 2MSvga &Mpeg‘Quantum/WD 2.1gb Eide HDrive*1.44mb floppy drive‘16x CDrom&Sound BIaster32 3D*33.6k voice fax/modem‘80w stereo speakers &Microphon‘104 keyboard & Iogitechmouse*15” .28dpi Svga color monitor
P100-S1830 P120-S1839P133°S1869 P150-S1899P200-S2199 MMX 166-52099MMX200-S2398 CYRlX/AMDKS scaII
MONITOR9399/659 Mag 01530/017025589/999 Dx15T/700T
3323/423 M500/M70OS699 SONY 15sx/sfS499 17Sx/sIScall Sceptre/ADI/Acer/etc
5490/7793495/8753699/799
3839/899/9955519/9995519/10695489/5195859/1089
Cardinal.
iIIEiH
1
i»'.. a, „z* - xrn— . — _ ‚ Perfer/ing
yourcompuierbusinesswith quulity8.durubleuccessories.
www-acp-ca/acp/ I-800 567-7227OEII Hause : d ‚Mouse, Power Bar avaiIabIe. " FuIIMark" ribbon BC excIusive distributor.
9120-13751 IfnayneidPlace. Richmond.B.C.Canada vsv 209 IlealerUnig
2607 Kingsway Vancouver B.C.y i Ph: (604)435 2038 Fax: (604)435 1298
„m Piniao-iianrgan Fax:(604)278-1211toIIfree:1-800 557-7227
r
V5R 5H4 An tecBusiness Hours: Mon.-Sat.: 10-6; Sun; 11-4
Pro200-S3399 Iease ‘S11Olm‘Professional ATX tower case‘Intel Pentium Promotherboard‘Support new USB devices‘Intel Pentium Pro processor‘Intemal 256k cache*32mb Edo Ram(up to 256mb)*Matrox Mystique 3D 2MSvga‘Ouantum/WD2.5gb EideHdrive*1.44mb floppy drive*16xCDrom &Sound Blaster32 3D*USR 56k internal fax/modem*230w stereo speakers &Mic.‘PS2 104 keyboard‘PS2 Logitechmousea Rad*17"Viewsonic .26dpi monitorPro150-S2899 Pro180-S3299Pro200-S3399 DualPro ScaIl I
MULTIMEDIA8X/12x/16x 3119/119/159
Color QuickcamVEDIO CARD
Scall
Iix/IBM 5x55 avgi/gg/g. Wg gh/g gutQftgwn with a m II h r
ATI Xpres. 3D 2/4rn 5149/199 ASUS 256k/512KPC2TV 3D 214m 3169/219 HARDDRIVE
Diamond Stl.3D 214m 3149/199 1.2/1.6/2.1GB 3245/269/288MGAMystique 274m 5169/198 2.5/3.1/4.1GB 3329/368/478
Millenium 214m 3219/268
Acer Open SeriesP166-S21 Iease5711m‘Acer 17“ tower "MMX motherboard'512KPBcache ‘Intel Pentium 166mhz‘32Mb Edo FIam ‘2m 3DSvga PC2TV‘2.1G hard drive *1.44m fioppy drive‘16xCDrom ‘AW32 3Dsound card‘33.6 fax/modem *Keyboard,mouse‚mic'15“ Acer Svga colormonitor
0
—AuthoriedDealer'--'-»»-->:a:»:v-:»<.-—;»;»:-—ä»o-=<»c—«:-»:va»: .—AcerNote 375+P133-s3199Iease s1o1/m'—-Pentiur‚n 133/136HD/16Mb Ram/11.3”DSTN /1Mb svga/10x CDrom/16bit sound/33.6k PCMCIA fax/modem/Windows95 preloaded.
istan trr
REMOVABLEDRIVEIomega 100mZip drive
SB16/32/AWE64 979/129/229 Jazz1GdriveinJext 5550/650S285 MOTHEFIBOARD
Gigabyte 256k/512k 3149/189
5199
3179/199
‘ColorQuickcam
Acer Aspire Series202X(Black)-—S2799Pentium 166/256k PB cache/32m Ram/2Gb hard drive/8xCDrom/16b 3Dsound/ j-keyboard/mouselspeakem15" Acerview SVGA monitor(BIaok)2733(BIack)—S2999MMX166l256k PB cache/32M Rarnl2Gb hard drive/16xCDrom/16b 3Dsound/keyboard/mouse/speakerh15"Acerview SVGA monitodBIack)2761(BIack)—S3488MMX200/256k PB cache/32M Ram/4.1Gb hard dnve/16xCDrom/16b 3DsoundIkeyboard/mouse/speakerh
nnPrintr' 71
\/
onthly Special!*8X ExternalCDrom driveS28O
—For your Notebook oomputer*Cardinal iSDN 128kModemS265
—New advance lechnology
-Let Computerworks as aVideo phone“ ” \ / \ / \ / \ '
_onIyS285 ‘Pneotsubpcibcnanqowflhomrloux‚fllrlosmfltsambolmgb
nun-In" man ownevxsudarvampayhgaudnmloschedionrm a n :
'nimmt°‘ Canon N E C SONY ß hier
5CLiet 01° Internet ervice Provi ersPROVIDER PROFILE SERVICE PROFILE r 5 . . 11.01.10.15 PLANPROFILE
Nnsubs! 56Kbype Dedkated l1! tech Web Max. BlzYarfoundwl! e-rnal! satte! lSDNI staff/ Start- S Hrs 5! stor. Trafilc s! t0
Name! Majsharelaold/äalesplwne! Website Tcpmodem 1118W! Dlalupl5DN1#_ shlft! up Kit pa’ per hr Weh hdhGB GB 512addrese iocztlon fax/ (http-J!) speed SUPIPFP ADSL ‘
resp. tlme Name fee9' incl morrth mo. a m " hast plan Imo over sei-v.
‘ACOT81Ent MP/ 800-370-0015! [email protected] 40.000! MP/ Y/M/M804
24 hours 0 Y 19.95 unlld MA MP PDMIToronlo ACC Tel Entj NP wwv/‚aoclemei 10:11 T31 MP1 0 Y 24.95 MA Yes 5MB
MP. 28Kbps MP MPAC1Laboratory 19941 604-27836501 iunoliuaacllalmom NP/ MP1 MIN/M 3! 8:30a-5:30p lndividual 25 Y 15 15 1 Yes 1MB .025 100 PDMCommeme Pik. MP/ 604-278-3612 www.actlab.com 7:1! T11 MP1 M-F Busnial-up 30 Y 40 25 1 Yes 5MB 2 100Richmond.BC MP - 28Kbps MP ’ MP Busw/o diaI-up 30 Y 30 unltd Yes 5MB .2 100'Allne1Exehann 1995/ 604-48807501 [email protected] 500+! MP1 MP/MP/N MP1 MP Dffioe network 300 Y 40 unhd Yes 5MB
'
PDMI303-896Cambie St. MP1 604-488-0790 wwwaxdcom MP1 T3! MP accessVancouver. 8C Vancouver 33Kbps MP - MPAllennet lmerncl 19981 604-882-8480/ [email protected] 200/ MP1 MIN/N 3/ 9a-10pM-F Simplymail 0 Y 8 6 1.50 Mo PDMI303-21183 88Ave. Partnership! 604-888-6514 wwwbc-altemel 10:1! 128Kbpsl 2!
‘9a-5p Sa1. Basic 0 Y '10 30 1.50 Mo
Langley.B0 Langley 33Kbps N0 U r 5min. 9a-5p Sun Extra 0 Y 15 60 1.25 Yes MPA01.Canada 1996! 888-265-4357! Stphenmcaolmm 100.000! MP1 M/M/M 3, 24hours 0 MP 13.95 5 3.95 Yes 10MB PDMI40King SLW. America Online! MP www.aol.ca MP1 MP/ MP1
'
0 MP 26.95 20 3.95 Yes 10MBToronto. 0N Vienna. VA 28.8Kbps MP MPAxion Imarnel 1994! 604-687-8030/ infoäaxioneLcom 12.000! Rockwell! Y/Y/N 11;‘- 9a-9p M-F lndivid, dial-up 0 Y 19.95 50 1 MP PDMI600-1380Burrarg MP/ 604-687-8130 wwwaxionetoom 10:1/ 55MBpsI 7! « 10a-9psar. corp. diaI-up 150 Y 29.95 50 Yes MPVancouver. 8C’ . MP 56Kbps No!Yes MP
’
10a-9pSun ISDN“'80Business 1995! 250-65248151 [email protected] MP1 MP MP1M!MP MP1 MP 0 MP 19.95 10 1.65 Yes MP PDMIP0 Box 2412 HawardCommJ 250-65248157 commerciatnet/vault MP/ MP MP1Sydney, 8C Sydney. 8C MP MP MP2 .
8CTelMnncell MP1 800-334-lSDM! [email protected] MP1 MA Y/Y/N MP] MP ISDMGHOme 60 NP 50 100 -Counmunieatiom MP1 MP wwwbctelnet MP1 5Vancouver, BC MP MP < _Canaia InternistDioe11994/ 604-602-1800! —cservice Gdirecuz 25.0001 Xz/Roclr! M/YIY 15/ 8:30a-10pM-F Standard 25 Y 19.95 520+ MP Yes MP PDMI1050555WHmtings Panne! 604-602-1700 wwwnirectca 15:1! 6MBps/ 51 E 10a-6pSal. Premium 25 Y 24.95 550+ .95 _Yes MPVanoouver. 8C VSE 56Kbps MNYes 10-'5min. 103-69Sun Bus. solutions"‘Coastnet - 1995! 250-95326801 salesöcoasmetcom MP/ MP1 MIN/M 121- 8:30a-8p Daily 0 NP 24.95 100 MP Yes 1MB4252 Commeme Crc. CSP lnlemel! 250-953-2659 wwvlcoastneteom MP1 10MBps! MP1.Victoria,BC Vic/Vcr. -* ZBKhps MP ' MP '
‘Comserve 1996! 604-543-8577! [email protected] MP1 MP1 MP/MP/M 21 9a-9p Daily Momhly 0 N 19.95 unlld Yes MP PDMI8080-15814 S1. L Stalker/ 604-543-6577 wwwmmserveoom 12:1! MP1 _ MP1 Duanerly (prepaid) 0 N 18.95 unltd Yes MP ‘
Suney, BC Surrey - 28Kbps MP MP; Semi-ann (prepaid) 0 M 17.95 unltd ' Yes MP000m1 Intelligente 1996! 604-279-0381! oontaelfloonnelioom MP1 MP1 MP 31 9a-5pM-F Movice 0 Y 9.99 7 .50 Mo Mo PDMI2132-12811 Rowan P1. GaryYam! 604-27941380 wwwnonneticom 10:1! MP1 31 '
Slandard 0 Y 19.99 50 .50 Yes MPRichmond. 8C Vancouver _ 33Kbps Mo/Yes lmrpediate Family 0 Y 29.99 50 .50 Yes MPBauen:0mm. 1995! 888-275-77771 infoücnxnet MP1 Rockwew Y/Y/M 51 9a-9pM-F PlanA 0 MP 25 MP 1 Yes MP 1 PDMIMP MP1 MP www.cr1x.ne1 6:11 10MBps! MP1 10a-6pSat. PlanB 0 MP 15 MP" 1.50 Mo 1
' MP 33Kbps Yes/Mo MP4'
' MP1 604-50154301 servioeöhelbcnet MP1 MP1 Y/MP/M MP MP Please contact Cyberion for informationonrates and services PDMI302-12886 78111Ave. Cyberion 604-501-5440 helixnet MP1 128KbpsSurrey.BC Met-working/NP - 28.8Kbps MPCylemri Ine. 1994! 604-66978731 imoacybersurtnel MP1 Roekwell YIYN MPÄ Sa-Gp 0ai1y Dialup ISDM/Yr‘" 240 MP MP unltcl Yes Mo unlm PDMI301-510W.Hastings Cybersurf CorpJ 403-777-2003 wwwsybersurtnet 10:11 v MP MP1 PPP digital/Yr “‘ 199 M MP MP Yes Yes unltdVancouver‚ 8C Caloary 128Kbps Mo/Yes
‘MP7 VirtualTl!Yr 250 N MP' 6570 Yes Mo unnd
01|1|81All 1996! 800-27542601 in1o@ark corn 5.000! MP1 M/M/M 81 I 9:30a-9pM-F Gold 39.95 Y 19.95 50 1.50 Yes 1MB l306-576 England Ave. Kevin Bauersby/ 250-334-2365 wwvLark com 20:1! T1! 3! 91303-511 Sal. Plantinum 39.95 Y 27.75 75 1.50 Yes 1MBCourtenayßc
ACoumey 33Kbps Mo/Yes 1h r 9:3-a—5p Sun Diamond 39.95 Y 35.95 100 1.50 Yes 1MB
‘DigitalHainMemel 19931 604-543-30251 aceountücfigflal-rainoon 2.000! MP1 Y/MP/M 8/ 24hours 10 Y 5 8 MP Yes MP PDMI201-1283746111Ave. MP/ 604-596-4473 wwwxligital-raincom 5:1! TV MP 0 Y 15.95 120 varies Yes MPSurrey. BC Surrey 33Kbps NP MP MP Y 19.95 unftd MP Yes MPDonautal 1995/ 604-66440441 webmastarodowcooomr 2.600! MP1 Y/M/M 8! 8:30a-9pM-F Interlite 19.95 Y 9.95 10 .99 Mo P200-1024 RidgewayAvflugh Dobbie! 504-937-7610 wwwnowctxeom 15:1! 10MBps! 2- 10a-5pSaL MeLLink 19.95 Y 19.95 160 .99 YesCoquillam.BC Langiey 33Kbps Mo/Yes 0-4 urs 10a-5pSun Platinum 19.95 Y 29.95 160 .99 Yes 20MB 20 20‘Franc! MP/ 604-739-8060! infoüfronetoom MP1 MP/ Y/M/M 3/
\10a-6pM-F 0 MP 18.95 60 .25 Mo -
105-1755W.BroadwayFrontierCompJ 604-739-8061 wwwjronetoom 10:1! 12810795! MP1‘.Vancouver. 8C Vancouver 28Kbps MP MP5
’‘mehr00mm. 6cm. 1993! 800-36304001 salesfihookupjiet 50.000! MP/ Y/MP/MP 80!_ 24hours Residential 0 Y 29.95 120 1 Yes 1MB PDMI515 61h SL MP/ 604-257-2499 wwwxanhoolmpnet 15:11 T11 MP1 Corporate 50 Y 39.95 60 2 Yes 2MBMewWest. Dalrville.OnL 33.6Kbps MP MP3IBMGlobalServices 1987! BOO-IBM-CALU [email protected] MP/ MP1 Y/M/M MP1 NP Entry plan 0 Y 9.95 5 2 Mo PDMI3500 SleelesAve. E. IBMCanada! 800-565-6612 mmcan. ibmoom! MP1 MP1 MP!— Mew plan 0 Y 29.95 100 2 M0Marldlam,0m. MP globalnetworlr 33.610795 MP MP.‘ICEOnline 1988! 604-48275751 icsfioeonlirveoom MP1 NP/ MP/M/M MP/ MP Please contact ICEOnline for infonnationonrates arm servioes PDM212-2465BelaAve. MP/ 604-482-7599 wwwjoeonlineeom MP1 MP/ MP/
Bumaby, BC Bumaby ‘IP MP MP -lmaghtt 19961 604-66283321 [email protected] MP1 MP/ Y/M/M 4! j 24hours Basicnet 0 Y 9.95 5 1.85 Yes 5MB 20 2o PD200-425CamallSL M.Corderre/ 604-882-3624 wwwjmagnet 15:1! MP1 2! Fun.nel 0 Y 19.95 30 1.50 Yes 5MB 20 20Vanoouver. 8C Vancouver 3310195 MP Unqr 15min expertnet 0 Y 24.95 50 1.50 Yes 5MB 20 201|12|0111mm:lnc. 19961 604-601-21181 infooinznettcom MP1 MP/ Y/M/N 3! 2 103-69Daily Personal PlanA 15 Y 20 50 1 Yes 5MB unltd PDMI501-938Huwa S1. InznetMetworlr/ 604-601-2113 wwvainzneltoom 7:11 T11 2! ‘ Personal PlanB 15 Y 15 30 1 Yes 5MB mildVanoouver. 8C Vaneouver 3310m Yes/Yes Imriediate Business PlanB 15 Y 40 50 MP Yes 10MB unlttlInlomahl 199W 604-421-3230! aeeountsüinfonpatcneom MP/ MP1 Y/MP/N 3! 9a-5p Daily 60Hours 0 MP 13.91 60 1.20 Yes 1MB .04 DM143-9632Cameron lnfomatch/ 604-421-3230 wwwjnfomaxduoom 14:11 T1! MP1. 120Hours 0 MP 19.95 120 1.20 Yes 1MB .04Bumahy, 8C MP- 3310m Yesmo MPrwenn:Teeh. ll 1993! 604-48282381 infofinioservem MP1 MP1 M/M/M 21 St30a-5:30p lnt45 0 Y 1996 45 1 Yes 500K8 PDM5438 ImperialS1. Privately ovmed/ 604-482-8248 wwwjnfoservenel 1&1! ‚ T1! MP1“ Dany ln125 0 Y 14.96 25 1 ‚ Yes 500K8Bumahy. BC MP 33Kbps MP MP= Im12 0 Y 9.96 12 1 Yes 500K8 o
luurueiGattin 1995! 604-654-6088/ staflöintergambcxa 10.500! XZ/Roelr! YM/M 8/ ‚ 9a-9pM-F 0 Y 19.50 100 MP Mo Mo PDMI503-889w.Pender MP/ 604-669-8489 wwwjnteruztebeca 1&1! 11.54Mßps/ 41 j 9a-6p S31 0 Y 29.95 100 NP Yes Yes unitd unltdVancouver. 8C Vancouver 56Kbps Mn/Yes 2 0 .
‘lahme:Juden 1994! 888-94441517 infofiimiclionnet MP1 MP1 M/MP/M 5! * 8:30a-5pM-F Introductory plan 50 MP 9.95 10 2 Yes 2MB PDMI1-421625th Ave. MP1 604-542-4130 wwwjundionnet 15:1! - 10Map31 MP/ Basic plan 50 MP 19.95 30 1 Yes 2MBVamon, 8C Vemon 3310p: MP MP
pPremium plan 50 MP 29.95 60 1 ' Yes 2MB
InternetLlflmpni 1992/ 604-48241901 infofllighlspeediaeca 1.8001 Bodrweii/ M/M/M 4! 9a-8pM-F Conservalive users 0 Y 19.95 20 1.50 Yes 1MB PDMI201-6833SellersAve. J.Milne! ‚604-482-1191 wwwjiahtspeettbaca E11 T11 MP1: 10a-5pSat Power users 0 Y 19.95 unltd Yes 1MBBumaby. 8C Bumaby 3310m: Mo/Yes MPf _
'
MummPortal 1994! 604-257-94001 infoflponatca 2,6m’ MP/ YM/M' Mon-Fri silver 19.95Y 14.96 22.5 1.29 Yes MP PDMI
201-2525Maniloba LarryTolton! 604-257-9401 wwvaponal. 3+:1! 1.55MBps! Goid 19.95Y 19.95 45 129 Yes MPVancouver. 8C Vancouver 33Kbps Yes/Yes Plaminum 19.95Y ' 24.95 60 129 Yes MP1und1m m 1 1995/ 604-87563061 infoöinloudmbcu 5.000! MP1 M/M/M 7:30a-11:30p Midnighter 0 Y 15.95 unltd Yes 5MB .05 80 PDMI3448Cambie SL ° lnterMetStare! 604-87545307 wwv/‚intouchbaca 10.11 T1! Daily SoHoMet 0 Y 15.95 66 1 Yes 5MB .05 80Vaneouver. BC Vanoouver 33Kbps Mo/Yes Basic/Access 0 Y 19.95 66 1 Yes 5MB .05 80
Q COMPUTER n u n : p MAY 1 9 9 7 p http:/lwww.comlputer-playencoml
Legend: ‘A9 I51’ did not reply by the deadiine, data i5fromIicable.NPzData not provided by 5P. Under ßiz t0 ßiz eervices: PNote: Due t0 spacc Iimitatione only three plane could be lieted for each 15i’.=Ye5. N=No.NA=No1; app
B Cfs megaThe
Iocal access ramp to the InfoAutobahn seems to be getting biggerand bigger. ..
What became obvious is that pricing andusage in the ISP market is becoming moreadaptable andmore responsive t0 user'sneeds.For examplc, this is the first time a significantnumber of ISPs offcred “unlimited” access totheir systcms,often for a flat fee.Most ISPs offer a pletttora of pricing options,
designed t0 capture cvcryonc, from occasionaluserswho simplywant to checke-maiLto thosehard-core surferswho seem to spend much oflheir waking Iives connected t0 the Net. InaImost cvery case. each ISP provided manymore pricing schemes and options than thethree or so we couid Iist.Generally speaking,the first three pricing packages an ISP has areIisted in the survcy-ifpossible, they are Iistcd
I n t e rne tat a yearly price to pro/vide betxer comparisonof rates,although it can be mfely assumed thatmonthly rates an also bc had.Most ISPs now include some form of set-up
Charge.On average, the typical set-up fec aver-ages somewhere between S2025.Note, how-ever, that those ISPs listed with “Yes” in thcsct-up Charge cotumn do not necessarilyCharge set-up fecs in all cases-if set—upclmrges applied to the majority of pricingpackages listed,a “Yes”was added to the col-umnffhis does not take into account any pric-ing specials,which an: numerous.Connection spceds are fastcr than ever
before, reflecüng the rapid advance of moderntechnology.Most ISPs offcr their customers 33.6Kbps diaI-Ixp speeds, and a numbcr of ISPsbegan 1o inuoduce 56.6 Kbps diaI-up Serviceover the course of this survey. If you are inter-
http:/!www.computer-
esfted in ISDNServices,anmcreasirlgnumbcr ofoficr direct ISDN connections,asWell.
{Thafs not to say that all things are rosy in(H: Greater Toronto Arca ISP marketplace.
‘ e it still seems prematurc to say that theofien-predicted shakeout of the Iocal ISPmar-ket has occurred, there have becn a number V
o8’;casualties, and a lot of “re-structuring.”innmnberofISPsfromtIi/epxeviousstirveyddicided t0 drop their dial-up Services t0 indMdu-'
'
als in the pursuit of more Iucrative businessonly
CtandWeb connectivity servioes.I
nger: LatIn aphorism ahead{A5 with any purchase or leasing arrange-
nfynt,the phrase caveat emptlor (“Iet the
b er beware”) applies when searching forISP. In the months sincc thc last surveyundertaken, this writer has received
s eral e-mails from readers who felt thatII‘playencom/ 4 MAY I997
PROVIDER PROFILE SERVICE PROFILE m. PLAN PROFILENo.subs! Weh Max. BIz
Yrfounded! e-maII! suIzIIne! Starb S I-Irs S! 91:01: Trafflc S! t0
Name! Maj.sharehoIdJ Saiespiwne! Website TopModem _ up Kit pa per hr Weh Ind.InGB G6 ßlzaaldnass locatlon fax! (httpJ!) speed Name fee9 Incl monthmo. ova- host plan Imo over 5cm
Island Internet Inc. 1993! 250-753-1139! [email protected] 10,000! NP/ YN/N 60/ 24hours 2 Starter 25 NP 9.95 10 -2 Yes Yes PDM57Skinner St. Hookup Comm./ 250-753-8542 wwwisiandnet Varies/ BcTeIUbiq! 20-25!
xMainline 25 NP 24.95 60 1.50 Yes Yes
Nanaimo. 3c Oakvilie.0N 33Kbps Yes/Yes Immecfläte Power 25 NP 34.95 100 1 Yes Yes‘ISTAR Internet Inc. 1995! 888—GO-ISTAR! [email protected] NP/ X2! Y/N/N NP/ ' 24hour Entry 0 Y 9.95 5 3 Yes Yes .02 vanes PDMI250Albert St. Public! 60445685028 wwwistanca NP/ T3! NP/ Standard 0 29.95 90 1 Yes Yes .02 variesOttawa, 0N TSE 33Kbps Yes/Yes NP - '
Lynx Internet 1995/ 604-331-2511/ [email protected] 5.000! X2! N/N/N NP/ 9a-6pM-F Personal 25 Y 20 unltd N0 N0 PDM
508-938 HoweSt. NP/ 604-331-2522 www.lynx.bc.ca 10:1! NP/ 3! 90-60 Sat. BusinessA 50 Y 30 unltd Yes 5MB 1Vancouver, BC Canada 33Kbps Yes/Yes 5min. 113-60Sun. Business B r 100 Y 50 unIId Yes 5MB 1Maximum lntemet 1995/ 604-940-8921! [email protected] 1.000! NP/ N/N/N 4/ 9a-10p Daily PlanA 25 Y 29.95 unitd Yes No 3 PDM101-500747A Ave. NP/ 504-940-8952 wwwmax-netcom 5:1! T1/ 2-3! PlanB 25 Y 19.95 30 Yes N0 3Delta.BC NP 28Kbps No/Yes Under min Email-only plan 10 Y 5 unitd Yes N0 31:131111131113‘.1.1!. 1.989! 604-602-9158/ [email protected] 250! NP/ Y/Y/N 3/ T0 NP Personal 0 Y 18:88 150 1 Yes No 2 5 PDMI700-1080 Howe s1. Jason 0s Wan! 604-602-9108 wwwmdica 6:1! T1’! 3.’ 2 Business PlanA 80 N 19.88 unltd NP Yes Yes 10 5
I/ancouver. BC Vancouver 128Kbps No/Yes Same Äay Business P1511 8 80 38.53 811313 i‘ Yes Yes 15 5Monimer Online 1995/ 604-294-2995/ [email protected] NP/ NP/ N/N/N 3! 9a-9p Daily One year (prepaid) 0 NP 14.91 548 Yes Yes PDMI120-2465Beta Ave. NP/ 604-294-8341 wwwmortimercom 14:1! T1! NP/ 6month (prepaid) 0 NP 16.50 274 Yes Yes
Bumaby. 8C BC 28Kbps Yes/No Under 10min. 2month (prepaid) 0 NP 19.50 100 Yes ‚ YesMSN canaua 1975/ SOO-FREE-MSN/ NP/ NP/ NP/ NP!NP!NP NP/ NP NP NP 6.95 5 2.50 NPMicrosoft NP/ NP www.ca.msn.com NP/ NP/ NP/ NP NP 19.95 unitd NPRedmond. WA NP - NP NP NP ‚vNETCOM canada 1995/ BOO-NETCOMI/ [email protected] NP/ NP/ Y/Y/N NP/ 24hours Casuai cmising 25 Y 12.95 7 1.95 Yes 1MB M905 KingSt.E. NetcomOnline! NP www.netcom.ca NP/ NP/ NP/ g Serious surfing 25 Y 26.95 unitd 1.95 Yes 1MBTor0nto‚ 0N San Jose. CA 128Kbps NP NP Professional plan 25 Y 29.95 90 1.25 Yes 1MB‘Meteor: Pm Services 1992/ 604-272-2624! [email protected] NP/ NP/ N/NP/N 5/ 8a-10p DaiIy 50hour biock 39.95 Y 34.95 50 Yes 5MB PDMI103-8080Anderson NP/ 604-271-2624 _www.npsnet.com 10:1! MultiT1/ NP/ 10hourmonthly 39.95 Y 9.95 10 1 Yes 5MBRichmond.BC Richmond 33Kbps NP NP 25hourmonthly 39.95 Y 19.95 25 1 Yes 10MB‘Paciiic Interconnecl 1994/ 250-953-2680/ [email protected] 10,000! NP/ Y/IIIP/N NP/ 8:30a-9p Daily 0 Y 5.95 2 3 N0 PDMI4252 Commerce Crc
'
CSP Interner! 250-953-2659 wv.com/pi/ 12:1! 10MBpsI NP/ ; 0 Y 9.95 6 2.5 Yes 1MB
Wc/Vcr. 64Kbps NP NP 1 0 Y 34.95 15 1.95 Yes 1MBPlaneteer 1994/ 604-606-7620! [email protected] 4.000! NP/ Y/N/N 3! 9a-9p M-F Silver 24.95 Y 9.95 25 .75 Yes Yes vaiies unitdPDMI210-11180Voyageur BYuen. LLan! 604-606-7615 wwwplaneteercom 8:1! T1/ 2! 9a-4 p SaL Gold 24.95 Y 19.95 75 .75 Yes Yes varies unttdBurnaby‚ BC T.0.Ncr. 28Khps No/Yes 15miq.Prism lnlemet NP/ 604-270-7135/ [email protected] NP/ Rockwell! Y/Y/N NP/ 9a-7:30pM-F Personal diaI-up 0 Y 18.95 150 1.50 Yes NP PDMI120-8740Beckwith NP/ 604-270-6873 www.prismnet.bc.ca 6:1! T1/ NP/ J 10a—5p Sat. ISDN diaI-up 0 N 29.95 150 1.50 Yes NPRichmond,BC NP ‘56Kbps Nu!Yes Immediate _ 56K dial-up 0 N 29.95 150 1.50 Yes NPRadiant 60mm. 1996! 604-257-0500/ [email protected] 1.000! Rockwelv Y/Y/N 4! ; 8345pM-F Standard diaI-In 0 N 19.95 Yes 2MB .2 10 PDMI1420W.Georgia S1. NP/ 604-608-0999 wwwradiantnet 6:1! 10Mbps! 2-3! j 10a-4pSat. Dialup ISDN 0 N 35 50 2 Yes 2MB .2 100Vancouver, BC NP ’
33Kbps No/Yes Minutes 10a-4p Sun. Dedicated ISDN“ 0 N NoRapldnet ‘Ieeh. 1995/ 604-855-7638! [email protected] NP/ NP/ N/N/N NP/ I; 9:30a—5:30p Basic 25 Y 9.95 10 1 No No PDMI3-31018 Peardonville. NP/ 604-855-7456 www.rapidnel.net NP/ NP/ NP/ ‘ M-St 60 25 Y 14.95 30 1 Yes YesAbbotsford. BC NP
1 NP Yes/Yes . NP . 120 25 Y 21.95 60 1 Yes Yes‘Siwash 00mm. 1995/ 604-684-7007/ [email protected] NP/ NP/ Y/N/N 2/ 1 9a-7pM-F 0 Y 18.95 150 1.50 Yes 1MB PDMI
200-1048 Davie St. Localiy owned! 604-684-5252 www.siwash.bc.ca 10:1! T1! NP/ I 10a-5p Sat. Annual (prepaid) 0 - Y 9.95 25 1.50 Yes NPVancouver. BC Vancouver 33Kbps NP NP l 10a-5p Sun.Slryhus Internet 1995! 604482-1238/ [email protected] NP/ NP/ N/N/N 6! 9a-5pM-F Premium ‚ 0 Y 19.95 70 1 Yes Yes PDMIL8-601WBroadway DPEComputers!604-482-1239 wwwskybuscom 15:1! T1/ 6! Ä 12p-5p Sat. Basic Bus.Web 50 NA 49.95 Yes Yes unttd
Vancouver‚ 5c Vancouver 28Kbps Yes/Yes ImmediateSmartttlet 1994! 604-473 9700! [email protected] NP/ NP/ Y/Y/N 8! F 9a—6p Daily 0_ Y 10 15 1 Yes No 0 PDMI114-3855Henning Dr. H&SToussi/ 604-473 9080 smarttcom 11:1! 10MBps/ 3/
' 0 Y 22.50 100 1 Yes N0 0Burnaby, BC Bumaby 33Kbps Yes/Yes 10min.SOH0Skyway 1995/ 604-482-1222/ sa|[email protected] NP NP Y/Y/N 4/ - 24hours Unlimited " “ No No
WilliamCampbeil 604-482-1222or www.SOHDskyvray.net 1:1 II/easured604-885-3654 128Kbps ‚ Teieworicer -
‘Sprynet 1995/ 800-63-LOCAU [email protected] 235.000! NP/ Y/NP/N NP/ I 24 hours 0 Y 4.95 3 1.95 Yes 5MBBeilevueWA Compuservel NP wwwsprynetcom NP/ NP/ NP/ 1 0 Y 9.95 7 1.95 Yes 5MB- NP 28Kbps NP NP « 0 Y 19.95 unItd _ Yes 5MB
sympatico 1996/ 800-773-2121! [email protected] 140,000! NP/ N/N/N NP/ ' 24hours Occasional NP Y 9.95 5 1.50 NoNP BCTeI InterJ NP wwwsympatiooca NP/ NP/ NP/ ‘ Regular NP Y 24.95 60 1.50 No
NP 28Kbps NP NPUltranetCanada 1995/ 604-685-2229/ [email protected] NP/ NP/ NfN/N 4/ Ba-BpM-F Mercuri iemiloniy)’ 10 Y 4.25 10 1 No No PD250-780 Beatty St, DSmith! 604-685-2120 v/wwnltranetca 11:1! T1! 2! * Personiti 25 Y 19 60 1 Yes Yes 1 60
Vancouver. BC Delta r 33Kbps No/Yes UnderF1 hour Famili 25 Y 24.95 80 1 Yes Yes 1 60Uniserve Online 1988/ 604-856-6281! [email protected] 12,000! Rockweli! Y/Y/N 15/ ‚ 9a-7p M-F 25 Y 8.95 10 1 Yes Yes PDMI
27009 Fraser Hwy GTremain/ 604-856-7796 wwwuniservecom 12:1! 10MBps! NP/ ; 10a-5p Sat. 25 Y 24.95 120 .50 Yes Yes
Aldergrove. Bc Aldergrove 128Kbps Yes/Yes NP i‘ 10a-6p Sun.
revioue survey and may not refiect current ratea and servicee. "Call ISPfor detaile. "flndicates annual rate.qweb page design , D=Web eite deeign, M=5itemanagement, Izlntranet consulting.
Service provider surveysome ISPsmisrepresented themselves.Giventhe size of the ISP survey, it is impossible toindependently verify all of the Informationprovided. It is recommended [hat you calIup the sales depamnent of the ISPs you areinterested in, and ask them detailed ques-tions about the types of services they pro-vide and how they can cater to your needs.In particular, t ry to determine the Ievel
and competcnce of their technical Support’
staff, and try to get a feel for how Serviceoriented they are.A good ISP will go theextra mile to pIease its customer base. lf youdon’t feel comfortable about closing a dcalwith an ISP, den’: do it. In this marketplace.there is absölutely no reason why youshould not get the type of connccüvity youwant for a reasonable price. O
4 COMPUTER n u n : Q
GuessWhichCartridge Saved
Our CSWQELSZQB-
QUALITY
GUARAN'I'EE
These days, the only way to tell ourremanufactured cartridge froma newIaser printer cartridge is the pri_ce_.Our cartridge can save you as mucha5 S70whiledelivering the samehighqualityand reliabilityyou've come toexpect from a factoryOriginal.
COSTOur remanufacturcdcaruidges saveyouupto50% of the cost of new carnidges. AndjwzrJm/ing: da12? and t/Jere. Weuse replaoementparts that cxceed the specificationsof factoryOriginalparls rcsullinginmoredurablelogggrlastingcarnidges.
Haveyouniedaremanufacttlretlcarnidgelately? Over thepast twoyeaxs,dtescicnccofrebuildingtoner cartndges f0: laser pnnters has improved cltamalically. Infact, independent studiesnowSl10W that remanufactured carnidges arehigher quality dian newones.
In the old days, our industry used to simplyrefillcarnidges. Butfimeshave changedand atVancouverTonerPlus We pizide ourselves onhaving thebestcartngginthem‘dusg.Everycomponent of every cartridge is tested,inspected, and replaced asneededwithhigherquality parts than dieOriginals.The result isacarnidge that producesbetter quality text andgraphics than otiginally-manufacmredparts.
When youputa toner cartridge inyourmachine, youexpectgrcatresults for the lifeof thecarnidgc. Andwith aVancouver TonerPlus toner cartridge, that’s just what you’ll get—cartxidges thatwork the first time, evelytime.And to back this up, every ‘toner cartndge comes with our personal guarmtee of you:
sansfaction. Youwon’tfindanyloopholes inourwarranty-ifyou’renothappywithourproducts,we’llgladly refundyourmoneywithno questions asked.
CALL VANCOUVER TONERPLUS TODAYAT(604) 552-3280T0 START SAVINGMONEYONTONER CARTRIDGES!
—AIways free pickup and delivery-mäum:
awrtsu
CASTEEDGE REivEMxIÜFäCiÜüiNG 000l’.
Fax:(604)552-3281email:[email protected]
—ASKUSABOUTOURLASERSAVER13STEPMAINTENANCEPROGRAMFCALL NOW T0 RESERVE 510.00 ORYOUR H R S T ORDER.
Q COMPUTER PLAYER! b MAY
10% OFFWHATEVEER IS MORE!
1997 b http://www.comApu
Feeling pI/sliewxExg o -ByPAUL ANGYAL o o
lIs itlthe ultimate junk unscrupulous entre-prerieurs want to shove down your throat orthe rave,new world of automated informa-tionflclivery? I: elieitsthc-sirongc-ste expres-sions of opinion, not unlikc When voice mailwas eashedonto the unsuspectingmassessom ten years ago.Halrdly a day goes by without some kind of
an jimportant” announcement. Strategiealliances are being formed every hour‚Week-longlevents are dedicated to it‚and the pop-ular Ltechno-presss vocabulary is laced withrefenences to agents, channels, subscribers,narmwcasting, and so on. You may some-timeis feel that unless you jump on the band-Wagon,you will be hopelessly left behind asa modern day Intemet-Neandertltal.Welcome to the miningof the click-stream.
Push technology has artivcd in earnest.Hold the anchovles in either caseCompare push and pull as a pizm delivery
Order:wouldyou ratherpick the store and thetoppings or let someone else do it for you?Of course, push technology-like anything
else raken in moderation-has its benefits‚mosnly in "the corporate intmnet environ-menLwhex-e regular information updates canbe delivered to all cmployees automatically.The cartension to that is the “extranet,”wheresome infonnation is pushed out to suppliersand qustomcrs on a selective basis.Bau? why is it so significant? Quite simplybecaose it pnomises to transform the Internet aswe have known itfIhe emphasis is shifting tobusirxless and thertin lies the big danger.unlike
market research,where advertising isbasecl on statistical averages and cxuapolation,with ‘push they can base it all on youfiperson-al profile,”so thcy canpinpoint their targetmar-ketingwith laser-sharp accumcy.lt i5; a big deal, not for you and me‚but forthe push-vendors. For us,the absence of aper-
’
maneht connection to the Net can easily out-weigll the benefitsYou have to put up withperioädic updates, downloaded to your desk-top atgreat expense of you:- computers pro-
speed. Still, it is convenient and youhave nothing to do-except Watch the com-merckals,which soonwill look very similar tomeirTV Cousins, thanks to streamingVideo.Early push embryos were the e-mail alerts
and in-boxeswhere hyperlinks gave youaccess to sites directly from the mcssagebodvThcn along came Pointcast and gave usthe SLCYCCIISHVCI’ advcrtising, a whole newdimension where newsbits were pushedonto vomdcsktop at regular intervals,select-ed fmm a few“channels."Of eourse, Pointcast didn't do it for you;
they did it for their sponsors and the contentthey delivemd was brimming with Commer-cialmjessages.Largh horsesOther push-vcndors followed suit as the
real revenue gcnemting potentialwas recog-nizedfby the big players. lt didn’t take longfor Netscape and, of course, Microsoft tohitch ithemselves to the push-Wagon. Theirversiol: 4.0 browsers-duc out any time
e r - p | a y e r . c o m / -
new-will have push technology built in.in Microsoft's case, along comes yet another
attctnpt t0 cmatea newStandard(CDFor Chan-neldefinition format),with anoblegoal ofmak-ing it possible to view content supplied by dif-fegen; ‘iery iüsonable—cxccpt"
’
you become fully dependent on the InternetExplorerbmwser,because Netscape (at leastz:the time of this writing) has not signed on toSupport it.They try to counter CDF thnoughJava and Javascript, in the name ofopenness.”TimeWill tell who wins this one.The endangered species are the thirdparty
vendors, such as Pointcast, who gave us“push” in the frst place. They will have tooffer value-added Services to remain in thegame, Strategie alliances notwithstanding.Pointcasfs release 2.0 (nowin beta) does justthat: it irltroduces“Connections,”whercby anyaspiring Web site can become a channelprovideron their system,gainingaccess to thecompany's alleged 150,000 subscribersTheywill also provide rating of contenLWatch themarketinggurus salivate over this one.Justasapomtofreferenccifyouarestilla“pullcfitheieisalesswelllaxownalteimtivebtowser; the Inteigo bi-WmEoLI andWm9ioutthere,availablefi-omhttpzl/Wwwteadieisdtcom/fora small fee.You can search through thcirrated Web site index library (continuouslyexpandcd)—a kind of aV-chip approach.Push product paradeOthers, such as First Floor Tcchnologies‚
promise to giveWeb sites the ability to noti-fy identified users of content changes. Notethe reference t0 “identified”here.SpyGlass Inc.’s product addsWeb fimction-
ality to non-PC applications,one of the mostpromising practical uscs of push technology:fee-bascd Software upgrades. Apparently,Xerox has signed on and plans to introducea new line of copiers with embedded soft-ware that can be modified, upgraded, andeven diagnosed through the Internet.A mixed bag, the fange project from
NetBox introduces “parallel pull."'l‘his ncat lit-tlc pnogmm (still in beta) gives you instantpower-shoppirlgYou input the itemyou wantand jango will scan (“pull”) through 30 or
A more Internet stores andmalls all at once,anddeliver (“push”) a summary report in no time,with price comparisons‚ links to the sites—even an Order form. Ostensibly, the same huntfor a piece of informationasopposed to a bar-rcl of cheese can't be far behind.GlobalVillage/Air Mcdia’s NewsCatcber is
anothcr girmnick, as innovative a5 you canget. The littlc black box captures the newsfccd from the air through an antemxa, so youdon’t have to be online at all. Demonstratedat the Comdex last fall, it shouldmake itswayto the market soon. It kind of remindsme ofanother black box where I used to catch thenews through the an".my short-wavc tadio.Thcyearwillbeacrucialtcsttoprovcthe
technologys stayixlg power. Watcheis‚_ likell)C‚ see very littlc room lcft for newcomersandexpect a fall-out between existingplaycrs.We, in the mcantime, will have to try to
develop some clever techniques to zap com-mercials!
mnmmm. 2*=rmmw1mmmswmmm
Umll V i d e o Q gsavlneaoaamomu 5sn e w m a ) Pnoauasenm gaomwxpaessbeaama sussmso"flüflvfiafleafl 5msuauumnaamawnm gxysamH n rdgg‘Onsis ‘u- spaüiwaarzoae „155275
unewuniunraauczcpu S a w t m fl m m 9 3 5 msmlsNPclfirionllvxctfizsenmß _ a.zsacppeineamcadne „ 7 _ m m m s
W j g v fi j j r m “ a y g ßPansoltlAflßFloppyDrive V e n u s - u m „ a 5naaaoemoaeqraaxunnve "°“°"!'=‘7‘"9 amNewssmwge PCI 2MBVdeoCamw. b‚..„'i""’_5°g‚r-L,m"sm,'"m5 mcfi12xEIDECDHCHI rzxnax/atxwmm SIäGIEBALL- vavunavuco-Aoonswuerannm 1,ESSHBBIBMSOIIIdCaN ; w Cm“
5 0301gS a n d s I l l ä / A W E M
:äzw..m°sszmw mzfiäxazpssIangflEBZpDfivePamneI/SISI 9m
:‚:.‚mm°:::a“;2:;.WW mm m w ästpraExpuessßßFaxNoimh-Llflodsmmafi) 5135U.S‚R. 33.6 FaxNoine Modem lnuEn. s 175.129AcaaasFax/Voimuodetnm/SVDIM-njem 5135/5110
Expra-ss Micra fllasfl ina i- Tangawi SystemCaquiilam ‚fluihyrizad 9921erSyeuscaladnwideuaranyavaiwleLeasetooun! Pleasecalm o t e ä flFhqfiallbgafleäwfiascfiulgfltflunofi:Alkus-elncahpiuz.i ä n 1 i x b i a ß 7 h ä ß fl
2-555 Clarke Road. Coquitiam. B.C.TeI:931-8803 Fax: 931Mon. -Sat.11:OOto 6:00 Sun. ä Honda r Closed
o: profits 9,6elping childr
Camuwfifiorisifnfluwsäoflieeäflmetc.
-8874
If you're going to buy a computer,Fi l l your hunger,and end their’s.Powerful Multimedia
‘S,Penfium Gompuier
Micro Business ComputersPlione: ( 6 0 4 )6 01-8240
Including Monitor
Q couvurn n u n ! b MAY 1 9 9 7 D
--ByCHRISTOPl-IERGULY--Idevisionaxxdpctsomlcompum-rmnufiacnzr-äswillsoonbevyixxgbrdmsamclnwnctgldiumcgzysam-firxramlystwiflnaljshgh-Ipchraieazfilfirm.l‘ W hm contcntfiotntlnc lntcmct becomc
asilyacccssiblctoTVvicwaxthcmtcrnct
will fractutt into two pieccs: a compmex-opntric sidc andaTVcenu-ic sidcfsaysGen-yKzuflnold, who works for ScottsdalcArizona-bpscd In-Stat. “WcbTV Will lct you vicw anyWbb sitc on yourTVscLznd with a point-
httpJ/www.computer-playencom/
um Cmnmgon,"apmisoohofl„dann;
Jhkwßfin1amdtbe|Whb:ANOTHER TALECONVERGENCE
OF
anddick intcrfictgyou won't nccd (o know
atxoutcomptltctsorcvcn how t0 typc.’Thafs a socnario people living in London,onmriqandkcpcmigxygQacbocJmysomlbchoedwith.
TesthgtesthglfßdlCanadagclsappwnlfiomflrc
bolhcnmmtnniiswillbelhcfirstinttleaxm-trytocxpctianceWdilVmatwoycm-nmkct
continued from page64Stbscriaershflßiviglflflmwimefive
wIflsounnhflnV-dfipmstxemdmws(onoefsznülioJltnttrywialsohzvcacoesufüxmmnüyhptcsjwlfihamwstesihmsmaealctltirownlrogaumfiyguntentthtmglamailwebsitcatxzcssfltatspe-chlcanmunuy‘mexiaoenaeshlxnhciisBdrscxpexinmmaboinchndcsminamzfive
‘Ncrmpmaxgwhcxviewuswiheafledickanmsaemiammsaxparfijfllchmopinion poll during a ncws bmadast.lmunctivcdnwswflbcihnfifiadbyaspccialtmmflnescmen.ATwwilabobeiachxbdflvlndJyulsumns
‘nluxkmzflllqtmflrywibcapfipedwihifiatedkcybtmrhdnaibcnsedmcfluplflrqxecdlmalnetfivtcscfitcflyfiunfifi-ndeväxmsetal-‘orexmqtfifsmmnc
Avhinhfixmhouzvnfltyvwxfiltfirkmthxhnmsctaiifisafladivfibaagd-suhämicphxessfinelmomom
‘filflifllflkünWlilcnclisbziafirgttnclmcmctmwlxxwn
cvcnstnmaclrifigwmflnehfimt.(Inlrhkxfilncfsfist-Wlzibisäsflnfia
zä-lnmlmcnnctodywlcvsimaxlvideonct-wuhwhichmbeaoocsedwihaslflldard
nfingschedflcbysdaxigtttpmgmsfltywmtwscchdncotxhflryvnnmseeflman.Whcnidctnfilstsqxunhqlist-‘lvpte-
senmdanngzinc-styledäxwwfiralfigmws,ptodn tevtws, 2nd peopk 511% äd"fifillcliüfitfbbwfirNctlttwuknnsscvualpxlgzuns,hchuig‘flnmnmfltWcifanrPI-ist-TVNcws.’l fi w b a x d fl t fi a l fl a t w r x a
WvunctivcwlidlanbeüxwxfltnnkdafltsirofdroanpmlyflmrxnnficunultvimSofiwmcmflncpaogznnmmmylbnüLhcorfimrhm-PcwihzlxsnflßdRAM, 2nd wocks wih an: NaxapeNafigtorzomlatervctsixmnfllfiamfilntenveüfnußfl.Vmmcüvccanpxssesvideocipssoflncy
czntm&mdaamcsbwas2‚000bytespcrnnntwlfilmflncucmdtywn-hflnsdrhahbtwliqtckvämtnwubacbctigz
decfln‚flthaemq’mUS1nwub—Am(IIEzniNlIJ-aqfilyedvinflfiaflcfixßnfigäxmfiqflüavzflpfluflqxfluafl
Eectin-ifiiafinswueflkmänpflr
fixaconmncflormovigaqäaswdasfiqfirgbndgumtßmflinmhciygnfl»tineaimmddxancmts‘lhcdawlnchfirlrmdtaaflsfisüntflfs
virmalmdmdogyiscxpufivc-wfithacxm-plctcvirnnlonyxsaaxlbaxsfisgasnnflilas81.5million.
‘Ißednnplnsgnttoaneaüawlnwibczuanacmnmncww
1Asu-vcy by Ncw I rak- lau! j g ü rx p u 5 fl n l 2 7 n i n l m I mhadswibcusigwebwbyuxyzznnjmdisnabaixmxtnanigsxmbviixfspodddchyaltyusxmhflymdnic
lociigafltlimrydpimchlfikrmighCandlhackrnvicwllrxnxqxccfiut-‚Inv
mmnnrfirlhehiet. O
g-stems <
"TEECOMPUTERS
TRI CITYcompurens
10269 - 128111St, Surrey Ph: 581—46Qf Fax: 581-8382 3610BWestwoodSt. Coquitlam Ph/Fax: 552-3119
Great Prices‚ Great Chqices,Great People_ ”CD SOFTWARE LIQUIDATION”
Truck Ioads fo clear 55.00 8; up.MONITOR!)
VGA3nd SVGA used andfactory refurbs.TVMNEC,andother brancB..599.00 andmNEW MONITORS
soeptre(P411-14')...s249.99Seeptre(P511-15’)...S349.99
GreafPrices o o o Spedcas . . . . . . ‚ . . . . . . ‚S9__m_m _____ &“‚
i m - Ü P D M „#22200 Anmcpu SoftMenu) w a r m ........„ w n o mKeyboard --------517-00 j Prmercabaes ......... . 331993 Buttonmouse . -. 310.00 T Motherboards. Assoned caues ........ 31.00:...äT“€„‘5.i"ä.-‚;‚a'::::s‘3‘;:3 whgfumre vechnology rode»
“ M u m m ------""-°°“°
16x . . . . . . . . . . . -3185.00 SM5Maüboatd_„S159_wVXchipset12x . . . . . . . . . . . -5145.00 SM5A Maamwdgmzoo vxdnpsa 6m!!!10x . . . . . . . . . . . .
.:135.00nmmmoam..s1a9.ooVxdfiaset We buyund sell.
8x . . . . . . . . . . . . _. 125-004x ____________ „S8500 Hardware undII-IISMONIHSMONEY SAVER . s’ slellß’
12xcg-Hqocgagm
We Bulld Them Custom t0 Top“ F a ” Y°“'3P°°“i°°“°"'-C°"'°i" w i d s o u a i n g u u60 Watt anpified '
e,“‚SETO,„S00for a Quote todav-
cwssrmnmpmm _NEW Alm “SED '
COMPUTER HEAnAcHm ; „ m “ , ‚N STOCK CIDVERDAIEwe've 9mthe eure’ Computers for every budget.Turbo FAIRGROUNDSTheDociorisin. e08axrs‚2as,3a6,4ae‚wehave s fl l fl "
Over night servioe. them all-‘
16 72Pin--.s105.0o (edo or reglar)
30pinNixeCNp 1 MEG...s12.00
MEMORY8 MEG.-.555.00(edoor regdar)
3o pin 1 MEG...s7.00
MairoxMieIimmIeg.-..S359.mNewandUsedVlVideo „SlllfloaupLOcaIbusVIdeOCaIdS ....s2o.o0a...‚IFMBHKHGHT-Dmnuolercatds . . . . . . . „S511!M0no‚CGA‚VGA<aIds „S541!NenuockcardsNen&LIsed--.S15.wsupNewSUsedHardDrives „SifiwupSCSlsotmdcaIds . . . . . „S3100Assoriedsotxxicards.....s2o.mamNewTovcverCase . . . . . . ‚ .501!)Useddesktopczses ‚.
UsedFloppydives . . . . . „S2000Mousepads . . . . . . . . . „szooaup
Assoried Parts
. . ‚SIOIDSQ
GOLDENE)?lslocatedilsideflieSUPERSFOODSTORE
Get ConnecfedWeS-e|| AXION INTERNET KITS
OPEC9AM-7PM7DAYSAWEK
http:l/www.computer-‘playencom/ 4 MAY 1 9 9 7 < C OM P U T E R n u n ! ä1
äääüiäääDy/nalab '
ifiArphic ’ EEMonofype%4ÜÜ ? ä
mEü—%€%äwääämxfiääfiäää.
%Efi—%äifl%äm%E%Xfi&üEX*%X*EX)
ääääämifiääii%äflm&EEfiEäEffiäää ’
äfiüfiäfiä
‘a-h a -— ‘ ß fl a
:—äääxßflETEäEEan » : ä z m — g m a a ä «: % _ ä ä ; a : w g a » m g x ä%#_ä ä äwüLfi—ä=fi&fiä%'Eä%RfiEEäß&flfi8’ägäääE 1 - 2 ?
zäiäääwääxääiääE%bä!EF%—#fiEflä»fiä%üääflfi@%ü»ääääfi2 äfiflääv
2 !ää%E%»ißfiüAämE725a »mamg n gwmnmä ä m a o s ä m i m m g v
iÄü=ä%Hflfiä—äßXmuäms
l
Lfäääääääül1fiääfiifi»äK%äääH
FKä»fiEEfifäE?; @ m fl % # fl fi E ü ä ä ' fl
5e5saäüäß?L; m ä ä w x ä m ä ä » E ä m fi
Eäiäfiüüäfiiflm?’ägwa2u%=äaäa—aam fiflfläääTäfiäää i z:äm äfiääääfiäiüäü?i fl g fi ä fi ä ü ä a a m m m s
aanmvmxäva... :->s m s % x ä » a # g % ä ä m z
F’äEäfiämä5!HäRRäg & # # m » s 2 x g € E ä m x *cääwaannmammfiwäm*?&’üäü3äT?
:Efi=ä%mÜuäTfiE&üääfiitämäwäflflääfiä#&7?flä8€Efiflä*°
j ä fi ä ä ä v ä ä fl f ä ä w i
‘ä
Hfiüämülfiäßmfih
Multi-Muster Page:fiilkläää 800%
‚ -
PENPOWä? ä m
äfiflfiäflfi Group ßEIHäAHGTäQPFQE!gggggzgggfi „ d ; Efltäfiääfiääfifiä
’ ääjtTfIäääfilfiflflfl:Align Obiectsäiflälä Polygon SeflingsEQFT Murks ffi E E TrappingDrag-and-drop
l
&+#fi>ä%äEm&Hfi( m mm s a fi mmm a a a m ä g gwwn»ma2äänmnamä»üfiüflfiflfiääümä?
fiwüwWE%fi%üäEWä9a nä m x a w m s m ä g a ä g
WuV43J' 4553?? v fitiiiiifl‘ '€ük+:ui#&mä
' * ä * g ‘ * ” ä ä— ä 5 * ä n w m m m a : & 2 ;'@%*ä*fifi*i?‚ mwgaugiwnwfimmmm?-fikwkxäääääfi ääääwfiäääiäiää' ääifiääfi 5J\{6
3V ä) ßä- . EI JE 3 % ?‘?’ä‘fai’ä‘ia’äizsa‘ä.ania Efiääfiäifiwääfiwäfä-aiäiäiiifi+iüxäeyv 8 E g ü ä ä m ä g ä j ’ ?.- . 8 % ä A a % x x a m s ä m g ä“ ” ” “ “ fi “ * ‘ © vETfiäE&mäWm%ä%H&MH+ i ü%%ä 3 w _ ‚- s m « ; a ä n n & a u w 1 a m 8 2:gg?ää%gägäg‚gä‘ ri-ääfiffi; I-Äiäfitfiffiäüifi 5 N
‚ —_ Ä * % ä q % m & ä Tääfi g m a m ä z g m v v
i3 COMPUTE! n u n ! p u n 1 9 9 7 p nnpn/uuw.compupet-playeucomr\Ä4| _ [ { „ „
«EA5W751% 3 fiäfiUimLin)
PCifllflfifiääEäfikääfiüäßTkäfifliäüFfiääifiäää ' T}
EiifiTfiflEH ' ßlfiäififi ' Eääflfli?
fiääfisäflmäfiifilifläfl‘Feääüfäfiäfil? :
Aäfi
I n t e l CPU 166MHzPcntiunlothc rboard75-20OI1:32IBEDORAI12xCDROID1-iverFullDuplexSoundCaxd2. 1GBHardDiskDriver14"ColorIoni tor33.GKFaX/Voicc/IODEI
33H
InteIHXCIPU166HzPcnt iunIothe rbon rd 75-200E1232x35mm12xCIDROIDIiVerCreativcLabAIE64SoundCard2. lGBHardDiskDrivcr15"ColorlonitorUSR33. ölFaxlVoice/IDEI
AEEEBEHHEHESSEÜVää-F * ä ü fi i ‘ Hfiflääää° 131905353 ’ 1913399355553' fimäfläflmflfiüfläiflfilflfl—H‘ ’ {Eflmäfiäflxlflifiäfiäli-EQEQHUXHZÜBE?
ÜxlibfiääißfläfifififiüäE E E Q R ' {Bäflfiäfifäfläüßfifl =äfiäfiämfifiäüfiäfiifilfl?ää ’ — H Ä R % H Q H X Ü H ? ‘ficRGaIe * _t_tlnternct a fiiäfifäffiäfifilffiä?
ÜTä-Eäfläfifl ' E T ä ä ÄEEEWTU ' EP1555555?‘ ’ 3%äiääßflfxüfiüg7flxflflifliE K E E ' ääliääfiTTäbäfiä °
ääGa-GEE ’ QäTfEGamflWETfiäffifää ' fläTifi-{ififimfiäfiäflflä E - ä ’ EäfikäfflfiäGalt? fiäflääflßläflfifääüiflcflfim—fi€ ä ' äEÜLXEViDÖOVSEÜÜ’ äiiääämsäfifiüfim?
gzsääfijfififigflindowsfinncj’fiäfiffiäifimflfiääfifiä ’ äflüfi/‘jfiääTE—fäH‘JK5IEfiEG=E ’ fläää E5E a ä ä fl fi ä ?mm’ ‘EHXÜI-‘filflfififlifllEfififlflmfiflflfifi r ä fl i ä fl g ä
fiTETWEzgECPUZFELXQQE ’ 935-Eääflffiäcflltflfläüfiäfinfl!
ä E ä ä ä ü fi ü ä ä Ä m ä äHEREEEäEüH-J’ ’ ääfläTäfifiää ’ Fääfflllßäüäfllfifläääfläfiäfi’ Efüääfilfiflääfiä? ’ fifiäfififfi‘ääfl’? ° Jäääfiüäif ’ fiifiälfifiäEKGI‘FEIE?QEHETH(%fi) ’ {Eäfiflääüf-fififiä ’ flfläfäfiffiläüfTäääilflFullDuplmOüä-F ’ ‘ä’fäfiäääfilntemetäfiäääfifif ’ 23Bäüääßfiffiflfiäfiää(fißilnlcrnetPhone s ägääfiääüfijfleyer) o
Efiäffifis‘ ’ äüfi?fiälälififflääfififihäfiäälfiä’äü‘F ’ Efläääiflfi-ääfiflifiäääI15 ’ {Efiifläfiäfifim}?
BH} ' ä ä ä ü fl ä ä fi i äZiifcfifääßfi] InternctPhonc n ftflflflfflfiäHEÄEäHfi-fiäfäälääüfifififläfläwüfiiääflfiäfiääääfiiflä
ääääfi ’ ä % ‘ fi R ü } ' ä fi ä fi -
EÄÜEEEEÜ ’ äßäfiäfiääflä5%’ fääflfflääflääfiflää’ä%ä
äfilfläwfififlääfi’ fiääffififiiflßfl
w . . . . I)lääväfäEfiffliäTäfi?flää
äEHÜ-F ’ fifitflflflßjfiäßäääf’ äEU/filfiääfiffläfläälfilf ’ ä?lnternetPhoneüäfiäiä r ifiäfi-flääääiälfläfiü-FT?
äfiäääTääääßfiCreativeflüäfif?ää-flfiäßääTFfi ’ fflfifläfäfifiäfifiififl ’ äääfiibflFfifiQEKNRäEH-ää ’ ifiääfieativeEU‘? ’ üxfifiä-äflflfiäEfiä2 5 l ’ Ubfiäfiififilflfläfl ’ ää T fl T fi ? o
Monitoräßffiäflää ' äääfl:Eäfififlwflifiäääfiflfl ’WEIN‘!määttvtwmäääcwsloo ’ {BEIä(Viewable)fi’\Jk/J\üää7fiäfiä °
fiääfit ' ääfiäfifimäfiää E W Ü ä fi ( V i C W B b I C ) % T - ä W’ fifliTäfläßfiit-fihtük 'Ffiäfiääääfifi-Eüäk ' fflfiffifiääfläfifläääi’?
ä ä ä ä ’ fifläfiääükää’ fiäfiäänflifffl ' TäääfliCADSIOOfäEI4H—fiEKJfiä„. 2-)
KHHWODEH) ’ ä ä ä üTflfißifäffiälfiflä ’ ä ä fi - E fl :äfi > fEjtT-Jittüfiwfilkääfi 'ääfittüTfläiFrflüüälääßlflä7%* äfifitflfiää ’ älfiäflflfiflääfifi ’ EäWA-äflläläflfiäüäfi fl ä f fl fi l fi ( ä ä Ä Z ‘ ä ä ä ü fi ü)o
Efiääflfigäfiääääfi ’ ääääTfiääi-jffi i äTitFflälfiäT?
QEQÜSRWWPÄEWU ' E3753?äfifläfifiä-fifi ' FELXUSRäEHä ä k fi ' ffläüäfiäfiäfiäifiäüääfläflfii”?
fiäääääAää ’ LIEHEUslfilläfiäffiäflü ’ FTILXEETEIZtääfläfifiällskfiääfiä ° 3 E : 'ääfiläTäähtäkfläflfiäflzää(USR» Motorola s ZyXEUfiä EflfijfltfiüäaFf * ääfiääfiüäzfififläfififiäakockwelläATckTfifgfljäffigagHE > TffifiääfififiufififläfifißEäfitfläfifiäfiiflmfiä °
Eäflfiifit ’ X5Jfi5WÄ-LXJ:%1Efiätüfiäaaafilfiäiäflääfifiläfliäflää °
Liäfiffläölämä ' äfifißäü
üäfilääic-fifäfiüT ’ Qfiäfiffflää ° rm2 ’ ‘äffjäfläääfifiäflääffißfl/fiäfi ' äfififlfifiääfilfiäüäfiäääWW/o’Tfiiälfifiäfifäfiäläl—äai#fr‘aüäläsox‚Iiflifiäfiifläfiüä?
{Eä > ‘äfääfitäfififlfläfäUskääfiüäflüfi ' ifiifilfifläÜSRFFJÄäÜEERHW/väfzfläfiusl‘Efifiäfilfiä ’ {EifiäfläfilääffläHER? ’ Hüfiüflfiäüäü-fi * E}?Täfl!
ä T ä g fi t t ü fi fl ä fl ä f fi i ääfilfifiääü ’ fififiäüääffiäEfiääßi’?
Tfifiäüäffijkäääiäfiä?Eäfilfiäfi ' ‘äfififiäffiäfiffll’/J\E%7EQE1JH"J7
E L X E Ü K H ü E - { E M V - F C(V-34tfl5fiäüßJ-fäüüäiß)wijfiä’ ä ä Ä fi T - E 23- “ W ä ä ’ 599'593Tfiäfifiißßfififfiflfäfiäfiä ’ LääElsvfilifläfiäfiäfiiäßä ’ fläkä?‘ifiV-FC’fiuäwfiääfifi ’ äEäifäflfiääM-“Bfiüäßfläfiä?
QÜÜE?B4JUSR7C1J{EQFEIDSVDfi ä ä ä ä ’ E E Ü Ü E E E ’ Ffiää’325R- -I)
Wflä ’ äfiififii ’ äßälfläfiiäfiäfifiä?
fifiäüfififlfiääääfifiäüä‘?fifläffiiäääfifflflsz ‚ äßffiäfifiäEILXEFELXäÜE4J436(ä-’*36)äfi ’ F‘)?LXQEKMSÖEHEIETQEEÜR ° ilfläflfä?iääfilflntemetfiüäfiäiäfi ’ fiüä‘?fiäfifififlindows95ä0sl2?äßfil‚jäflä'g‘WöflfiääääälifläflfiääääfifiäfiflfjPentimT?
IEHÄÜLXEÄEBUEH ' ifiidiäfiäfifläfißfläfiäö ’ 533%}???üääfiäfifiä?
m1 ’fläääü ' äfififiäfifiäfiääfilfifit ’ äflfiifiiiilififififäq‘:ä ’ flfiäfiääfiäTäääü?
ääfiääfläfiääfiäflöäfi' äHEEEFH ’ E I R EHHREÜEiääfif’?ä-EEHLEHEEH ' SJÜELXÜÜBÜlißiäfiiäfßT-m- ;Q
Täffläfli ’ EäfiääfäfiääHflfifiüfififläfiüflfiä ’ E T ä Eüfiääüüi?E ‘ CPUfiäiäfiä-a‘
flEfiConputcrPlaycrrEHW-ififfiiä‘ ’ 75535‘ 536‘K5 s K6‘ Pentium‘ PentiunProBÜCPU ‚ flEEäHäßECPUWäH ’
iE-äFQÜJEEHW/kßäflgäflä-9
ilfläfiäüTaäwää‘ ’ ääfiiälfliä ’ fifläfifä ’ ‚ääälfitä?
Inicläcfllfiäjfifi ' WVEWEE* üfififiäfiäfiflälntclwllfläfläftflffifflää ' lflilntelcflläfiäfi!LXEEEWWEßäüä-FIEÄVFW °
flfififiäfiäflwilüäflfiü ’fi5ÜäCyfiXÄiAMD° Ffiämfaä ' i?üficpuäälfltflcpÜäfäfifflTyääfi{L1 ° TfÜCYIiXRTQQäEWEfQ ’ TEEIntelfifljßöfi ‚ flgmggifagstsscpuüH1I-Sx86 ‚ gfissöo ama IntelääääE-‘ficpuflä ' ääläääfiäfiä * üfQPentiunKfäfSSSG) o Cyrixäflßflfigääfiäfiäaz‘: ’ Hpefltiuflifigflcpufiä6x86 (mmess)o
FfiLi ’ äfi/Käfififiälüäösö
2nd „1495W.1lthAve.Vancouver, B.C.V6H 3Y6
1€Eälfläfiäfiä-ffiflzflofilfififlißfiv ä 15lä H3’äTflllfCflääfiää
gäqäügümaääfimzää»@H%%m?ää%m&fiaää| E fi @ ä E E Z ä E '
——n—-——-—-—..—.———————————_.————_.—_._————_.——._———_._._.————..—-——.
ScotiaMcLeod ääääHäfifcfl I Thomas Klein; l i l l ian Ying
http/Anm.webhaven.com/money
51:1 ; Efiäfiä 1:1 älücfifiäfizäfiäfifiäfiäfifiä)p ; fiflßfiüfiä E] ää+kßäääfiä —
p Rkääfillafiüfi 1:1 EHHeieräjäääIfi 3 e-mail:so: =‚äääc/A): (ä)= ms;
Tel:737-3503; Fax:737-3524
IEIZMYEJEHÜ.i
‘käflä’ fäläälziäofiä[email protected])@äflt—.ä& ’ 57.77.1553?‘
= ‚==5:5 5Pj fi ä fi fl fi Tel:(624) _93o91oa
/ 341-0180BIS Information Systems Efiflfiöfiäfloffiifiäfi
#203424 E. Pender Sireet, Vancouver B.C. V6A IT3 hflpJ/mwyncwimoom/bis/Office hour: Man-Sah, 10:30-15:00 ' Free parking 1 hour
MuIflMeflia Asia Software Suppl Eentre Mama;.ypmjgmAsia ComputingSpecialize
Twinbridge,MSChineseWindow, UnionWayDragonWriter0 Twinbridge 46 Fonts forW1n95-Chinese pro for office 970 Hanyin and Chinese Fonts Package° Eääfifiäfi(fiLGST ’ffiäfiäfi ’ VISA171%)IIFXWmdow 95 + 32 äiääßwfifl° fiiä \ ä fi ä ‘ ääfiälfiä”° ääfllfiäfilmfiäißfififiää(Technical Support, Dealer Welcome
[RichmondEi:v 5H10-11E]‚ffifr-ätä]C O O O O O O O O O O O O O O O O 0 0 O O O O O O O O O O O O O O O O O O O O O O
Computer Systemso AMDK62001VlI-Iz ----------S2299.°°-Kfiäfilfiääfifiüäfi( %ää% * fiäüfiä ‘ ääflää )
o o o o O Q I o o o o o o o o n Q o o o o O o U u o c C o Q Q Q o u u u -o o o o Q o o a n o Q o o o n o o o.
C (33%?) ‚ _ [Intemetfäää]om - -.„„„A%. 3&3? ;‘fi*Wmm!?fi’flE3N‘ Photoshop * Inta-netßä E ; " www-fiflflfikfikvrin-www)‘mxfläxfig‘äfäififi i * fiäüfiäfifitwin-game)‘Fqzhooßmofiia ‚g ü t i g )
* hnpJ/wwwcwinsom/enewsOfiice Service, Chinese Typesettins.
' FPICDHE-‘IHEEEE....(fififlfi ’VideoCmfiffifiß)
httpzl/wwmcwinconflbislgnme/ v‘CNUÜEÜÜEE (0335935195666)‘(VCIDäBi ‘äEVCD * BXMIVCDEIiE’!‘Tfii‘5&2?! *man: *älffifi.*filfiizs-26. .(fiäfii!)(GAME) —
jß. ‘XRAS‘i?‘ifil?* 51.935 * 55H!‘H?*QIGHI‘fiflflf‘KIR4:52‘NHL97*BnskdbaJl97=RedAhhDiabIo‘ü?*aamxatism s fiflsmoo
—b|a'yer.com/"4 MAY’ 1 9 9 7 4 COMPUTER PLAYER! ä
ComPro InformationInc.ä ü i ä fl fl ä k fl fi i ä
‚l „q, ü g Tel: (6040263-07303506West 4lst Ave.,Vaneouver, B.C., CANADA V6N 3E6
Fax: (6040263-0750
ComesWith New FeaturesSfiifiäfläfifififiäifiäfiifififlfifäääfläüäüfitfixfäiääfiväflä
GoGoPen enhances your Computer performanceand solves your Chinese input problems
Ifäfifiiiffiläkfl! 'ifiääfiä‘äI ä ä ä fiIäfiifläIJEHEHl#fläääfifit ( fi fi i E ä-ä ä ä fi ä fi fi )läääfiälfiifi ( ü ä ä fi ü )Ifikflifiifii? * E E Ä E F E ( fi ä ä fi ü )
r
IifitlflfiflfjäfieälflfiäfiäflIlfifiißflämfiä ( E ä ä fl ü )I i m ä ßnxmszI g fl ü m fi ä ä fi fi
l ä fi ä ä ä filäääfiääiflfi ( fi ä ä ä fl )Iääfffläfiififämfiä
Mäv ‚e gsäeisfsz{im {ifiäfire-‘afs22%was’:amabzsg-23mm2:55:26.
1E' Ffiäbflfifflfiääflätbfiääfi »
äfläätfiäflfiäcpua äflsäfiä
«,äfiäAflDflüfläCPUfiüäLiK-‘ifläfim ° i
fififääaätflä ’ äfiääfiiflzfiÄ-—& väfiüääöfiilntelätäfififi ’ Eääääiäfi? o FELJ ’ flifiääwäääfiäiäficPlHäämTäääfiCPU) i!äfiüääflzfääflä > FffiäääßäficläflääTäääßäü!
iäääüüifivwäfiäfiääüäjzfifläääifififlfiä ’ fäüfüxtiääßfüwn?
1&9? ’ ääfimiäilfifiääääFIashßOPMBIOS) : fiflifilßüfiääää%I&&LüM%fifi°ßfflllglmfläaätägiüfifllfiäfififljfltbsite(lnternmtfiTäfim 3%Roucddea wie ä Fräififitmiäfitäfißlos’ äfiwifififififimüfi *o ‘ 5L
1@%’Eääfi% gM%äH%»m%fi—% „m%ä»@m:&mw% Qüüäää? w
rmm»E:&&m ääflfii » äßäääiäfiääfisposg ‚ gamma:CPU’ EHU€TITEEEE% k
x\xio
Q COMPUTER PLAYERI p MAY 1997 > httpzl/wwwmomputer-playeLcom/
- E äI%?fiiä‘ä'äEHEEZEDHEK ' Efiämfltä * 3E (äääfiäfiää)1.Windows95fäiäkFfifiülääalöfiflflää)2. Internetfiäiffifiifilntemetflxfififlä)3.äiläflizfiüäflfiäääßfifieooxmgäääfi)4.äflfifiäPowerPoint(PowerPointFflFdöfi)5.#ä5äWindowsN'T(NTHäF-'fi*fiIE-ä)‘ffif-‘fiil‘ Ü H C I K I H I Ä| 3 : : (604)657-4919 (Ion-Sat‚l0:30-l8:30)
Mail Z jin]inQinIeIgateJnLcaORhttpzl/cadxcontw
31035:; ‚ äg-fmos?„ ä ü ä ä fi ä ä ä ä ä fi m
ImwWmEmTmfifiEN@\%%%
m%@a&mu%%ä»m@äää‘fifiä (j im] in@iute rgate. bc. ca) 2
u T% äW fi% fi fl Ik ä fi ä c j m iCADS BBS 1-604-821-1046 ZSSOÖBPS /V. 34/V.FC/V.42b 24/j\ Hä}Efl{üCADSBBS 1-604-821-1047 ZSSOOBPS / V.34/
e v.FC/V.42b ZwjxfiäßflmWebSiteI httpM/www. cads. com. tw
ä ö ä ü ä ö ß fi f
Chinese GatewayUnionway’s Chinese Gateway is
the first true 32-bit Chinese system forWindows NT and 95 to hit themarket.There are other similar Systems in themarket but they are for the 16-bitWin-dows environment.
There are three bundle packsavailable - Standard, Gold and thePlatinum. Bach bundle pack includesthe Chinese interface that works withtoday's newest versions of Windowsapplications includingOffice 97. Alsoincluded are at least 8 Chinese TrueType fonts to enhance your Chinesedocuments. Chinese handwriting re-cognition input software is also in-cluded in each pack.
In the Standard Pack, the Super-Pen mouse Version, allows the user toinput Chinese characters by writingwith the mouse. The nine keyboardinput methods are also available if youcan not get use to writing with amouse.
In the Gold Pack, along with theSuperPen Software; a 3” x 3” pentablet isincluded. The pen tablet isvery good for fast Chinese characterentry if you do not know any keyboardinputmethods.
In the Platinum Pack, eight addi-tional Chinese True Type fonts areincluded for a total of 16fonts. A 4” x6” pen tablet alongwith the SuperPenSoftware is bundled in this pack.
ä im. nlfmx u. 1 Jlaz-‘Lcrm;
3:522—n i:
=.."-—-PRESIDENTPLAZA
LOGIN: äfiäaää
wmmmmmnzfiätjlfiiär-E]
In addition, an Asian InternetViewer is included for easy AsianWeb page browsing using yourfavourite web browser. As an addedbonus in the PlatinumPack, aChineseText-toSpeech Software is included.After entering a Chinese character, theSoftware will pronounce the charaoterin Mandarin, a great learning tool forMandarin speaking.
Although the system requirementsis for a fast 486 CPU and 8MB ofRAM, I recommend at least a PentiumCPU and minimum 16MB of RAM.And as with most new Software thesedays, a CD-ROM is required for in-stallation. -
-Hi
Es:
.‚‘iliil
WeämäaämEäiHg-m-gnprfi
aeW%enawafiwas;
«mewmiä
ä
.mHaägW
mmämm
«sähe-um?aßen"?
gW"Elätfifiiiäim
man
w#o»a%
M
E-wenn
läma-ms
emmäea
v
Ul-n
määamqäfiäm-°>11}
äiimm
°m+4}?
äma
am%%a
man
new
määx
man
mää
aeaa-«M
Mafia
waaaean
ana
ifiäämflifliflttfli}
nmsaams
ammsman
man-an
u
iiiiigiggfili
m n a a m a a m m s äeaamammämäflw a a m n a a m
afi
wanamneg
mm
m m m a m m a
es
Nen—»mn3
am
on-ewneü
m
>maem®>
a na°e
2E ä ä Suggested RetailPrice:E iäHEStandard Pack S299äfifiäGoldPack 5349EgfiPlatinumPack S399‘äßflääfiäfififläfiääflä
(Instant Solutions)gamma;o äiSHiEfiEUEHäleiflälüfiifläfiä ° ä235155325]fiäfiäfi i 273-0383.
:il ‚l
i
MOTOROLA 's WisdomPenFripm the cellular phone makers‚ Mo-to" la now introduces a handwritingreIognitionpen and tablet system.TheWisdomPen has a very high recogni-ti i; rate of Chinese writing for bothTraditional and Simplified characters.
the tablet, the user writes the Chi-neige character with the attachedmetal-tip pen. The Software then rec-ogiiizes the writing and adapts to each
users writing style. The WisdomPenrecognition software is fuil 32-bit forWindows 95. It alsoincludes a signature _writing applet forsigning your docu-
domPen."Fü ä E
InstantSolutions
(504) 273-0383Unit 1205 B/C,
4'871 Shell Road,
May Demo Schedule:aaeaaaeaaaeaDate: May 10 -11 President Plaza, Main flräfitfiitßfiä v üfazifaikääßixfii
Ma 17-zisastxiäfiii+üää ( e i n i g - F )May 24 -25 Chapters, MetroTown
11%bis fiäfl,Eaton Centre,Chaptersi; #9
18 Yaohan Centre, 2“"flr
Richmond, B.C.
fltfifivfi. flflzliäfä-J-üfltfiäflfiflDemo DaySpecials... Free One Hour Tutorial!
M i i fi i i z ä w n a e e s m m
gwaaaasenraäaaa
ä {ü ‘i’ ‘i’s‘: ‚f.9E32-bit ChineseInterface forWindows NT, 95 &3.1 Nine Chinese inputmethods included. -:E.i+:;{ii;fil;v?xaifl-ü a i n ;ü f N T v 9 53.3. iixarseesta awas-u-Three choices 9-E. ä: : Standard Pack,Gold PackPlatinum Pack eemneanühxä v i e 8 ’ i1‘?114-3? ’ Ifäiflßääfli ' ‘Prtfä-fikfi?) °
HifiäfißLanguages in 1 CD, 16 Fonts!fifi?‘a‘#i’+%ü#fi’ä#8&#??Ü*TwinBfidge Chinese PartnerCD-ROM V4.1Q ä i}:44’-i ä ä ä ä e m fl ä ü - fi # 8 & fl * # ä ä % % ü %mmmmum ummQmu ; ä e a # + x a eNoChinese Background Required! lncorporates two yearsof Mandarin training taking you to the intermediate skiil level.
MoTonoLAaL d:w a r m ä.ä <3” x4.5”)i2==5 genau: y 5.-:aaxwvna‚e:;aa:z
WbhnmoaämaaaaäaaaaasaaxnrnaNewTabIet-Size &Many More Free Features. The BestHandwriting InputPen!Besides DragonWriter, TwinBridge andÖhinese Gateway,wealso bring inrriany new Asian Ianguage Software programs &Chinese computer books eachsmionth. Check us outfirst! fi-B#1ä ß 1E‘i’ immer.üfitnfitfiaz
1;;Oursoflwareprograms arealsoavailable a! allChaptersBookstomsacross canada.
1997May 10-11 (fit-Eiä)
' % ü E H E°fiiääfläfifiä-fiäjfiskyinternetfiä*M fi fi ü(ää)May 10-11& 17-18 (flgflßfl)
skyintemeznm
‘fifiäfiäfiürFfiflflififi-fill! J
President’s Plaza -8181Cambie Road, Richmond, B.C.
http:llwww.computer-pilayencoim/ d M A Y 1 9 9 7i
4 COMPUTER PLAYER! Q
Building your office--ByALAN THVVAITS-oicrosoffs Ofifce is arguably themost-used application suite onthe markct today. I ts comprehen-siveness and shcer size prescnt
‘their own problcms, though. Ofiice 97,the latest Version, offers more featurcsthan anyone can bc cxpected to use in asinglc lifctime. And, bccause Oflice con-sists of unrelatedprograms that have,overthc ycars, been torturcd into workingtogcthcr, its complexjtics arcn’t alwayscasüy resolved.A good way to use Ofice 97 well is t0
have an “Ofice 97 Libraryg” so {hathelp is. ajways where you nccd iLWhich is cxact-ly whatwe've donc-thc three books COV-crcd in this revicw arc, rcspcctjvely,an in-depth refercncc work, a quick-and-casyrcfcrcnce work„ and a detailed guide toOutlook, one of the ncw clcments inOjfice 97 that some argue is thc bcst partof this suite deal.721e Ofiice 97 Bible, likc its namesake,
covcrs all the baseaWcighing in at 1,159pagcs, a little lcss than 2 kg, 3nd 854.99,it’s hard to ignomThc book takes a mod-ular approach, und is divided into six’parts: onc giving an overview of Ofiice,
Ä comrursn p u v s n ! > M A Y 1 9 9 7 p http:llwww.compi
In.
938 HOWE STREET, VANCOUVER , V 6 Z 1 N 9 TEL: (604)33]
?7 Iibraryone cach for Word,Excel,PozuerPbint,andAccess, and one that describcs Outlookand various tools you can use to makcOfifce applications work togcther.Each scction covers thc ground well-
from basics likc "Crcating a Documcnt”(Word)and“WorkingwithTables" (Access)to using Word t0 dcvclopWeb pagcs 2ndapplying Visual Basic for Applications t0automatcd macros within Access. Lots ofgraphics, screenshots, 1nd Q&A’s through-out thc text make the going morc thanpalatable.Eachapplication scction ends with a list
of “TopTen”commonly cncountercd ques-tions. Users who havc upgraded from pre-vious vcrsions of Ofiice wil l find thc sec-tion on using Outlookjrhe Binder (whjchallows you t0 combinc documcnts thathavc bcen creatcd with Office applica-tions), and Sharing Data BctwccnApplications with OLE cxtremely helpful.For thosc new to Oflice, a sct of “Basics”Appendiccs help get the provcrbial showon the road.
Playlng it stupid?Ofiice 97 for Dummies takcs a similar
approach, a! least in thc way it presentsits information. An ovcrview’ of Ojfice is
f Allowcd by chaptcrs on Word, Excel,i erPoint, Outlook, and Access. Thcnc:mcs. a short, but comprehensivc scctiono‘ shafing data among Ofice 97 applica-t" ns.For users comfortablc with the indi-v‘ ual programs in Oflite, but have littlcorno cxperiencc linking thcm, this sec-ti n should be a real cyc-opener.
„ he book cnds with a chapter ona jccssing thcWorldWidcWcb from Ofiice9‘ applications, linking documcnts t0 theWeb, and turning Excel, Powerlbint, andAccess documents intoWcb.pages.The book is writtcn in the familiar
Diunmics fashion-lots of lists, Screen-‘ots, and off-the-cuff humour-and it's
I formatlon gatheringutlookforDummies prcsents a closc-
ul
vicw of thc information managcr thätb dles with Oflice 97 (Microsoftcalls ita
'
esktop Information Manager). Givent ' hectic schcdule most of us live with,it jmay just bc a minor "killer app’? in themglking.iluthor Bill Dyszel says hc has Outloakning on his Computer all the timc,
bTauschc uses it as an assistant in “deal-
ing with the flurry of 5mal] but impor-tant dctails that stand between you 2nd
"
thc work you d0.”Thc book is divided into four parts.
Part One covcrs using Outlook for rou-tine tasks likc keeping track of mes-sages, phonc calls, and appointments’, asweil as tips on various vicwing and filcorganizational options. Part Two dealswith how Outlook handles e-mail-com-position, flagging, sorting, and buildingcontact lists.Part Thrcc is about rnanaging thc Datc
Navigator, Notcs, and Journal utilities tot ie officc tasks togethcr in an efficientWay. Part Four (thc familiar Dummies“Part of Tcns”) refreshingly offcrs a [istof “Ten Things You Can't D0 withOutloole,” as well as hclpful shortcutsand ways of using Outlook with Internettoolsfrhe book is an appcaling 1nd infor-mative introduction to a ncw and excit-ing product.
Office 97Bible, byEdward Jones and Derek Sutton, fromIDG Books. 554.99. Microsoft Office 97 for Mndows for‘Dummies, byWallace Wang, from IDG Books, 326.99.Microsoft Outlook for Dummies, byBill Dyszel, from IDGBooks. 526.99. 6
ter-playencom/
szoforu
Training
-2511 FAX: (604) 331-2522 E-mail: [email protected]
‘W625i
Gimme that giant robot!41xi15J
o o ByWILLIAM A.wooD o-So, you're piloting your giant robot/HAWC(Hcavy ArmerWeapons Chassis-a Mcch byany other name...) across the beautiful,unspoiled landscape, whcn suddenly you'reambushcd.Dcspitc your valiant dcfense, theenemy’s beam wcapons takc down yourshiclds and thcir cannons and missiles pierceyour armor. In no time at all,your mightywarmachine is a flamingWTECK.Game ovcr, right?wronglYouTc just gctting startcd in G-Nome.As a giant-robot combat Simulation, G‘-
Nome is quite good. lt looks finc 2nd soundsgreat (and it uses the newMMX technology,if you have it). What sets lt apart from itsheavymetal brethren, howevcr, is a littlcsomething called“botjacking.”Basicallyr,your chzuacter will ejcct from a ter-
minalHAVC/Cwoucanalsododxatvoluntatily)and bc plunkcd unccrcmoniously onto the bat-dcficldA dcfcnscless soldier is liable to get toast-od (orsquished) in short ordet-‚butyou lnve anaceup yourdeevetthcGASHR(95assault shocktifle),Which evicts an cncmy fmm a HAWCYouan thcn stcal thc nowcmpty HAWC for your-
(and, as thc ‚ganzes box pmmises. “crushyour cncmywith bisownvehide”).
l
ifiYoumay wcll go through several differentWCs (or guard towers, tanks, hovercraft,buildmgs) in ordcr to complete each of
qinc gamds 20—plus missions.Of coursc, you,too, can be forcibly ejccted‘ by enemy sol-dlers, so watch your back!ggThe single-playcr game pits you, as Joshuaqant, HAWC pilot cxtraotdinairc. against avghriety of opponents (as well as grantixtg youajgfew allies to look after). Most of thc mis-
sipnsan;quite challengixtg and niccly varicd:114
sometimes you’ll havc to fight, and sonne-times you'll have to bc sneaky.The assort-ment of HAWCS, vchiclcs, and buildings(spread out across four diffcrcnt mccs) is a
’
good mix.There are threc difficulty levcls tochoose from.What does this d0? Oops!Onc odd touch in G-Nome is that thc
wcapons in each HAWC are mostly unique,with singularly uninfonnafive names such asPZMEC andTARl2 (that's Pulsc PlasmaMcson
fomenonThe addwniphen0 0 ByMARC SALZMAN 0 0
henever l argue why PCW gaming 4 is far better thanconsole gaming, there isalways a hush from myopponents when I intro-
ducc how much life, and thus value, youcan get out of one solitaty PC gamc. Sinccthc pricc of a CD-ROM is about that of a_console cartridge or CD, is it just that thePC games are designed to be longcr t0 fin-ish?Weil, yes, this is t rue on avemgc, butthat's not the answer. .‚and length doesn'tnecessarily make for a bettcrgamc,either.There arc two main rcasons why you
get more bang for your buck in ComputergamingIhc first is that most games thcsedays arc packagcd with somc form ofmultiplayer componcnt, whcthcr it'sthrough dircct modem-to-modcm play,serial-link hookup‚ network (LAN) com-pliant, or lnternet-readyAnd if anyonc ofyou PC gaming enthusiasts are reading
this, you know that head-to-hcad combator group play is a totally diffcrent gaming
i
tljtcn thcrc’s an casier solution for you-siinply pick up a CD-ROM collection of
experience tofficial or unoffi-
alwsether n cialaddvnsood-( Q u a k e ‚ ‘» ics, whcrc somc-Diablo, Air one else hasWarrior II,and so on).Aska console fanwhen thisScga NetLinkthing willcatch onandlgu a r a n t e e
alrgady done allthe work for you.These cheapdisks arc chock-full of thousandsof bonus lcvelsand other toolsthat breathe ncwlife into your
I?{11lthey'll just
stare at their 1-shoes. ..
Please, sir,I want some moreIf you don't have the desire or savoir-
faire t0 personalize your existing game,and you also can't find the tiine to surfthe Weh t_o download these bonus levels,
E games, and it
h: lights much of thc hard work andcffort by level designers worldwide.
the eighth day,lud crepted Doom{Such add-ons rcally took off with thehit gamc Doom in 1993, and 1'wouldnjced thrcc hands to count how manyCD-ROM collections of Doom WADs
have passcd ovcr my dcsk ovcr thc ycats
(the most notablc bcing MicroforurlfsDeatbDay‚ Modern Microwards TbeComplete DoorrgwizardWorlrs D! ZoneI and 2, and Muravall Systems’ DoomOuerload L111).We now see a huge markct for thcsc
supplemcntalproducts‚Supporting amul-titude of games in man}!genresAlthoughthere are many addon packs availablc for_hits likeWarcrafl l1,MS FligbtSimulator;Civtlization I1, Heroes of Migbt undMagie II, SteelPanthers,Descent l and II,Command und Conquer,and CommandandConquet-RedAlert, let’s just look attoday's best selling packagcs, namclythosc for the first-pcrson pcrspcctivcshootJcm-up phcnomcnon that is Quake.Quake ‘n’ halteBonus Quake add-ons am sclling likc
hot cakcs off of Canadian rctail shclvcs,especially with the release of thc two firstofficial mission packs, Scourge of
continued on paae 74
VYVVVYVVVVVVVVVVVVVVVYVYVYVYVVVVVVYVVVVVVVV7777VVVVVV7V77"‘VVYVVVVVÜVVVVVVVVVVVVVVVVVVVVVVa> ‘ i
4‚ N ThinkPad sssxo 430 cm 4P Un Intel P120 Intel P120 4
I - —_.. ._ .-: . 8MB RAM,1.08 Hdd 16:3SQM. 1.3 Hdd j>
'i
‘
6XCDRom 10 _°m 4: 11.3"Active 11-3'ACWS 4
‚2 _ 3 yr,Warranty |3M 3 Y“wammYTosmaA 1t ‘ . |E3SE 108/MO. [ease 1
I SpeCIGhSf Inc. Lite 373 Plus E133T 1b P133 P133 4: ”Providing Portable Systems t0 Meet Your Specific Needs" 16MB RAM. 1.3 Hdd 16MB RAM, 1.08Hdd jSALES-TRAINING-SUPPORT-SERVICE-UPGRADES-FINANCING 1OX CDRom 8X CDRomb 4: WeSellAllMakes 8:Models 11-3" DSTN 11-3"DSTN :> FREE1110m}!OfAXiOH Internet! Call for the Best Prices in Town! Acen (Ö - E133.‘w“ Ami” 32'997 4: FREEdelivery anywheremB.c.: m: ( m )„ u m 53,097 . 5 2 , 4 9 7 1: FREEset-up 8:SoftwareConfiguration! Email: [email protected] 473-7765 ‘e359 ‘"’M°' Iease 90/Mo. jp LAAAAAAALAALAAAALALAAAAAAAAAAALAAALAALLLLLAAAALT L A A A A Ä A A A L L A A A A A A L A A A A A A A A A A A A L L A A L A A A L Ä A J A A
http:/lwww.computer- gplayencom/I
MAY 1 9 9 7 COMPUTER PLAYER! T
SYSTEM -PRO COMPUTERS „a.TEL : 583-9977 FAX : 583-9979
SUBSCRIBE | CCOMPUTER innzvevsarg/ I um;A N D ‘rau cougMultimedia Email a“a"*äü‘nß» 2
i
' -. . . . Btcsrrd mm‘ 911-5: 2mm HÜPk tLQUF u!‘ Ä l 1150/16612 Pentiu gßrgErävfä S285 Motherboard W/CPU & Fa“[t5 Email with amtude. .
'
9
. _ i; „ u m . 2„D;‚DE „G m5120MHzPentium chivbasedw S395
' H 9}= «f;F S; F _f _9
.9 GlGN-BYTEPCI-ISA Board WD IDE2'“; m m ’P'"".“‘“°"?""’”°""‘B 5438_. ummu ‚man amze» im __ ..
g 256KifiwuneßmflCache . . . S320 150MHz Pentium chIp-bascdMB S476‘ffi53g . _Rßrnr!
W.D. IDE2.56 S360 166MHzPentium chip-bascdMB S60i0716533366
'9
_ E
v
M3%\% (‘Jfrd IIMR WDIDE “G S399 zwwtpmmchipbafim S950r
" ’ ' V ”‚ "9"". llrugVGAvlzdonitoram w'D- IDE 4-06 S510 Tzflmfifänfiifufiwgwmmm 5317g
9 9 V l
99mg:3mCäeos EIDE HardDrive Flinte“ mm m a n Mm ü b h wm s "mi E‚ Aoerl “anasonic s;CD-Rom Drive . Canon BJC-240 lnkjet 3250 TapeBackup:‚ {äfighficfig596W Canon 13104100 lnkjet 3329 [omega 800MB „ u m 5178/193gi Mm wdfilywgpad Epson 51,135 ‘zoolnkjet 3356 [omega 203/3255 Im. 5250/330
i Epson style‘ 600 Inkl“ S448 Colomdo 8_00M lnL/Exl. 3215/2759 31629/1677/1719/1893/2205 EM"5M“800 lnkjet S653 Colomdo Jlmbo 1400 Im. 1.30 32x5i SymüUpgradeOption: : HP692C lnkjet 5413 “ w ”T""°""°‘ ’°°‘m’ ‘"5‘
‚
‘Cfl HP5L Lager Print" S580 v
Seagaze tapestor Traven 3.2G S315I I 13411330 . o_ . . [j|‚‘‚;.’|‚5c[g_|c/J_|(; ||_|)_ s a n n “ HP5P LBSCI’ Prmter DnvePlease send me c subscnption io Computer er!Canoda Compufes! - ”PP".5""5"""‚31’“"’9”‘ 5751165 HP6P LaseT Printer S1030 zxpDrive l00M Fax/SCSI S285-- . . . . . Uru-Matr-xMmqwmne-nn- swsms .B.C. Edlhon und enier me In fhe June isi/97 row for Mu|hmed|a Emod.
b Mumm-Ins"Mqm nsmoA5 .
“ Z 29 " "'095551 1'“- 554°A one-yeor subscripiion cosis 529.95 (12 Issues) or 549.90 for iwo-years 1 v fiß°'f“'„äflx"ä‚1“iä.a. “Z3?” ' AWT. 4 1 g m fl n ”
(24 Issues) incl. GST io cover posioge und handling. : 3:: zxäfflm“ ‘a: ."„’‚‘—,‘„ä‘;‚'..i‚°°„?f”“" w‘ v“I am paying ihe F11" amounf, Poycb|e io Canado Computesl, Unn- GXCD-Ro- sos
filinieämmxzqob Ü Ch ue ormorä?!
order or, C"!05-97 f » f: 9 - - >
i Igmfipfi S2,650 Computer-' VISA Ü asier Cor j „
(h J „ m m amPClVndeoCard ‘"'-="'fi"-> Service CeggerName: ä A0970 „„,„f„m”t‚°„”‚‚f igsTxlfnffi/mmm System Diagnostic _._ '. 16m:Sound Card w/3D speaker
‘SystemUpgrade 4%‘i v
Company (if opphcabie) Ag- B_ale_n _ „1-Adel E’ " d e m " ! SystemRevav " 3(€551 ’
‘i’City: Pro“ Code: Sand“): lteEmailAdess:[email protected] Eusinfess Hpurs: .phone Nmba: suBscRiPnoNs ( ( m m TER BOOKS: l I‘T0 40% DISCOLINT °"' " 9 3 “ ”-B-OOPM
. w‘ mm b" _fimdable da2 Saturday 11:ODAM-5:DOPMwen» m “erde w- re - . » SALESMPGRADENETWORKING.TRAINING.LEASING Sunday „es“,'
. ya„„„.‚e5°3‘zfgcafiäifig Address 1um: #1, 10330, 152nd Street, Surrey, ac. V3R 4GB '-°"9 Cmsed(Across from GUILDFORD IViALL. right behind R0 er Video) weekfm’97BISCOMPUTERSERVICE
#121-4940, N0. 3 Road, Richmond,BC,V6X 3A5E (604)214—8020, Fax (604) 214-8021iVfliue SStem Wc SPCCiHIiZß in:CPU w/tooling fan
RFCppgfadefilanfi; Triion IIChipsetMBw/SIZK Pipeline Cache 993m’ “S” 39 °"
OnBoard 2xEIDE, 2xFast Com Port . MP5‘; Rgggfgggdggs‘i Enhunced Prinier Port&Floppy Controller "Pqdyä16MB EDO Memory:2.16 Hard Drive (Mode 4)i 1.44 Floppy Drive EIFIB‘i i4’ SVGA Ni.28dpi moniior PLEASE CALL!PCI Video Curd w/IMB Memory (exp. in 2M)9I5"Tower Case, I04 key Win95 keyhoord, mouse 8.pud M205 S1088m35.]g/mnmg äg _ P4335 Sii38or3675/mnih= ' M505 Sii68or37.70/mnIhE ä fl fl ' #5 ' ‘ääfiääüv P4665 Sii88or38.36/mnihi c p ä ä fi I 1g ‚ cpjcfiÄ ‚ P-ZOOMMX Si588orSi28/mnih
cD-RomflModemggmgg oall Ieasingfor36 monlhs
GIVESOMEONEASECOND CHANCE.
Discuss Organ donation with your family.THEKIDNEYFOUNDATIONOFCANADA
i
CIJISSIFIEDS
ß c o w u r n PLAYER! > MAY 1997 p http:llwww.complter-playencom/
N0 ORDINARY
. ‘ ’. . y. me Drecror lets 310L: { u m Iights and appiiarwces on and cf?
a ‚j ACtIVIty Center . .5 ;._:— E»? you :an SEI up reutinesm: gsve vom‘ house that Iex/ed-irv.A w Franklin's room Ispacked wlth 11 e ‚/
fun thlngs t0 d0. There are' Jigsaws t0 unpuzzIe‚matchestorgaltce. pictgreslto
colourand ätartee’ Kit avazlable on the mtwa CSX. T}car s ocrea eusng 3 : , T, „ 33- „ fi „ a ‚„„ „ J ; ‚a: p O.
.thousandsofplecesofart 2.4? !L„«.c.|>«\_\1J-: ‘x1!„K“ JI !
. a n sang 1Sx:;‘::*€-: av a: 5
Frank||nV‘ LearnsMathwnen klds joln Franklin, thev enteramaglcalworld where turtlestalk and flsh flv. where gumballmachlnes are packed wlth prlzesand the forest Isfllled wlthfrlends. And thev dlscover 10essentlalmath concepts.
' Have youmet Franklln? He's theIttle turtle who can tie his shoes "I -_tand count by 2's. what's 2 „ ‚ . z? imore, he C311 captureYOUI’ childs Imagination _ \ 1 ‚r l _ ‘ _ ‚ _emaway tnat makes ‚ . _ Dumm. ux/Im the natest technomgv anc. emeu taanmert featua esf learrflng t0 read fun. mm
' '
. perfect P: Fo1’ work er okay
sI>0I2IsIsI2® 56k FAxMAoos n»s; Now «um56|6|35 ‘X'2“"*TEC||HÖI_.0GY!Now download emall, graphlcs, sound, Videostreams from the Internet nearty twice as fast a5 28.8modems—even faster wlth compresslon! Uses the
» üufimiiss
_ordlnaw analog phone Ilnes you have“ H 1 ” now. supported bvmore than 100A .55
Internetservice providers wlth over16 ‚5
E -. seflingmodem A, ’ .4
Ä m||||on älseiiingmtxdem _
nmunnucuua-rcamnme ’
DISTRIBUTED IN CANADA BY B E AM S C O P E CANADA INC.DEALER ENOUIRIES 1 800 268-5535
c v \\0“- G\5\\9°' 5\99“ wie o“
i; äfmoaReseorenanoDevelopnmreosury Boord‘ VietemnsMausweslem EconomrcDrverszficmro-r
29OrherDencmenr (pleose soecrfy)DUDDDDDDD
88882883
rnvrncralGovarnment3o Animation Resecrch Foundalion3| rrculture und Fooa32A General
ä; äää5c _ anoTrooe:dr.:g:atron and TrnrnmgEnvrrorvnen:und EnergyJDOÜCE M 4
«anooptxorxe onrs4mm4msHumcrr rghts CommtsssonI’! B5Ingmohon ondmlirxggwgc-vemmm
wämriwmmfommmiD D C I D Ü D D D D D D D L I D E I C I C I D D D D D D D D D D E I D D E J D D D D
1:
naaeswaagaaasaseezsa2.25235258::
g
.
‚POSTALCOOE
Tobeqln your suhscrlptlon just eomplale, slgn und remm this fax.Please answer the tollowrng queshons 0 Publisher reserves the nghl Iodelermine quulifrcution.
(stimmte)COMPANY MANAGEMENT Dm sroo nur _D o5 um4 9ummD O? SOMGDQQBM! ÜCG lWb?9HrI
ägz girrsssar" gewissen”DAdminrsfiofrve/Ptxrchasmg HP}:which
0171170110!Irasednisubrrsm71
E!Momenng ‚wbemmd? check „wir;COMPUTER SYSTEMS/OPERATIONS Es;{yggwggmmrDManagement D03 orte oomputers
gwm äälänflifnflrwys83? parpneruls
ENGlNEERlNG/MÄNUFACTURING E331NgMVk "flwg/‘WUVBDManager-Her" o roopemr syslemsW aumfimfleIool
"ä°m"siäß"“ EIERSXZL m;D Educcnor
V
Ü 0"’- 5°°°"V Fedora!Govemmenl3 8% ° i135
(Stimmt) ää Immigr ron
COMPANY MANAGEMENT B23 m“DGoiemmenr Do7
g(immer8:DonServices ääC]Cotnp/Cornn-nrnrelrude, WhoIesoIe/Rslurl g MausD Olher, preose specny Ü ,3
D l4U15E}?DIEDISYes D NoD D20 Savrces= FAMILYNAME..‚ ‚ ‚ ‚ ‚ ‚ ‚ . _. . . . ‚ ‚= DEPARTMENT/DOMPANY ‚ . . . . . . ‚ . . _. . . . . . . . . . ; . . . . .
O j Aoongss ‚ ‚ ‚ ‚ _‚ ___‚ __‚ __‚ _‚ „ _______‚ ___‚ ‚ _. __‚ ‚ . ‚ . . . . ‚ ‚ . . . ‚ . . . . . . . ‚ .
{ v o m . . . . . . . . . . _. . . . . . _. .. .....PROV'INCE‚ ‚a INTERNALMAILAwrzess (rr ANY) . . . . . . . . . . . . . . . ‚ . . . ‚ . . . . , . . _. . . . . ‚ . . ‚ .
01 ‚ . . . . . .. . ._ ‚ ‚ ‚ . ‚ ‚ . ‚ . . _. . . . . . . . . . . . . . .
ELECTRONICMNLADORESSGFANY) . . . . . . . . . . . . . ‚ . . ‚ . ‚ . . . . . . ‚ . . ‚ . . .. .. . . . . . .‚ „.
. . . . . . . . . . . . . . . . . . . . . . . . . . . . „EXTENSION . . . . . . ‚ ‚ . . .. „w...Pleosa anieryourlulhers hrslnama have ‚ ‚ . ‚ . . . . . . . . . . . . . . ‚ . . _. ‚ . . I ‚ .
Iwish Iorecerve u oomphmenlury subscnption roGonrmnniconvutuMogczrne D YES! D No
Signomre . . . . . . . . . . . . . . . . . . . . . . . . . . . . ‚ _ . ‚Data . . _. . . . . . . __. __. . . . . . _. . .
Orrwlofion ouoflorsreqarire avertraue pnecao?personal rfiormmion
0 0 0 1 0 0 0 0 0 00
PEUPLEwe'd likeall you gaming fanatics to get involvedand share your favourite fixx. lt can be the Iatestgame onthe market, great classics that you stilllove to play‚ or an obscure title you want toshare with other readers.Gqt any hot gaming tips? Let us know. Needpointers? Maybe our readers can help you out.Try to be brief (under I00 words), and we'llpublish your ponderings in our gaming forum.Send feedback toGames People Play via e-mailto ,[email protected], by fax (416) 588-4110 orby;snail mail to 99 Atlantic Ave.‚ Suite 408,Torionto, Ontario, M6K 31s.
Lookln’ fo r Duke and Quake onlineWlrere do I find multiplayer Internet sites forgames like Quake and DukeNukem 3D?
Rodney Young
Thäre are thousands of real/y good Quake andDuke Nukem 3D pages on the Web. DukeNukem 3Di5only Web playable, however, at TheTotal Entertainment Network (http://wrvvwten/).ForiQuake, check out:Blues NewshttpJ/wwwbluesnewrcom/Redwood’: QuakehttpM/redwood.gatsbyhouse.com/Quake Stomping Groundshttp://wwwstomped.com/Quake SpyhttpJ/wwwquakespycom/Ifynu’re into thesekindofgames‚ oranyPCand/orInternetgames, youmaywant topick upmybook,The Internet Games Directory, available at your
OOÖOOCOOOOCC0 0 0OOOOOOOOOOOOOOOOOOOOOO0 0 0 0 0 0 0 0 !
continued from page71Armagon and Dissolution of Eternity.Dcveloped by Hipnotic Interactive, pub-Iished by id Software, and distributed byActivision, each contains over 15 new lev-els (single player and Deathmatch),never-before-seen weapons (including Thofswar hammcr Mjolnir), demons (howabout a dragon?!)‚ new CD-quality heart-pumping music‚ and unique environmen-tal dangers (Spike mines and Iightningtraps. ..ouch!).‘Ihe Ievcls are so beautifully arrangcd
that I would go so far as to say that theserival the Original game in design and chal-lenging gamcplay, and most ccrtairlly incnemy artificial intelligence. For morcinformation and screenshots, visithttpJ/wwwactivision.com/quake/indeJLhtmlLotal antl-heroes?Others have collected and/or designed
bonus levels for Quake themselves andarclworthy if you're a fan thirsty for morefun. Toronto's own Microforum hasreleascd Dark Hour,which contains newlevels, new textures (designed byMieroforumb award-winning tcam ofgraphic dcsigners), and other extra fea-tures, such as a directory of Quake-relat-° COMPUTER P_LAYHERI b MAY i 9 9 7 b httpz/lwwuucomputer-playencom/
P L A vfavourite book store. Sure this is a shamelessplug,but it real/y isa cool book and CD-ROM!
Marc Saltzman
Darklands fanI am a huge fantasy fan, but I have found veryIittle that is at all interesting. lt is somewhatparadoxical, but I like fantasy that i5laced withenough satisfying realism to allow me to sus-pend mydisbelief. l like the fantasy elements tobe intelligent and imaginative.All this to say that the best computer fantasyrole playing game that I have ever seen isDarklands. Dark/ands was produced byMicroProse and although the technology adecade (I'm guessing) ago placed Iimits on thegame System, and there were some flaws‚ Ihaveyet to see anything that has surpassed it. Thebasic combat System, the obvious research thatwas done, and the story Iine (along with manyinteresting mini adventures) made this gameengrossing and a heck of a Iot of fun.
Owen Lee Stairs
How clvlllzed!I play a fair number of games from time totime. I like fIight/combat simulators and otherstrategy games. These days my hard-drivespace is Iimited (thanks to Vlfin95!) so I keeponly one game on board: Civilization 2.After masterlng Civ 1 and becoming discour-aged at the glitches and cheating opportuni-ties, Civ 2 was a breath of fresh air. Finally, thediety level ensured hours upon hours of chal-Ienging play.
NeilH.Watson
ed Wcb sites, Quake Clan sites, and anassortment of cheat Codes and hints.Thestatt up and interface arc a breeze-andmake sure you check out the single-play-er level“Arena”or take on “Office Hell” viamultiplayer!Instead of distributing unconnected
and unrelated levels, Q/ Zone (WizardWerks) provides three completcly newepisodes (35 new maps) with new ene-mies, a new weapon, and a levelmanage:-that allows the user to take Charge of var-ious aspects of the gameplayThe helpfulfrom-and software enables gamcrs to eas-ily access the Original Quake, Q! Zone’sepisodes,or any other maps you have col-Iected. A good solid supplement to theOriginalQuake.Lastly,by the time you read this, another
active Canadian company, Rocelco Inc.,will be shipping thcir contribution to theQuake craze.As with the rest of their add-on lineup‚ this new relcasc will consist ofmany fresh levels (over 250 Deatlfluatch,and over 200 single and rnultiplayer),FAQS, stats, and other handy Quake utili-ties. book for this value-priccd product inyour Iocal retail hang-out by May, 1997.All of these products range in price
from S20 to S30, but makc sure you havethe full Version of Quake to begin with!Enjoy! Q
continued from page71Cannon and Tactical Airbomc Rcchargc-
Ion Gun,obviouslyywhmyousteal an unfamiliar HAWC, thencfimm, youmay havc some uncotnfonable momenrsfiguring out what exactly is at your disposra1(whilcthe cnemy continucs pound atyou, natutally). _Meabwan-ior veterans may complain
about the lack of customization options foryourvchiclc orHAWC,andthe fzct that111cmam no random, standalonc missions for soloplayers. Some playas may get frustrated atthe Iack of mid-gamc savc capability, whichmmns you may play the bcginning of somclongmisions over and over untilyou get allthe way through.G-Nome can be played against other
humans ovcr a nctwork, through Mplayer,or via modem. l found the hcad-to-hcadmodern scenarios to bc a bit simplistic,though (you and your opponcnt an:tumed loosc amongst a bunch of emptymachincs,basically).StilLI likod G-Nome aIot, andwould recommcnd it favomably if(his is a geme you likc. O
G»Nome,from 7mLevel. lMn9SCD-ROM. 545-550 (smeet).Check out the company's excellent Web site, full ofinformation and mission walkthroughs, athttpzllmvwJthlevelxoml gnome/indexhtm
continued from page51Ieap forwaxd t0 about 91 million of486/W'mdows3.lmcmworldwide(firmver-sioncxpectedttfissunxmerhvtxolnvurtyctupgtadedtoeithcraPenüumorWmdowsß.Aptlynamed Projcct RcschqitisaspedalJavaoskitmatwillmmttncscoldcrmadtinesintoaninstantNcAllmctsertnstodoistypejavaosatttxcmßpmmptandptesto,Wmdowstacmporarilygocstosleepaxxdthenetwoxk featultscomcalivclargecmnpa-nicsinparticularareteportedtohaveexptesscdsflonginterestmsalvagingmciroldinventorythiswayOnthcchip fronnaxialystsagttethatin
about a year, the Pentium Pm 235 MHzmodelwillbcthedominantmictoproccssorfrom the WinTel side, by whidt timc thePowen-Pcwillbenearmgtlncflwllflizmadc.Applcjtxstretmsedacouplcofötmllfl-{zmachincsandbigblucIBMissprmÜdingmerumour that a ncw ThinkPad super-fastmoddintlncirtaptoplincupwillrunonaPoWerPCchipandthcncwMacOSJtappears that the spccd-sprcad ‘s growinginsteadofmrinkixiginfzvourofthePowerPC.Andwchavcrrtcvmcovcrcdflicpotexr-
tiaIIymmü-billion-dollarappficafionbrjavmsmartcaxdamdallmedclicaxetasksassod-atedwithtrxettnsrxchascxeditcardaltms,andsoforth.‘limwillbettiembiectofaxaoflmcratfideb
DoesYourOfficaea RecyclingProgram?Conserve our environmeht andsave 35333 at the Same time
Alouette Laser provides remanufactured and refilledtoner cartridges to Iaserprinter userswith savings up t0 60%
100% Money Back GuaranteevWe also carry other toners, developers &dmm units.
cartridges are tested and completely disassembled when recharged.Wealso recharge cartridges for:
Photocopiers 0 Canon Personal Copier Laser Printers-HPLaserJet I, II, IIP, lll‚v Sharp Z-series Copier-Panasonic FP82O
Laser FaxMachines
IlIP‚ IIID, llIsi‚ lV- Apple-Canon-Brother-IBM-QMS-NEC-and more!Onsite Cleaning Service——Flebuilt Fuser Assemblies
FREE PICK-UPAND DELIVERY INGREATER VANCOUVER
fiouefleLASERPRODIIGTS ING.
Call Today291-8442Fax: 291-8435 '
1 0 0 0 0 0 0 0 0
BY:K.CÜLBGIIRNE
_j THE MINUIIL ASSURED TED THAT HIS COMPUTERi VOULD VOR! VITH VINDDVE.
Thanks to everyone who sent in comics to usfor consideration. We received a lot ofgreat submis-sions-more tfhan expected.The artistwechose, KevinColboume‚ isadigital compositor atNelvanaand a graduate of the animation program at Sheridan College. Wehope you like hiswork asmuchaswedo. Let usknow bye-mailing usat [email protected] O
rMICROSEAlSystem C o r p .ääifiääiäifläfiäifiStandardPentiume Computer System:‘ o Pentium°Intel-Trition chipset MainboardIntel P5 75—200Mhz CPUwith Fan&HeatsinkBuiIt-in PCVIDE&Fast I/0Controller
4 256K Pipeline BurstCache onBoardo 16MEDO RAM i
o Panasonic 1.44M (3.5") Floppy Drive.1.668 EIDE HardDisk.PCIVGA Display w/2M (MPEG)Cardo MidTower case w/CSA Power Supplyio Fujitsu 104Windows 95 Keyboard-0 SerialMousew/Mouse Pado 14" .28mm VGA NlMonitor
‘Stearuboräz-Yearmtslvarrantyof
12X1 l6X CDRomI6 Bits 3D Sound Card PnpCreative SB AWE 64 PNP 5253
ive SB I6 PnP 558
S228 / S248S228 / S248S258 / S328
S458
Trident 9680 PCI IM S48S3 3D Virge 2M / 4M w/MPEG 888 / S128ATI 3D+2M / 4M w/MPEG S108 / S188
110-4940No. 3 RoadAlderbridge Place
Richmond, B.C. VGX 3A5Tel: (604) 273-9233Fax: (604) 273-9203
STOREHOURSMON—FRI:10:OO—6:OOSAT: 12:OO-6:OOSUN: CLOSED
Mary'sSpedal!!!IntelP5-133 31,259IntelP5-150 .........31,369IntelP5-166 51,459
IntelP5-166MMX 51,599IntelP5-200MMX 51,899campumrsysam
POS SystemWinPos-IIOOO Business SolutionMetrologic 97| 125erScannerCompact Cash DrawerEäonPOS Printcr S999
Harlem SywrialSmarklink 33.6Data / Fax IVoice S108USRobotics 33.6 FullDuplex S158Color QuickCam S268
Diamond Ullra SCSI 5123(FirePon 40) PC1140MBpsWebit yourprices, lease ask!" ConrradService:SystemMainfenante, NerworkServite, Programming, S
Alllogosß are ' ohne’: ‚ „ Prieessxbpctwdvangewimocilrmiee.;Sales 0 Service 0 Re airs o U fade 0 Networkin 0 So
114-3070NorlandAve. Burnaby, B.C. WEOFFER YOU TOTAL SÜLCTIONS’ AFTER SALESf SERVICES.’
http:I/www.computer-pllayeucom/ 4 MAY 1 9 9 7 4 COMPUTER n u n ! Ü
INKJETWHOLESALERThe bestwhoIesaIe‚ deß Ierandretailprices for compatibl inkjetcar-
tridges, refillsand ribbons nCanada.
681-710?A!50% -75% Savings.Consignmem orders available for‘dealers.
(; L ‘Yhenäsadeal nearyou...Bumaby, D0 town, RichmondSFU, NorthV ’
uver, UBC,
i‘: SPARKLE 42xm ü’Bilingual System (English/Chinese)
Custom SofiwareDesign / Programming / Supportäkfiflää ä i fi ä x ä ä äSofiwarepackage Support, MissionCritical Statistics,MIS for small business... BilingualDocumentation...Database Design / programming, DOS/Windows/OSZ...
Chinese Systems: Twinßridge,KuoChiao...Free Initial Consultation
DataHecoverylahs
DOS 0 MAC 0 Novell 0 XenixUNIX 0 OSl2 o WIN NT
Hard Drives o Diskettes 0 TapeSyquest 0 Bernoulli 0 Optical
Tel/Fax: (604)4352338 (Mon.-Sat. 7am -Zpm) West End and many more.
'- _—-—-————-—-' ‘
Highest success rate, even with the most difficult| | situations. No recovery, noCharge!We’re your g| Custom ‘DENTIHCATION | __b
Chance of getting your lost daga back.| ‘s O F F " I T "Tals AD I 128 kbps InternetAccess DownloadourDataRecoverylnfo Kit wwmiatareacom/infakihhtmlI I _ i
482-1222 -1_300_563_1167l A H Y
'
l E35)’ and 5 emanl [email protected]| c o u n f a v / S TAT E I P R OW N C E
| Aflbrdable E_‚ „ www.sohoskyway.netI BURHSIDEQREAL-IILCOM | Power-up your LAN with ISDN InternetAccessu:comryrmr RENTAlSm) „ a m vom
InkJet Cartridge& SAVE 50-80%
mscurAMDman.
As Iow as *2per refilu! TobaccoKills."'°""”'""°""“""‘"“”"" BRITISHCOLUMBIA3.
2
gäjgfigrfikmmag?"‘°' LUNGASSOCI_ATIONWe Rent COMPGÜMGS, o Momrßocku m : -Todlswpon o lnvnfriadtnnfidgcslvuilable Box 34009’5mm"DVancouver. B.C. V6J4M2Phone: 73l-5864486Pentium 8:Most Brands of Printers
Tel: (604)521-6904 Fax: 525-4060email: [email protected] AVENUE, NEWWESTMINSTER, B.C. V3L 3C9
WESTERN CANADIAN
COMPUTERSWAPMEET
. Speedv
i-ET‘ iCiaII: 1-800-581—3475 mmM83: C (mm1:R 5| \ s | 416-63617500 cm“
1%: ComputersC6919 Russen Avenue‚ Bumaby1 um Einstd!
Soda:amPfgone: 437-69? Fax:m11
Regular siore houn:Mon-Fri,10cm -Span‘ Webuy 8:sell, new 8:used computer items‘ VGA/SVGA Monitor repairs from S80‘ 486 DX—4 100 S550; Pentium 60 S600‘ Colour VGA from S125; NEC20'SVGA 8600
2HÜam-3pm gq/"Äfrtaions"g ’ CompqhangeCLOVERDALE FAIRGROUNDS
Emggggwfggqfiggäam ‘Syggäv: Computer ShowAUCE MCKAY BU|LD|NG Youmusfbeoverlßfowemisservice Zf.‘„ff‚°„33„ff2;ifJ3Qffiafiffifflfiafiifii S"""*‘V' “aymh- ‘997 ‘mm-‘Pm
Fire hters’ Club1 2
r 6515 Bon rAvenumBum‚ '' ’
(behindm. Bay.Metrotown‘ _The Place for Computer B I}
wesumdAM—300a LwdleedHuy, Pom 464-5515(banpldlHd-31200 E54 Am, Vmcouvar 437-5553ä m ä g ä m m „ For info. hone Ifimberley a1; 438-1094
00-6}:“The boolcseller with äxperience andknowledge)438-6114 eve/woekend) or 816-7731 (showday
(PRODUCTSsumma)ClOV'
o COMPUTER PLAYER! > MAY 1997 b http://www.computer-playencoml
Marketplace
CPU/ME!
ORY
1l
—r'r 33.6K Voice/Fa odem„.549 „.6120 on BJ-30/BJC-70 020x360) „8299/5399]; DK5-75/90/100/133 ...S52/68/99/125 _C 336K Int. Speak _rFax/Modem „.8119 "an‘Color Printer M
’
6x86 150/166/200 „.8139/189/279 upgrqdable to 56K „.5149 1 BJc-240/4100/4200x6x86 150/166/200 „5139/189/279 r C 33.6K Ext.Voice/Fax/Modem „S159 ’_therLaserWL660W ._i. ntium 75/100/120/133 „8129/139/149/182 ercom 33.6K Fax/l odem „.5115 ther Laser HL630/- ‘
uum 150/166/200 „8219/359/559tlum MMX 166/200 „8455/699 l
Kexternal 79ntium Pro 150/200 „5289/820 —160m 33.6K Voice/F Modem „S109 .
. 116cm336KVoice/Ff x/Modem svo..s11oä suna älMM/EÜÜ** '-. „532132 . Robotics 33.6 Fax/Modem „614960nS SIMM/EDO „559/59
‘ .161663355VoiPeIFaxIModem...S159‚MB60nS SIMM/EDO „31151115 "x33.6Kwin’dnu/‘Jnodem- r „.58r MB60nS SIMM/EDO ...s2261226 „618133. ix336K 1: „#29 ;» oKB/512KB PB CacheMemory „319/35 = Voice/Spkr Phzfine/Fax/Modem „.395g 1
: m"mm" 16MB M3129v. tnx PCMCIA Fax/Modem ...s159» .
Systemam” s115rnet Card 16 bit 13A1Pc1C 16 bitCombo ISA}Enet Card
f c 32 bitCombo Pc/fenetCard. v 5200 32 bit PCIEtnprnet Adaptor ..
or Ink Cart. „.845Cart/Head&Tank „830/56
00/4200 InkCarL/Head8rTank519/62486 Motherboard 256KB Cache ard DriveIntel SXIDX Cyrix 5x86.AMD5x86 „.399 11.3GI1.7G/2.0G ...s219122912491275_ C HardDrive -| VXCompatnble PCI Motherboard 1216/253 ms275f299ß27PB Cache, for Pentium 75-200,x’cyfixsxge, AMD K5 estern DugntalHard Drwe„S105 I2.1G/2.5G/3.1G „3275/302/358/399ITriton 430VX PCI Motherboard/512K PBCache, for Pentium,. X,Cyrix6x86‚ AMD K5 „5120/130 ...s2721285136813731409
‚antumHardDriveG/1.7G/2.1612.5613.1G
i
teI i4401=x PCI MotherboardPentium Pro 155200 M5239 ...s2691299132913791415,„am Pentium HX‚ AMI B1os,ATX
1
ega Zip Drive 100MB internal „5239‚K1512K Cache 90/199 mega 21D DFEVE 100MBextema/ „S239ega ZIp Drive 100MBSCSI „S239wer Casew/ 230WCSA PS
13"/15"l19"XCasewl 240WCSA PSM O T H E R B O A R D„342/55/69
V
ega Zip Cartridge 100MB (10pk)...5175
nasonic Floppy Drive 144MB ‚.530w 14-115"117" 1 . ..s30914451749 vadeoBooster {M12M „576188. 14-115-117" „622213151609 3o Expres. 2MB (expAMB) „.311sra 14-11s"117" „.3219/336/619
'
3o Expres. PC2TV 2MB14MB...s15911994 . chi .28 15-117" „5426/735 o 3o ProTurbo PC2TV4M18M „52491349.- d “0 1 . 814" 1 269 Ma h641MB . „.989-—. 02d: . „s15" 3?:0g „i389 m '
s Eogic 543415436 wl MPEG 1M „.832o g ndaiDeluxescan .2817" „3729 < s Logic 5446w/ MPEG 1M „.839m odo .28 15-117" ...s3391636 ond Stealth 3o 2M „3125_ilips .28 15"117" „55501912 o oxMillennium 2M14MwRAM...s25913392 . .ilips .26 17- . „31166
voxMystique 2M14M s6 „91751215
1 al .28 1411.5" n
...s2391369 o ‚T110664V;g/MPEG1M12M""-- eptre .28 14 115 117. ...s26913491649 V-RE 3 M4M „.5
pu-e 17" _2s = „3695 I‚|‚| dent 9680 1MB_| '
sung 15GLe/1561.1 .28 „94591499 r: nt 9685 PC2TV 1M 69D msung 17GLi .28/1WBLSi .26 „386911069 o =Lightspeed 128B“Refresh t0 160H:m5119/129 sung 20GLs 16001151200 .26 „s1759 S 225MBof 800MBISec „S149mono 1024x768 91'1114" „.3162/165E „.31191128/179 .28 14"6450G/GL „52391295 RAMfor Video Card 512KI1M „.88“5_ Pro .26 14-115" „15275/359
16x „.31191165 Pro 17" .28/.26 1 „56391749a neer/Cyber CD ROM12x „3138/144 Pro .28 2o"I.26 21*.‘ ...S1388/1998 "
, __f
f i m f ‘ .
75 MfizAMD K5 150MHzCyrix/|8M 686 120MHz Intel Penfi PentiumMMx166 PentiumPro20016 MBEDORAM 16MBEDO 16MBEDO 16MBEDO IntelMBw/ 32MB2‘ “umMolhcrßoatd 1.3GB HD 512K Cache S 1.7GBHD 2.5GBHD512K PBCacm 1.44!FD 1.668140 1.448FD
‘ 1.44IFD1.068110 Savldoocfid 1.44IFD SSVIchOCrGZM 10xDDROIPmaaonictMMI-‘DD PanaaonkMaCDRDM SSWdnCC-d 1? 32b|tPro8oundcnrd A113D4IVidoocIrdS3VidooCardw/MPEG « 33.611VoiceModom ‚ i‘ ' 12100/2001 1‘ 12xCDROM USRSSßFmt/IodemPowononicMimTowor PowaraonicMlribwcr ' Mitibwor 335KVoico/Fnx/Iodun Saunabau"32 hitsould0ndMrlssinhmeodkoyboerd Wirßöfinlwleodkoybocrd Mvflsfiiwleodlfleyboard. 15"Pavw0nodcTounr PowonodcflfATxTowcrsamouaoaPad sarnoualrPnd 3Bmouso&Pad .1 FujflsuKbdüLofitochnvouse Fqihtakbdllsnlouacw! 14"Nil-R SVGAl/‘Onifor w'14" Nli-R SVGÄMWW» .114-NILRSVGA
V
itor. w/ 15-ProfessionalMonitor. 111/15117120"75/90/100/133""!185°"
35/20015"! 1201133115011 „ Hz MMx-166/MMX-200 ProfessionalMonitor.‚3829/839/869/899 1099/1149/1249 1079/110911 4gü
s1309H
.29 81689/1989 52679/2959/3718
Lumoenand g N _ is #242391 BndgeportRd, hmond‚ VGV U4 Q Tel 214-9316, Fax: 214-9317Powersonic E 33'311-‘-‘I ÜF' BridgeportRd.
"’C HNTEKSIKEA‘ 1
i
A
I,
‚ . 7 e ‚ _ „ . _ _ „
httP
15068-8 Kingsway‚(2 Blocks East of Metrotow11ACIä/nter) Burnaby, V5H 2E7 ä
0C97c
Tel: (604)451-8682 Fax: 451-8611 httpz/lwwwnetcLcom ErrIaiI: [email protected]:M-F:9:30AMto 6:3OPM.Saturday:10:0OAMto 5:30PM v
S y s 1 e m 1 ( P C I )sys1em21PcI) Svsle p
"AMD/cyrix öxasPmcessor-basedUpgradabla Systems6x86-133 (P166+) S1120 63186-133 (P166+) S1363 61186-133 (P166+) S1792AMD K6-166 (MMX) S1330 AMD K6—166 (MMX) 81595 1 AMD K6-166 (MMX) 52010 <
’ ’ 6
‘ Emailaddress. Personal home
1 ‘P-‘I20 VXPro S1111 P-120 Triton-VX S1373 P—120 TriIon-HX S1782 v
P399"0 SGIIIPI". 75" w "
t|.‚ .
ZA . : p
P450 VXPro S1204 P-150 Trnon-VX S1455 9-150 TriIon-HX S1866 \/ .P-1soVXPro 31323 P-166 Triton-VX 31532 gP-166 Triton-HX 31997 „ _____________‘ /P-166 MMX IIXPm S1363 P-166 MMX Trnon-vx S1648 P-166 MMX 1111.11.11): S2050 | F” ‚_‚„„‚ ß m n ‚ m , | 1 WP-200 MMX 697 P-200 MMX rrmvx S1968 P-200 MMX 1111M): 82363 * | 1:1.. . . 1„ am o...- | V_V_ü, -‘—'
‘
1010-150 ATX 31626 g 1010-150 111x 3203s I _ _ ä ._
. I
l 3 P(11.51.13) P ‚__PRD-200 ATX S2070 PRO-200 ATX S2480
n
sl A„‚.„-,ab,e a, 5.„„ a m „d l ß g-8MB 6011s E00. 512K Burrätcache -16MB60ns E00.25511 11m1Cache; o 32MB 0011s E00, 512x BurstCache '
| v
’ ' 'vv v
v v |' 7
i v 13GBEIDE hard dnve. Mode4 v 2.060 EIDE hard drive,Mode4 iv25GB EIDE hard drive,Mode 4 -'-------------' _ 8v 3.5‘1.44MBfloppy disk drive v 3.5“ 144MBfloppy disk dnve v3,5" 144MBfloppy disk dnve ‘ mv PCI EIDE 2x16550UART v PCI EIDE. 2x16550UART ‘‚- PCI EIDE. 2x16550UART n/eme __vCinus Logic 64bit PCI video card v A11VideoBoas!2MB EDD Ev ATI 3Dxpression+ PCZTV 2MB ’
;1MBDRAM.FIIIIScreenMPEG FullScreenMPEG SDRAM exp 4M,FullScreenMPEG . ‚ Q „
. .. 7)v 14'MonitorN.I.L.R‚ v 15"MonitorN.I.L.R‚DigitalControl 15"MonitorN.I.L.R,DigitalControl Epson 00101400/600/800 72011113329/415/533 I
1024x768, .28dp 1280x1024. .28dp 1280x1024, .28dp. PnP. OSD 31m r‘ 2:... ‚#210511;S419 'v 13'Mini-towercase 230W v 15"Med-towercase 230W iv 17"A7X-towe1case 230WC&&.\‚ fÖÄflguaiuxxaesos1n/1oomopsfrf;‘ fiv 104V0095 Keyboard 8.2BMouse v Logrtech 3BMouseMan Microsoft2BMouse (PS/2) .S.R.Sportster Im.VoIceModemv 8XEIDE CD-ROMDrive v 104Vwndows 95Keyboard Iv104 III/Indows 95Keyboard ‘
_ 3;; „Af 335K / 1.’. i {v55Kv 1601701100016!3D800m1Gerd -8XEIDE GD-ROM Dnve —12xEIDE CD-ROMDrive ü,» /„1 „man 12xman” 5109v 60WMultimediaSpeakers v SoundBlaster 16PnP (creaüve L317) -SoundBIaster 16PnP (CrealiveL301 .„b. ‚_
--33.511Modemw/sbeakerPhone -sowMultimedia Speakers I-eowMuIfimedia Speakers 3 MICv v v‘
' I
v v v 1 v
;v 2 Year Parts and LabourWarranty v 2Year Parts and LabourWarranty I;v 2Year Parts ano LabourWarranty 77 "*7"- 3 I“
' "- *
115'111. LR. S89 16MB EDO ‘S58 53211/19500 595 ATITVTuner S138 gmatrox 2w S88 25/31015HD548/98:1‚.7GB S38 2MBwdeo S20 IIZXCD-ROM 31a 17'Towe1 S20 f‘ 77v“ ’ I = =.= f:’ ' ’ ' ' “7 NTWorkstation 4.0 S268 MSHome (6üfles)585 MSNatureK13. S68 MSOfficePro 97 S439vSI/praExpress 33.6 Voice FaxModemInl. 11.34 with 1 1: ’ ‘
v,S118
i
31133/338u u
L‚
ES
MOTHER BOARD PRINTER ‚NSCATJIJERIWIAMEHA TaL eDrive&Removable StorageM537M53543m253117320011111:0131120111111 109n23 Canon 3.10240um 3223 ’ =IOMEGA zip 1111140511110slPora. 8189/208Ev<
‘> l 5 v’
52955;;"6
v Zip Drive 100MBSCSI/Peru. 8198/198I m pad EIDE. v/Jutperless 5mm -zssxpapemgyacm 1mm:u m ;nasnaIos 3m:cm1300/5002300 323/4195119 ‘h?2"",1_F L.‘
-515,9’A508 PIFPSSTZPCv! EIDE. I i l speed I0ATo7ATX 318922.115 1:61:10!
PCG.Mac7 _ ' ‘
‘zdß im’ '
svwd/ifi512K Pipeline BurstcacheJrnon II4301-0111330 BIOS H E W L E "53mm „ 0 35V - -
Asus 11x97 III-EIDE.hnhspeed10113119 v- 3149 (1,1) PACKARD DSSWEMMMMTW 3991533539«
< v 011m Easy 320011115111. 3233/353512KPneirIeBu5t [Sandmanuhsn430m1 lmetJeläl600m1!!! S535 1" T: E . ; x* I _ I’; ‘LT 52'. ugugs 51mg 3173g ISAAIIaphec1 I- iorscslzipA/PclJulielscsl 856/12951211Pmnesue1camrmmu.mn43om I.'..:..'T‘.?‘ “ i f ? ' . ’ ‚ i i . ‘ V’ 1* 5"?'*?‘ ‘»»
"‘(VAN70mm In0112|Fasan50cm 1 3330 segnen 4s 553|[59m: 3mm :m39 TAPE 3M800 z /2.0GB /3.2GB 8119/31/49
512K HpeifleBuslCacmTmmI.Hash. BRAM31m_ „ ‚ . . v / „ I . . . . ‚ 1 . ‚v -- w v „svsavoace/Fnlnuvur
5I2x3usIcacne1m1‚n43onx_rnsnA1xs1yIe =
3oo-NLo0U-EEE\\-'o-v-v:‘
3 0 0 - N C O O U - E S E \ \ - ' U r + v + 3 '
aon-xrcoo-o-sssxw-‘oen-v:
Boo-xxconn-Eääxxuna-«n:
' "" "
‚Sportsterßlßlfixtfuv ueuv Paarung/minimale......... 329a __„‚_ 1.;“Bzsexamcm 11x5mnasnsaos ‘ " 1Egüflfig: f}:INTEL pemium MPAX PRO CF“ F: ":'.::I‘.‘‚'‚"E5i 7.:,’- FJ: E}: "TjßfsciiPro-ZOO P120/133 P150 P166 W 7 6 6 Mm oreeveqronunwsuwsnnenowxz 3359scaII 5149/189 scaII scaJI ScaII scaII CrnüvePB-DVDKÜßSDKBPS v 353a ‘III-II.‘ EPU t1"! IHM i“! ;.;.'1'5.'?‚'.2‘„";f—."_"‘.‚_.""" m 30m 111m PCZTV 4MBssm 3249X5213? K6-P166 K6—200 6X150+ 6X166+ 6x200+ Mm “ u m ” m m “ van-nur v. , ‚A _ „ . 3 _--:g;;;;:598 5368 Scall 5159 S189 526B „„„„„'m‘“"„„‚ „ m m ATIVideo 1msE00 mIIaIaoo 305/99
1107-1113-“5451 36132101 1.11031 [IIICGI Passau: co-nonuux 2x 11 s _vldeoßooxlßdxpresxiun S1394MB 4500 8MB 8EDO 16MB 16E00 32MB 32500 = =
u 30 2/411110 EDO 8148/170529 S30 S58 .558, 5108 ‚S.198 5303 5208 " u m “ M ” v ‘v v-
‘ Sleallh 30 214m0 vnm 3233/3331111111/11111111111/11; acwnmsmowmmfl)“ 5g: ‚ zmauorumzaoscoiginwmea 3134
ä WESTERNDIGITAL scsosrcrranuninonooaserroan) 399 33|‘ ' ' " " M u m m ? "“ M ” ‘239/“51 m mm,“ 131;; 10m 520| 12311 119mm 324a vommnuem NNeIHorIHuD 3115/139
Ä
PcllflvsfiouemSGHAM 8179/229Westen 0in1 1.500 m: im Im M2160! 326a Back-UPSP1oPrIP280/420/650 819913380128 - —113mm:nunnevStudio rrv 3300/100WOCHE“Ü” 2.1 GÜ ‘Ü!’ u“ Ü‘ " m a n 5330W“! E00 578/105“ BMW” 7-555 ‘°"“ m‘ m‘ “ m ” 333° 153113 231,1 nsssoxz 13/335 ‘ -weaenoqu 3.11:: um 5m m! I m “ ! 335a :.:.-.. v'v'.:v;'vv:—: ’ v: v . "MPEGM"m“ "MB "321:WettenDich! 4MB "I" m‘ m‘ WM 8459 IOMEGASCSIPCI32bIICor1troIIe150pinII/D 312a’ 51352407593161.3.1....
m213a m. m m: rm- 3311s 3äiC3l‚1‘“3’°a„?ä2ä3%„°„.‚„2-°1.°;.’„e1’”
"U"5589 590511/17531m1; 1 5591059
mwmmm" m: FÄM‘'3?: T mm KEÜM1ÜMK3EÜ
C635 Acah15".2B 1121030LR. /15"Touch8creen 33211/755‚mmm „ G , M, 5m ‚m F„„„‚ „,5 E9 5725001746725 Kevbogfü 2m! 53859€? DawekNLLR. .230191:3115 .17 5348/770 inuantnm 64GB um: 3500 12311 wenn 8540 W15“ . ’“ " 5 ’ “ 399'915" ‘7 P7397“ 355/553/759 .’ LrtconWIn95 NIturIIILBJ/nhToucnPnd S85 ‚v: 0x11“ 15.. 25 Trinuton 3499 :a m “57 l3 G5 " m " 5“" m‘ ""”* 553° Loguech 2BM0use/3BM0useMan 322/35 1121515,
'’_‚ ‚
cgpseagate LogrtechfiuflrackManOombohIarble 585/105 799717" 15 T""'"°" 532“‚ „ . „ . ._
»===v=*= W 1"" “W m" I3l0ääl’;1l’.‘ä’?;‘;2.‘;‘:’:°' 2172231723 SON säälfißi%äävfisi“’ä-f’ 13351352 * v...’re
‘ V ' ' ’ ' ‘Massenmarkt-g .. 1 . . . , ‚ ‚. 115c 15X1! mxv+ 3523/953 _—; ‚; —v
‚‚ : . ‚- —‘ v_2G „_ m w m m5 2 1 3 1 1 1 1 1 1 2 NE I v w
*v »
e.v." a m ! .5 B ' corelxara IorWindv-s 95 _ 8249 115cM700 17" S1068 v
‚ ...... ..100.“ -Maxtor 5.1
als 10m‘: 531111 55311 35120118538 _ äservergwlifipcfimtfimmas‘ 5152:2
- ‚ 3111773N775 .26PnP OSD 5709/848 1 g . v, ‚ i . ..3,49’ ‚
ouammsosa 2133 Im: 5m m! 7 m m 3m msonseemosnuwiussaaem) v 3m _ „ „ „ ä ’
v
»
’
v
»e
v
Quanmmscsrz 3.200 was s-zoo 126x 0432:1112 313e MSPIus95/PuhIisIm97 568/95 _ w “I 15 "7 f?‘ _„ 150/950“ 1Ommumscsts 2.2 es am: 7200 512x 3227m 353a MsSOLSerVerGDmrNTFLSI/ljp 31213/599 “ u m ? ! ” WANN) 15 "7 I21 "29/177/255 '
T comvursa PLAYERI > MAY 1997 p httpzl/v/ww.comHVuter-player.coml
2YEIIII PARTSGIIBIIIIWIIMANTYWITHEIJIIIIANTEIZIMY IIMMIIIIIII!
TOTALGOMM
IIIEHIBAMIII
MLBIIIIWMIWITY:IYIIIIMVHIIETIWIZPIIIIIIBISWIIIIISHHIIISVIITIIYIIIIIEWFIIIIIÜSWDIITERJTLLWMEEIIIMIIIIIIIT%I
Faronics Speedbookv IntelPentium 133TCP Packagev _v 16MBRAM expandable to 48MB g-256KB Pipeline BurstCache LevelTwo Cache fv Removable 12.1‘TFT LCDModule "v2MB Video Card 8:16BitSound Card
4
v FuIISoftware MPEG Support .;vTwo Type IIorOneType III;MicrosoftPlug and Play Compliant PCMCIAv IOXCD-ROM v 1.368HardDrive i‘
v 1.44MBFloppy Drive Iv CD-ROM and FloppyDrive can be used at the sama fimevVlfindows 95KeyboardvGlidepointMouse I.v NiMHBatterywith dual battery capability; Flugs intoeither CDorFDDBayv lnfaredPort,Serial Port,Parallel Port8:External P512 PortvMSVlfindows 95OSRZRelease IvTargus Carrying Bag ivBeautifulFrt8:Finish;Lessman3.2kgs. I
1
i‘
TIte Perfrer forD _ Home/Offlce
fitllfflglqgQJWWBZ m3"!Machme Complete Packagev ne en um ‚ .‚3_‚„B„„„„‚„„ Faronrcs 5200M32 1 rammcssissmis‚ ‘ IntelPäflflüm 203 I
.IntelPentium-IntelHXChipsetMainboardwl512k esCache ' 5“ G““a”" Ü " I ' ‘"563 "a"°""°vFlash RomBios °32MB SDRAM l .16MBE00RAMv Enhenced IDEController,Mode4 °3::Ilnfäälgfiiggd. |flte|TXChips“W513? P5Cache xlgihkäghiaflägt
Mambwrdwßm‘P8Cachev2HighSpeed Serial Ports 81Enhanced ParallelPort ° ‘ _‘1.44MBHoppyDrive oEnhancgd m5 cgpu-gflgr’Mode4 4 Enlianced IDEController,Mode4
n 2 speed sena|PortsaEnhanced Para||a| Pan °2 Speed Serlal PÜITS&Enhanced PHTHHGIPort' 12x8030M .144M3|:| p ' ‘ v144MB Floppy DrivevATIsoXpressions 2MB PCIVideo Card s4Bit 15xCDR01?""Ve _8xC0440,“v Enhanced Vlfindows 95Keyboard
' ' . ‚ - -‚MicrosoftMousew/Pad vMatroxMysoque4MB IfideoCardw/Games 2MBPC‘VW" “I'd 54B"vFaronicsMini-TowerCasa ' E"h°"°°dmndws 95K°V°°"d ' EnhancedMndows95Keyboard
o MicfosgflMouse ‘MICTOSO“MOUSÖvU.S.Robotics 33.6Data/FaxModern _FamnicsMidsrowerGase ‚FaronicsMmflowerGasev PnP 3DSurround Sound Card . ‚ -v Labtec Amplified Speakers °U3’3°b°"°5333Data/FaxM°d3m 1
O gäbgucsmassoamfäx ‘rmjem‚15-FaronicsMonitorNLLowRadiation ' CTGGÜVG L305Soundblaster W/WGVBIBNB n ""9"" oun m’-LabtecAmplified Speakersw/Subwoofor ' Labtec Amnhfied SpeakersvMicrosoftVlfindows 95OSRZOEMw/OriginalCD8:ManualvMicrosoftEncarta,Works,Money8:Two FamilyCDs
Performance Price .........v 1TMag lnnovisionDX700T .25dpiTrinitronTuha '14"FallmicsMWIITWN‘:L°W 3345350"vMicrosoftWindows 95OSRZOEMw/OrfginalCD8|Manual
Tha Dreamcan beyourshr .........51499.00 s4 2 9 gim)Upgrade (o theMMX166 ........S99 ‘539/"1 ' ‘n
vMicrosoftEncarta,Works, Money8:Two FamilyCDs111l:
Lease for0154p/m
vMicrosoftVlfindows 95OSRZOEMw/OriginalCD8:Manual
nbntabloOunlityl-‘achgo ...........1‚749.00
FaronicsGorporate ServicesNETWORKING: From2 to 100Systems,wecanbe yournetworkingpartnerComplete Hardware Expertise |_B_MAptiva 8:IBMServersv Hubs,Routers and Cards 1g f; v Complete Line ofAptiva C,E&SSeries
v Installation ofNetworkCable AmizvdfivsemivAll IBMServers available ‘e
Complete Software Knowledge „_ . & 25:35;Hausen» Q mm4 1o ‚g -Complete line ofOffice Printers
StarMax SystemsTOSHIBA Notebooks: v FuII SCSI Line for Apple Productsv Great Selection: LittIeWait 'I'Ime&Good pricesvNopoymenls for 90doys available ooc. (uslomize lhe syslems louny configurolion -"|usl cuIIorfux 540-8I79for oquole
TECHNOLOGIES INC.
Pfices and Specifications Subject to Change without Notice WEM“H“
0 0 0 0 i
57A -53Clipper Street, Coquitlam, B.C. V3K 6X2 mit" 7°“ ' "s0 0 0 Hours:Mon.-Fri.9-6; Sat.-Sun. 11-50 0 0 Brunctlc540-819
Check Out wwvnfaronicsmont This is how to get to Faronics.
UnitedBlvd.
ei.3.v:
I
There is more to anInternet service thanwhaf you see on your -
Computer screen. You need aprovider that can defiver Ihehigh IeveIofperformance undrelia- _ .bilifyyou Jemand - InternetDireddoes Djust rhaf! Service, Support, Reliabilily und \ .Speed. CallNow!
% InternetDnfecf« wwwdrrectca
cau 602-1363W
o: 21-800-232-4944»IN VA NCO‘UVER '
%OUT5IDE THE LOWER MAINLANDiA
‘7 .».._.s--». ‚;