Upload
dangkhue
View
215
Download
0
Embed Size (px)
Citation preview
The GlnR-dependent
nitrogen regulatory network
of
Mycobacterium smegmatis
Der Naturwissenschaftlichen Fakultät
der Friedrich-Alexander-Universität Erlangen-Nürnberg
zur
Erlangung des Doktorgrades Dr. rer. nat.
vorgelegt von
Nadja Jeßberger
aus Werneck
Das GlnR-abhängige
Netzwerk zur Stickstoffregulation
in
Mycobacterium smegmatis
Der Naturwissenschaftlichen Fakultät
der Friedrich-Alexander-Universität Erlangen-Nürnberg
zur
Erlangung des Doktorgrades Dr. rer. nat.
vorgelegt von
Nadja Jeßberger
aus Werneck
Als Dissertation genehmigt
von der Naturwissenschaftlichen Fakultät
der Universität Erlangen-Nürnberg
Tag der mündlichen Prüfung: 28.07.2011 Vorsitzender der Promotionskommission: Prof. Dr. Rainer Fink Erstberichterstatter: Prof. Dr. Andreas Burkovski Zweitberichterstatter: Prof. Dr. Yves Muller
Danksagung
Die vorliegende Arbeit wurde am Lehrstuhl für Mikrobiologie der Friedrich-Alexander
Universität Erlangen-Nürnberg durchgeführt.
Mein besonderer Dank gilt Herrn Professor Andreas Burkovski für die Bereitstellung des
interessanten Arbeitsthemas und die kompetente Betreuung. Weiterhin bedanke ich mich bei
der Universität Bayern e.V. für die Finanzierung der Arbeit.
Herrn Professor Yves Muller möchte ich für die freundliche Übernahme des Zweitgutachtens
danken.
Ein ganz herzlicher Dank gilt Frau Doktor Sophia Sonnewald und vor allem Stephen Reid
vom Lehrstuhl für Biochemie für die Durchführung der microarray Experimente. Ich möchte
mich auch besonders bei Amon für die vielen Ratschläge und Diskussionen bedanken.
Ein riesengroßens Dankeschön geht natürlich an die Mädels aus dem Labor: Kristin, die wir
alle sehr vermissen, Lisl, die kleine Eva und Naddel4-∞ für eine unglaublich tolle
Arbeitsatmosphäre und das gemeinsame Erledigen von jeder Menge „Unikram“. Eva, ein
ganz besonderer Dank für deine Tapferkeit und dein Durchhalten beim Thema
Sensorhistidinkinasen.
Meinen Eltern danke ich für die große Unterstützung während des Biologiestudiums und der
gesamten Doktorandenzeit.
Mein größter Dank gilt Mikko, der vor allem in der letzten Zeit sämtliche Anfälle von mir
ertragen musste und sich dann auch noch durch die gesamte Arbeit gequält hat. Paljon
kiitoksia!!!
Content
Content
1 Zusammenfassung/Summary ............................................................................... 1
2 Introduction ............................................................................................................ 3
2.1 The genus Mycobacterium ........................................................................................... 3
2.1.1 Taxonomy and characteristics .............................................................................. 3
2.1.2 Mycobacterium smegmatis ................................................................................... 6
2.2 Nitrogen metabolism and regulation ............................................................................ 8
2.2.1 Uptake and assimilation of nitrogen sources ......................................................... 8
2.2.2 Nitrogen control in Escherichia coli ....................................................................... 9
2.2.3 Nitrogen control in actinomycetes ........................................................................11
2.3 Aims of this study .......................................................................................................16
3 Materials and methods ........................................................................................ 17
3.1 Bacterial strains and plasmids ....................................................................................17
3.2 Cultivation of bacteria .................................................................................................21
3.2.1 Culture media for E. coli, C. glutamicum and M. smegmatis ................................21
3.2.2 Antibiotics ............................................................................................................22
3.2.3 Growth conditions ................................................................................................23
3.3 Procedures in molecular biology .................................................................................24
3.3.1 Procedures to work with DNA ..............................................................................24
3.3.1.1 Isolation of plasmid DNA from E. coli ............................................................24
3.3.1.2 Isolation of plasmid DNA from M. smegmatis ................................................24
3.3.1.3 Gel electrophoresis and extraction of DNA from agarose gels ......................24
3.3.1.4 Preparation of chromosomal DNA from M. smegmatis ..................................25
3.3.1.5 Polymerase chain reaction (PCR) .................................................................26
3.3.1.6 Two-step PCR ...............................................................................................27
3.3.1.7 Purification and enrichment of DNA ..............................................................27
3.3.1.8 Restriction of DNA.........................................................................................27
3.3.1.9 Ligation of DNA fragments ............................................................................28
3.3.1.10 Sequencing of DNA .....................................................................................28
3.3.1.11 Gel retardation and competition assays ......................................................29
3.3.1.12 Electrophoretic mobility shift assay (EMSA) ................................................31
3.3.1.13 Southern blot analysis .................................................................................32
3.3.2 Procedures to work with RNA ..............................................................................34
3.3.2.1 Isolation of total RNA from M. smegmatis .....................................................34
3.3.2.2 RNA gel electrophoresis ...............................................................................35
3.3.2.3 Synthesis of digoxigenin-labeled RNA probes ...............................................35
3.3.2.4 RNA hybridization analysis (Dot blot) ............................................................36
3.3.2.5 Quantitative real time RT PCR ......................................................................37
3.3.2.6 cDNA microarrays .........................................................................................39
Content
3.3.3 Procedures to work with proteins .........................................................................39
3.3.3.1 Preparation of total cell extract ......................................................................39
3.3.3.2 Protein purification via affinity chromatography .............................................40
3.3.3.3 Quantification and enrichment of proteins .....................................................41
3.3.3.4 SDS polyacrylamide gel electrophoresis .......................................................42
3.3.3.5 Native polyacrylamide gel electrophoresis ....................................................43
3.3.3.6 Staining with Coomassie Brilliant Blue ..........................................................44
3.3.3.7 Western blot analysis ....................................................................................44
3.3.3.8 Pull down assays ..........................................................................................45
3.3.3.9 Radioactive phosphorylation of proteins ........................................................46
3.4 Genetic manipulation of bacteria.................................................................................47
3.4.1 Preparation of competent E. coli cells ..................................................................47
3.4.2 Transformation of competent E. coli cells .............................................................47
3.4.3 Preparation of competent E. coli Rosetta2 cells and TSS transformation .............48
3.4.4 Preparation of electrocompetent M. smegmatis cells ...........................................48
3.4.5 Transformation of electrocompetent M. smegmatis cells ......................................49
3.4.6 Generation of genomic insertion and deletion mutants of M. smegmatis ..............49
3.4.7 Fluorescence measurements ...............................................................................50
3.4.8 Fluorescence microscopy ....................................................................................50
3.4.9 β-galactosidase assays ........................................................................................51
3.4.10 Determination of urease activity .........................................................................52
4 Results .................................................................................................................. 53
4.1 General analyses of nitrogen metabolism and control in M. smegmatis ......................53
4.1.1 Utilization of different nitrogen sources ................................................................53
4.1.2 Relation between growth behavior and initiation of nitrogen response .................61
4.1.3 Uptake and assimilation of urea ...........................................................................64
4.1.4 Generation of an in vivo reporter system for nitrogen response ...........................65
4.1.5 Purification of GlnR ..............................................................................................68
4.1.6 Generation of a GlnR-specific antibody ................................................................71
4.1.7 DNA binding ability of purified GlnR .....................................................................72
4.2 Characterization of the GlnR regulon ..........................................................................73
4.2.1 Global approach using DNA microarray analyses ................................................73
4.2.2 Verification of the microarray data ........................................................................83
4.2.3 Binding of GlnR to promoter sequences of its target genes ..................................89
4.2.4 Determination of binding properties of GlnR ........................................................91
4.2.5 Autoregulation of GlnR .........................................................................................96
4.3 Activation of GlnR .......................................................................................................97
4.3.1 Search for GlnR interaction partner ......................................................................98
4.3.1.1 Global pull down analysis ..............................................................................98
4.3.1.2 Analyses of deletion and insertion mutants ...................................................99
Content
4.3.1.3 Correlation between phosphate and nitrogen metabolism ........................... 104
4.3.1.4 Analyses of protein-protein interactions and phosphorylation of GlnR ......... 105
4.3.2 Investigation of phosphorylation residues .......................................................... 112
4.4 Nitrate and nitrite metabolism in M. smegmatis ......................................................... 118
4.5 Investigation of a conserved mode of action of GlnR in mycobacteria ...................... 124
5 Discussion ......................................................................................................... 128
5.1 GlnR as the global regulator of nitrogen metabolism in M. smegmatis ...................... 128
5.1.1 GlnR-dependent utilization of different nitrogen sources .................................... 128
5.1.2 Characterization of the GlnR regulon ................................................................. 131
5.2 GlnR as OmpR-type transcriptional regulator............................................................ 138
5.3 Activation of nitrogen response ................................................................................. 142
5.4 Ammonium assimilation in M. smegmatis ................................................................. 146
5.5 Nitrate and nitrite metabolism in M. smegmatis ......................................................... 149
5.6 Role of AmtR in M. smegmatis.................................................................................. 152
5.7 Nitrogen response in M. smegmatis as a possible model for M. tuberculosis ............ 154
6 References ......................................................................................................... 157
7 Appendix ............................................................................................................ 173
7.1 Plasmid constructions ............................................................................................... 173
7.2 Complete data obtained from DNA microarray analyses ......................................... 1800
7.3 Putative sensor histidine kinases activating GlnR ..................................................... 193
7.4 Abbreviations and units ............................................................................................ 195
7.5 Publications .............................................................................................................. 199
Zusammenfassung 1
1 Zusammenfassung
Mycobacterium smegmatis ist ein saprophytisch lebender und schnell wachsender Vertreter
der Gattung Mycobacterium und wird oft als Modellorganismus für verwandte pathogene
Spezies wie Mycobacterium tuberculosis verwendet. Zentrales Thema dieser Arbeit war der
Stickstoffmetabolismus in M. smegmatis, insbesondere die Antwort auf Stickstoffmangel auf
transkriptioneller Ebene, wobei der Regulator GlnR im Mittelpunkt der Betrachtungen stand.
Es wurde gezeigt, dass das Bakterium verschiedenste Substrate (Aminosäuren, Basen und
anorganische Stickstoffverbindungen) als Stickstoffquellen nutzen kann. Analysen eines
glnR Deletionsstammes verdeutlichten, dass GlnR maßgeblich an der Verwertung einiger
dieser Substrate beteiligt ist. Darüber hinaus wurden durch Transkriptomanalysen 125 neue
putative GlnR-Zielgene identifiziert. In darauffolgenden Experimenten wurde für 32 dieser
Gene eine GlnR-abhängige Steigerung der Transkriptmenge bestätigt, darunter Gene, die an
der Aufnahme sowie Assimilation von Aminosäuren, Peptiden und anorganischen
Stickstoffverbindungen beteiligt sind. Dies verdeutlicht die Rolle von GlnR als globalen
Stickstoffregulator in M. smegmatis. Weiterhin standen auch Gene, die nicht dem
Stickstoffmetabolismus angehören, unter GlnR-Kontrolle, was auf eine umfassendere
Funktion des Regulators hindeutet. Außerdem wurde eine untergeordnete Rolle von AmtR in
der Regulation einiger stickstoffrelevanter Gene beobachtet.
Zusätzlich wurden verschiedene Methoden zur Reinigung von GlnR etabliert und in vitro
Untersuchungen zum DNA-Bindeverhalten des gereinigten Proteins durchgeführt, wobei eine
direkte Bindung an Promotorfragmente der Hälfte aller identifizierten Zielgene beobachtet
wurde. Dies führte zu dem Schluss, dass auch indirekte GlnR-Kontrolle über weitere
Transkriptionsregulatoren oder bisher unbekannte Mechanismen eine Rolle für die
Expression einiger Gene spielt. Außerdem wurden in der Promotorregion von amtB
wenigstens drei GlnR-Bindestellen ausgemacht, was das Modell der „galoppierenden“ DNA-
Bindung von OmpR aus E. coli unterstützt. Als ein Vertreter der OmpR-Familie von
Transkriptionsregulatoren soll GlnR durch eine zugehörige Sensorhistidinkinase
phosphoryliert werden. Obwohl diese im Rahmen dieser Arbeit nicht ermittelt werden konnte,
wurden hochkonservierte Aspartatreste als Phosphorylierungsstellen von GlnR identifiziert.
Erste Experimente mit M. smegmatis und M. tuberculosis GlnR deuteten trotz der
identischen C-terminalen DNA-Bindedomänen und N-terminalen Phosphorylierungsdomänen
der beiden Proteine auf klare Unterschiede in der DNA-Bindung und der Aktivierung der
Stickstoffantwort hin. Dennoch kann das in dieser Arbeit entwickelte Modell der
Stickstoffkontrolle in M. smegmatis durchaus als ein erstes Schema für M. tuberculosis
verwendet werden. .
Summary 2
1 Summary
Mycobacterium smegmatis is a saprophytic and fast-growing member of the genus
Mycobacterium and is often used as a model organism for related pathogenic species such
as Mycobacterium tuberculosis. Focus of interest in this study was nitrogen metabolism and
especially transcriptional response to nitrogen limitation in M. smegmatis, while the
regulatory protein GlnR was the focus of attention.
It was shown that the bacterium is able to use different substrates (amino acids, bases and
inorganic nitrogen compounds) as nitrogen sources. Analyses of a glnR deletion strain
revealed that GlnR is substantially involved in the utilization of several of these substrates.
Moreover, 125 new putative GlnR target genes were identified in transcriptome analyses. In
subsequent experiments, a GlnR-dependent increase of transcripts of 32 of these genes was
verified, including genes involved in uptake and assimilation of amino acids, peptides and
inorganic nitrogen sources. This confirms the role of GlnR as global nitrogen regulator in
M. smegmatis. Moreover, also genes not involved in nitrogen metabolism were identified as
GlnR targets, suggesting a more global regulatory function of GlnR. A GlnR subordinate role
in regulation of some genes involved in nitrogen metabolism was also monitored for AmtR.
In addition to that, different methods for purification of GlnR were established and in vitro
analyses of DNA-binding behavior of the purified protein were carried out. Direct binding to
promoter regions of half of the identified target genes was monitored, leading to the
conclusion that indirect GlnR-control via further transcriptional regulators or so far unknown
mechanisms is also involved in gene expression. At least three GlnR binding sites were
identified in the promoter region of amtB, supporting the idea of a “galloping” DNA binding
model which is described for E. coli regulator OmpR. As a member of the OmpR-family of
transcriptional regulators, GlnR is supposed to be phosphorylated by a corresponding sensor
histidine kinase. Although this kinase could not be identified within this study, highly
conserved aspartate residues were distinguished as phosphorylation sites of GlnR.
First experiments with M. smegmatis and M. tuberculosis GlnR pointed to distinct differences
in DNA binding and activation of nitrogen response, although the two GlnR proteins share
identical C-terminal DNA binding and N-terminal phosphorylation domains. Nevertheless, the
model of nitrogen control in M. smegmatis developed in this study can indeed be used as a
first pattern for similar processes in M. tuberculosis.
Introduction 3
2 Introduction
2.1 The genus Mycobacterium
2.1.1 Taxonomy and characteristics
Within the order Actinomycetales five different phylogenetic families exist. Actinomycetes are
generally characterized by their filamentous, thready and branched growth, which can be
compared to a fungal mycelium. Their name is derived from Greek aktis (ray) and mykes
(fungus). The five families are indicated as Actinomycetaceae, Corynebacteriaceae,
Dermatophilaceae, Nocardiaceae and Mycobacteriaceae. The only genus in the family
Mycobacteriaceae is Mycobacterium, which contains more than 110 different species
(Hartmans et al., 2006). The first of these species to be identified was Mycobacterium
tuberculosis, which was discovered by the German physician Robert Koch in 1882 and
reported as “tubercle bacilli” (Philip, 1932). The name Mycobacterium was first used by
Lehmann and Neumann (1896). The securest method to quickly identify mycobacteria is the
acid-fast Ziehl-Neelsen stain. Here, cells are stained red by slow heating using the dye
fuchsin. After washing in H2O, cells are stained with methylene blue. Acid-fast organisms
such as mycobacteria occur red, non-acid-fast ones blue (Barksdale and Kim, 1977).
Apart from this, mycobacteria are generally characterized by their rod shape, the high GC
content of their DNA (60-70 %) and their rough, “mycelic” colony morphology (Ojha et al.,
2000). Furthermore, mycobacteria are considered Gram-positive, although they can hardly
be stained according to Gram. They are facultative aerobic, non-sporulating and non-motile
bacteria with a size of 0.2-0.6 x 1-10 µm (Traag et al., 2010). Moreover, they are resistant
against many antibiotics.
A closer look to the structure of the mycobacterial cell wall gives an explanation why these
organisms are hardly stained by Gram, why they are acid-fast and why they possess a high
resistance to antibiotics. The so called CMN group (corynebacteria, mycobacteria and
nocardia) are the only organisms known to be able to synthesize mycolic acids (Embley and
Stackebrandt, 1994; Rastogi et al., 2001) and developed a unique and very complex cell
envelope which is unusual for Gram-positive bacteria. The Gram-positive cell wall usually
consists of a thick peptidoglycan layer with associated teichoic acids lacking the outer
membrane of Gram-negative bacteria. In the mycobacterial cell wall mycolic acids, which are
groups of hydroxy lipids, are covalently bound to arabinogalactan (a polysaccharide
consisting of arabinose and galactose) complexes at the peptidoglycan layer. Mycolic acids
are large branched chains of 20-90 carbon atoms, which give the cell wall its typical thick,
Introduction 4
A
C
B
waxy and hydrophobic consistency (Barry et al., 1998). Although mycobacteria are classified
as Gram-positive, recent studies revealed the existence of a second, outer bilayer (figure 1).
This mycobacterial outer membrane (MOM) is about 8 nm thick, morphologically symmetrical
and organized in a native three-dimensional structure (Niederweis et al., 2010).
Fig. 1: The mycobacterial cell wall. A. Cryosectioning of the cell wall of Mycobacterium bovis. MOM: mycobacterial outer membrane. CM: cytoplasmic membrane. B. Cryo-electron tomography. Blue: arabinogalactan-peptidoglycan polymer between CM and MOM. C. Model of the mycobacterial cell wall. L1: unknown periplasmic layer. L2: part of the peptidoglycan-arabinogalactan polymer, partly unknown. Yellow: hydrophobic compounds. Blue: porin. Adapted from Niederweis et al. (2010).
A primary classification of mycobacteria was introduced by Ernest Runyon (1959), based on
growth rate, morphology and pigmentation of the bacteria. He separated fast growing
mycobacteria (group IV) with a generation time of less than five hours and formation of
visible colonies after less than seven days from slow growing ones. The slow growers were
described by having a generation time of up to 20 hours and by forming visible colonies only
after more than seven days. Furthermore, Runyon separated them again by their
pigmentation into photochromogens (pigmentation when exposed to light, group I),
scotochromogens (pigmentation in light or dark, group II) and nonphotochromogens (not
pigmented, group III). This separation into fast and slow growing organisms was proven by
sequence comparison of macromolecules. One of the most commonly used macromolecules
for phylogenetic analyses is the 16S ribosomal RNA because of its universal existence
(Rogall et al., 1990; Stahl et al., 1990). The affiliation of mycobacteria to the Gram-positive
branch of eubacteria was also supported with this method (Pitulle et al., 1992).
Introduction 5
Generally, fast growing mycobacteria are considered non- or facultative pathogenic. Most of
them are harmless inhabitants of soil or water living saprophytic from decomposed organic
material (Kamala et al., 1994). They are also known as the MOTT group of mycobacteria,
which stands for “mycobacteria other than tuberculosis”. Nevertheless, some species can
cause diseases to animals or humans with immune deficiencies. Some considered non-
pathogenic fast growers are Mycobacterium agri (Tsukamura et al., 1981), Mycobacterium
confluentis (Kirschner et al., 1992), Mycobacterium phlei (Lehmann and Neumann, 1899),
Mycobacterium smegmatis (Lehmann and Neumann, 1899) and Mycobacterium
thermoresistibile (Tsukamura, 1966). Pathogenic examples of this group are Mycobacterium
chelonae (Bergey et al., 1923), Mycobacterium fortuitum (Da Costa Cruz, 1938) and
Mycobacterium mucogenicum (Springer et al., 1995).
On the contrary, the group of slow growing mycobacteria is very often associated with or
even the cause of serious animal or human diseases. They are often obligatory pathogenic.
Most popular examples are Mycobacterium africanum (Castets et al., 1969), Mycobacterium
bovis (Karlsen and Lessel, 1970), Mycobacterium microti (Reed et al., 1957) and
M. tuberculosis (Lehmann and Neumann, 1896), which form the “Mycobacterium
tuberculosis complex”, as well as Mycobacterium leprae (Lehmann and Neumann, 1896).
There are also some members of the MOTT group among the slow growing mycobacteria,
which can cause serious diseases. These are e.g. Mycobacterium kansasii (Hauduroy, 1955)
and Mycobacterium marinum (Aronson, 1926). A few untypically non-pathogenic organisms
also exist in this group. These are e.g. Mycobacterium gastri and Mycobacterium terrae
(Wayne, 1966).
Of all mycobacteria, the biggest attention in research is paid to M. tuberculosis (figure 2A and
B). This bacterium with a generation time of 15-20 hours is extremely slow growing and
consequently difficult to investigate in vitro. M. tuberculosis is an intracellular parasite that is
easily transferred by respiration. After inhalation of M. tuberculosis, a primary infection starts
by settling and growth of the bacteria in the lungs. A subsequent immune response results in
accumulation of activated macrophages. M. tuberculosis is able to survive and grow within
modified phagosomes of macrophages (van Crevel et al., 2002). Because of the high lipid
content of its cell wall, it is very resistant to chemical agents and antibiotics. It blocks immune
response of macrophages to infection by preventing the formation of phagolysosomes
(Flannagan et al., 2009). In humans with weak immune resistance, the infection becomes
acute leading to an enormous destruction of lung tissue (figure 2C) followed by spread of the
bacteria over the whole body and finally death. In humans with good immune resistance, the
infection remains local and finally ends, but the patient keeps hypersensitivity against the
bacteria. Another exposure to M. tuberculosis can lead to chronic infection and destruction of
lung tissue (van Crevel et al., 2002). Over one third of the world’s population is infected with
Introduction 6
B C
tuberculosis, while 1.6 million humans die every year (Dye et al., 1999). The first treatment of
tuberculosis was achieved using the antibiotic streptomycin. Another very effective drug is
isoniazid, which blocks the synthesis of mycolic acids leading to cell wall instabilities and
finally to death of the bacteria (Engbaek et al., 1973). But with using these drugs, more and
more resistant M. tuberculosis strains appeared (Ozturk et al., 2005; Chaoui et al., 2009). For
that reason, research on M. tuberculosis is still of major priority.
Fig. 2: M. tuberculosis. A. Scanning electron microscopy (de.academic.ru/dic.nsf/dewiki/986655). B. Ziehl-Neelsen staining (de.academic.ru/dic.nsf/dewiki/986644). C. X-ray photograph of infected lungs (http://valuestockphoto.com/downloads/38482-2/tuberculosis-screening-chest-xrayDSC_7427. jpg).
2.1.2 Mycobacterium smegmatis
As described in section 2.1.1, research on pathogenic mycobacteria plays a very important
role. Due to the fact that many of these bacteria are complicated to investigate in vitro (high
pathogenicity and slow growth; M. leprae e.g. shows no growth in vitro at all), certain model
organism are used. One very commonly known model organism for mycobacteria is
M. smegmatis (figure 3). This organism is characterized by its fast growth (generation time of
approximately three to four hours) and by its general non-pathogenicity. M. smegmatis is a
saprophytic living soil bacterium (Kamala et al., 1994). Nevertheless, it was first discovered
in 1884 by Lustgarten in syphilitic chancres and shortly after that it was also found in genital
secretions (see Wallace et al., 1988). So, after M. tuberculosis (Koch, 1882, see section
2.1.1), M. smegmatis was the second mycobacterium identified. It plays an important role in
research on anti-tuberculosis drugs (Wang and Marcotte, 2007) and also in identifying
virulence factors of M. tuberculosis. The gene Rv3810 (erp) e.g. was determined to be
specifically involved in virulence of M. tuberculosis, but after the genome sequence of
M. smegmatis with an Rv3810 homolog was identified, this gene turned out to be a common
mycobacterial housekeeping gene, which is still of great importance for mycobacterial
multiplication (Reyrat and Kahn, 2001).
Introduction 7
B C
In some rare cases, M. smegmatis was reported to be pathogenic itself. Richardson (1971)
showed clinical mastitis in sheep after infusion and Grooters et al. (1995) investigated
systemic granulomatous lesions in an immunocompromised dog. Talaat et al. (1999)
revealed the pathogenicity of M. smegmatis to goldfish. Human diseases caused by
M. smegmatis are barely reported so far, except one nontuberculous mycobacteriosis, a
chronic carnificating pneumonia caused by infiltration of the organism into bronchial tubes of
a man (Schreiber et al., 2001).
In this study, a modified M. smegmatis strain, namely SMR5, was used. SMR5 is a derivative
of M. smegmatis mc2 155, carrying a mutation in the rpsL gene, which makes it resistant to
streptomycin. The strain mc2 155, which has a very high transformation efficiency, was
generated as a cloning host for genes from virulent mycobacteria (Snapper et al., 1990).
Recapitulating this information, it can be determined that M. smegmatis is an organism of
increasing importance for medical and biological research, on the one hand because of its
own increasing pathogenic features, on the other hand because of its close relationship to
slow growing pathogenic mycobacteria. M. smegmatis is also used to investigate general
mycobacterial metabolic pathways, such as the assembling of the typical cell wall or carbon
and nitrogen metabolism (Ortalo-Magne et al., 1996; Faller et al., 2004; Pimentel-Schmitt et
al., 2007; Amon et al., 2008; Niederweis et al., 2010).
Fig. 3: M. smegmatis. A. Electron microscopy (University of Pittsburgh, Pennsylvania, USA). B. Typical mycelic colony morphology (ASM MicrobeLibrary.org, © MacDonald, Adams and Smith). C. Microscopy of GFP-expressing M. smegmatis cells (this study).
Introduction 8
2.2 Nitrogen metabolism and regulation
2.2.1 Uptake and assimilation of nitrogen sources
The focus of this study was set on nitrogen metabolism. Following carbon, nitrogen is a very
recurrent element in cells. Particularly microorganisms struggle in their natural habitat with
often varying environmental conditions. For that reason, they are able to utilize a multitude of
different nitrogen sources. The Gram-negative model organism Escherichia coli uses
different amino acids such as aspartate, glycine, glutamate or glutamine (Goux et al., 1995;
Newman et al., 2003a) and a variety of inorganic nitrogen sources. This is also well
investigated for Corynebacterium glutamicum, an actinomycete which is often used as a
model organism (Burkovski, 2005), whereas in M. smegmatis little is known about these
processes.
These three organisms as well as the majority of bacteria prefer ammonium as nitrogen
source (Leigh and Dodsworth, 2007). In solution, the protonated ammonium ion (NH4+) is in
equilibrium with uncharged ammonia (NH3). Ammonia is able to pass bacterial cell
membranes by diffusion, which happens under high ammonia/ammonium concentrations
outside the cell. When this concentration decreases, passive diffusion is no longer sufficient
to guarantee cell growth. Subsequently, bacterial ammonium transport systems are
synthesized. These transporters work with high affinity to ammonium and depend on
membrane potential (Walter, 2007; Walter et al., 2008). Inside the cell, ammonium is
assimilated under high concentrations by glutamate dehydrogenase (GDH), a low affinity
enzyme that catalyzes the reductive amination of 2-oxoglutarate to L-glutamate in an
NADPH-dependent reaction. At low ammonium concentrations, glutamine synthetase and
glutamate synthase (GS and GOGAT) are used. In a first reaction, ammonium is bound to
glutamate by GS, resulting in glutamine. This enzyme has a much higher substrate affinity
than GDH and dissipates one molecule ATP per reaction. Four different types of bacterial
glutamine synthetases are known so far: the common form GSI encoded by glnA, the second
form GSII encoded by glnII, which is found in Agrobacterium, Rhizobium or Streptomyces
strains, the third form GSIII encoded by glnN and found in Bacteriodes or Synechocystis
strains and a fourth form identified in Rhizobium strains and named GlnT (Merrick and
Edwards, 1995). GSI activity is additionally regulated by adenylylation (inactive form) or
deadenylylation (active form) by adenylyltransferase GlnE (van Heeswijk et al., 1993; Nolden
et al., 2001a). Subsequently, glutamine, together with 2-oxoglutarate, is converted in a
second, NADPH-dependent reaction to two molecules glutamate by GOGAT (for an
overview, see figure 4 and Merrick and Edwards, 1995).
Introduction 9
B. Nitrogen limitation
A. Nitrogen surplus
2-oxoglutarate + NH4+ + NADPH+H+ L-glutamate + NADP+GDH
L-glutamate + NH4+ + ATP L-glutamine + ADPGS
GOGATL-glutamine + 2-oxoglutarate + NADPH+H+ 2 L-glutamate + NADP+
Fig. 4: Assimilation of ammonium in bacteria. A. Assimilation by glutamate dehydrogenase (GDH) under nitrogen surplus. B. Assimilation by glutamine synthetase (GS) and glutamate synthase (GOGAT) preferentially under nitrogen limitation.
Although it is very energy consumptive, the GS/GOGAT-system is the preferred way of
ammonium assimilation under nitrogen limitation. While some organisms such as Bacillus
subtilis use only the GS/GOGAT-system for ammonium fixation (Belitsky and Sonenshein,
1998), GDH-mediated ammonium assimilation is sufficient for most bacteria under nitrogen
surplus. Under these conditions, some GS activity can also be detected. As described
before, synthesis and activity of GS and GOGAT demand a high amount of energy.
Consequently, these processes are strictly regulated on transcriptional, posttranscriptional
and even posttranslational level. These mechanisms depend on nitrogen availability and are
summarized as “nitrogen control”.
2.2.2 Nitrogen control in Escherichia coli
Mechanisms of nitrogen control are best investigated in Gram-negative enteric bacteria, such
as E. coli or Salmonella enterica serovar Typhimurium (for an overview see Merrick and
Edwards, 1995; Leigh and Dodsworth, 2007). The four most important components of the
global nitrogen regulatory system of E. coli are uridylyltransferase GlnD, PII-type signal
transduction protein GlnB, histidine kinase NtrB and its corresponding response regulator
NtrC. Indicator of nitrogen availability is the intracellular concentration of glutamine and
2-oxoglutarate. Under nitrogen surplus, the glutamine level is high compared to
2-oxoglutarate, whereas this ratio changes under nitrogen limitation. This ratio determines,
whether the PII protein is present in the cell in uridylylated or deuridylylated form (Engleman
and Francis, 1978; Jiang et al., 1998). Responsible for (de)uridylylation of PII is
Introduction 10
uridylyltransferase (UTase) GlnD. Under nitrogen surplus, UTase binds glutamine, which is
accumulated in the cell. This leads to a conformational change of the protein allowing
deuridylylation of PII. The PII protein itself is able to bind ATP and 2-oxoglutarate. Under low
nitrogen concentrations, binding of 2-oxoglutarate induces also a conformational change
resulting in uridylylation of PII (Kamberov et al., 1995; Javelle et al., 2004). UMP is attached
by UTase to the tyrosine 51 residue of each of the three subunits of the PII protein (Son and
Rhee, 1987; Ninfa and Atkinson, 2000). Consequently, the PII protein responds directly to
the intracellular concentration of 2-oxoglutarate and indirectly to the intracellular
concentration of glutamine. PII modulates activity of the cytoplasmic sensor histidine kinase
NtrB. This kinase is part of the two-component system NtrB/NtrC controlling nitrogen-
dependent transcriptional response (Merrick and Edwards, 1995). Under nitrogen limitation,
PII-UMP is not able to interact with NtrB, which leads to autophosphorylation of the kinase at
histidine 139 residue. In a subsequent reaction, NtrB phosphorylates its corresponding
response regulator NtrC at a conserved aspartate 45 residue (Keener and Kustu, 1988). In
its unmodified form, the PII protein binds to NtrB leading to dephosphorylation and
inactivation of NtrC under nitrogen surplus. NtrC contains a typical helix-turn-helix motif at its
C-terminal end and is able to bind DNA even without activation. Nevertheless, it is able to
activate transcription of its target genes exclusively in its phosphorylated form. It is supposed
that only phosphorylated NtrC proteins are capable of forming oligomers, and only NtrC
complexes of at least two dimers can activate transcription by interacting with RNA
polymerase (Merrick and Edwards, 1995).
The genes encoding NtrB and NtrC are located in an operon named glnAntrBC, in which
glnA encodes GSI. Transcription of these genes is strictly regulated by the usage of different
promoters. There are two promoters upstream of glnA and under nitrogen surplus,
transcription starts from glnAp1 leading to a termination structure of the RNA and to the
expression of ntrBC from its own promoter ntrBCp. Under low nitrogen concentrations, the
transcriptional regulator NtrC is activated as described above and inactivates transcription
from glnAp1 by binding. This leads to the expression of glnA and simultaneously ntrBC from
glnAp2. This mechanism guarantees the cell a low level of GSI, NtrB and NtrC under
nitrogen surplus, as well as a higher amount of these proteins under nitrogen limitation
(Merrick and Edwards, 1995). Besides others, genes regulated by NtrC are glnAntrBC,
genes encoding transport systems for arginine, glutamine and histidine and genes involved
in nitrate and nitrite uptake and assimilation (Merrick and Edwards, 1995).
Introduction 11
Furthermore, PII has great influence on an adenylyltransferase (ATase, encoded by glnE;
Merrick and Edwards, 1995), which regulates GSI activity by (de)adenylylation at tyrosine
394 residue. Under nitrogen surplus, PII activates adenylylation of GSI, which is as a
consequence inhibited in its ammonium assimilating function. Nitrogen limitation leads to
activation of the deadenylylating function of ATase by PII-UMP and thus, GSI is active in its
unmodified state (Ninfa and Jiang, 2005).
Additionally, a second PII-type signal transduction protein, namely GlnK, exists in E. coli. The
corresponding gene glnK is located in an operon with amtB, coding for an ammonium
transporter. This system is important for regulation of nitrogen response at low ammonium
concentrations. As described above, under these conditions the response regulator NtrC
activates transcription of its target genes, which include amtB and glnK. The GlnK protein is
directly uridylylated and consequently not able to bind AmtB. At ammonium concentrations
higher than 50 µM, GlnK is deuridylylated and blocks AmtB activity by binding to it (Javelle et
al., 2004; Forchhammer, 2008).
2.2.3 Nitrogen control in actinomycetes
For many years, the well investigated system of nitrogen control in E. coli and related enteric
bacteria (section 2.2.2) was considered as the paradigm of nitrogen regulation in bacteria.
More recent studies of nitrogen control in other, especially Gram-positive bacteria revealed a
great variety of regulation processes, while the relevant enzymes (GDH, GS, GOGAT,
ATase, UTase and PII) are highly conserved. Concerning the order actinomycetes,
regulation of nitrogen metabolism is best understood in C. glutamicum (Burkovski, 2007;
Hänßler and Burkovski, 2008) and Streptomyces coelicolor (Reuther and Wohlleben, 2007),
while little is known about these mechanisms in mycobacteria (Amon et al., 2010).
C. glutamicum is a non-sporulating, aerobic and immobile member of the order
Actinomycetales. This organism, named according to its characteristic club shape (Greek:
koryne), has become extremely relevant for industry and research. This is due to the fact that
modified strains are used for extensive biotechnological production of amino acids such as
L-glutamate, L-lysine, L-serine and L-threonine (Leuchtenberger et al., 2005). Furthermore,
C. glutamicum undergoes extensive research as a model organism for related pathogenic
species such as Corynebacterium diphtheriae or Corynebacterium jeikeium (Coyle and
Lipsky, 1990; Hadfield et al., 2000). Compared to E. coli, nitrogen control in C. glutamicum
includes adenylyltransferase GlnD, the only PII-type signal transduction protein GlnK (Nolden
et al., 2001b) and the transcriptional regulator AmtR (Jakoby et al., 2000). Whereas in E. coli
glutamine is described as the main nitrogen indicator and GlnD as the sensor (Merrick and
Introduction 12
Edwards, 1995), this could not be revealed for C. glutamicum so far (Rehm et al., 2010).
Nevertheless, nitrogen-dependent transcriptional response is very well characterized. Under
nitrogen surplus, the bifunctional ATase GlnD is responsible for deadenylylation of GlnK; in
contrast, under nitrogen limitation it adenylylates the trimeric PII protein by attaching AMP to
the tyrosine 51 residue of each of the three subunits (Strösser et al., 2004). Only modified
GlnK is able to interact with AmtR (Beckers et al., 2005). Consequently, the transcriptional
regulator is not affected under nitrogen surplus and represses transcription of its target
genes. Furthermore, unmodified GlnK is recruited to the membrane where it interacts with
the ammonium transporter AmtB and is eventually degraded (Strösser et al., 2004). Under
nitrogen limitation, GlnK-AMP binds AmtR leading to a conformational change and finally to
desertion of the repressor from its target DNA. This results in derepression of at least 40
nitrogen-dependent genes, which encode transport systems for ammonium (amtA, Jakoby et
al., 2000; amtB, Meier-Wagner et al., 2001), glutamate (gluABCD, Kronemeyer et al., 1995),
urea (urtABCDE, Beckers et al., 2004), creatinine (crnT, Bendt et al., 2004) and others, as
well as ammonium assimilation systems (gdh for GDH, Beckers et al., 2005; glnA for GSI,
Nolden et al., 2001a; gltBD for GOGAT, Beckers et al., 2001; ureABCEFGD for urease,
Beckers et al., 2004; codA for creatinine deaminase, Bendt et al., 2004; and others). Even
the transcription of glnK and glnD is regulated by AmtR, which is surprising, as they encode
the two signal transduction proteins involved in AmtR activation or deactivation. These two
genes are located in an operon with amtB. Additionally, some genes of unknown function
(Beckers et al., 2005) and the vanABK operon, which is regulated indirectly (Merkens et al.,
2005), belong to the AmtR regulon.
Like in E. coli, GSI activity is additionally regulated by post-translational modification, i.e. by
(de)adenylylation via GlnE. This enzyme seems to work independently from the regulatory
system described above to guarantee fast adaption to changing glutamine concentrations
(Burkovski, 2003). At high nitrogen concentrations, ATase GlnE adenylylates GSI at tyrosine
405 residue leading to inactivation of the enzyme. In case of nitrogen limitation, GlnE again
deadenylylates GSI, which results in new glutamine synthetase activity (Nolden et al.,
2001a). The signal activating or deactivating GlnE could not be detected so far.
C. glutamicum owns a second GS encoded by glnA2, which is not regulated by
(de)adenylylation and which is of so far unknown function (Nolden et al., 2001a).
Although related to C. glutamicum, a very different type of nitrogen regulation is reported in
S. coelicolor. This non-motile soil bacterium is of great relevance for research, particularly
because of its morphological differentiation. S. coelicolor grows vegetatively forming a
filamentous mycelium. Under nutrient limitation, aerial branches are generated, followed by
hyphae differentiation and formation of spores (Chater, 2001). During these steps, the
organism switches from primary to secondary metabolism (Reuther and Wohlleben, 2007),
Introduction 13
resulting in the production of various secondary metabolites such as antibiotics (Newman et
al., 2003b; Bérdy, 2005). The mechanism of nitrogen response in this organism is not as well
understood as in E. coli or C. glutamicum. Like in C. glutamicum, a single PII-type protein,
encoded by glnK, was identified, which is deadenylylated under nitrogen surplus and
adenylylated at tyrosine 51 residue under nitrogen limitation by ATase GlnD (Reuther and
Wohlleben, 2007). If the modified GlnK protein is involved in further signal transduction has
not been proven yet. There is also evidence for adenylylation of GSI at tyrosine 397 residue
leading to inactivation under nitrogen surplus and deadenylylation leading to activation of this
ammonium assembling enzyme under nitrogen limitation by ATase GlnE, but the GlnK/GlnD
signal transduction system seems not to be involved in this mechanism either (Fink et al.,
1999). The component signaling GlnE to (de)adenylylate GSI, as well as the signal inducing
expression of nitrogen-related target genes has not been identified yet. Nevertheless, GlnR
is known as the global regulator of nitrogen metabolism in S. coelicolor. This protein was first
described by Wray and Fisher (1993) as the regulator of glnA gene expression. Furthermore,
GlnR directly regulates the expression of the amtB-glnK-glnD operon, glnII encoding GSII,
gdhA encoding GDH, nirBD encoding nitrite reductase, ureA encoding a urea assimilation
system and others (Fink et al., 2002; Tiffert et al., 2008). Unlike C. glutamicum AmtR (see
above) but as E. coli NtrC (see section 2.2.2), GlnR works in a bifunctional manner, which
means that it activates transcription of e.g. glnA and nirB, whereas it represses transcription
of e.g. gdhA or ureA under nitrogen limitation (Tiffert et al., 2008). Tiffert et al. (2011) suggest
that the role of GlnR might not be restricted to nitrogen metabolism; putative target genes
belonging to carbon metabolism, biosynthesis of antibiotics and amino acids or stress
response were also identified. No influence of GlnR to its encoding gene, glnR, was seen,
although it is repressed in the presence of ammonium, whereas the expression level rises
under nitrogen limitation (Fink et al., 2002).
In S. coelicolor, five genes encoding GS or GS-like proteins exist, namely glnA, glnII, glnA2,
glnA3 and glnA4 (Reuther and Wohlleben, 2007). glnA encodes GSI, the housekeeping
glutamine synthetase in this organism, which is constantly expressed in all growth phases,
whereas glnII encodes GSII, a primary typical eukaryotic enzyme, whose transcription is
increased during mycelia differentiation. No further, posttranslational regulation of GSII
occurs. The remaining three glnA genes seem not to be involved in nitrogen assimilation and
glutamine synthesis (Rexer et al., 2006). GlnR binds to upstream promoter regions of glnA
and glnII (Tiffert et al., 2008). Furthermore, glnRII, encoding a second regulatory protein, was
identified located three ORFs downstream of glnII. The resulting GlnRII protein shows 31 %
sequence homology to GlnR and binds equally to upstream sequences of glnA, glnII and
amtB-glnK-glnD (Fink et al., 2002). However, it is not a functional homolog of GlnR and its
particular role still needs to be investigated (Reuther and Wohlleben, 2007). Homologs of
Introduction 14
glnRII exist in various Streptomyces strains, but not in corynebacteria or mycobacteria. On
the contrary, homologs of glnR are widely spread among the actinomycetes (see figure 5).
They are highly conserved and show 60-80 % sequence identity. The conclusion can be
drawn that most actinomycetes (with the exception of corynebacteria) have evolved a
specific regulatory network depending on GlnR to respond to changing nitrogen conditions,
more or less unattached to their different lifestyles.
Compared to other members of the actinomycetes, nitrogen metabolism in mycobacteria is
barely investigated. For a long time, focus of research was glutamine synthetase I encoded
by glnA1, which is essential for growth and pathogenicity of M. tuberculosis (Tullius et al.,
2003; Harth et al., 2005) and M. bovis (Chandra et al., 2010). It is suspected that GSI is
involved in the formation of the typical poly-L-glutamate-glutamine cell wall structure and thus
a very interesting drug target (Harth et al., 2000). Furthermore, the essential role of glnE was
extensively studied in M. tuberculosis. As in other bacteria, GlnE is responsible for
posttranslational modification and activation of GSI by (de)adenylylation (Parish and Stoker,
2000; Carroll et al., 2008).
At the beginning of this study, little was known about nitrogen metabolism in M. smegmatis.
A genome-wide analysis of M. smegmatis and related species revealed the existence of
various popular components of nitrogen metabolism such as amtB-glnK-glnD, glnE and
gltBD (Amon et al., 2009). Some of them, including M. smegmatis, showed genes encoding
nitrate, nitrite and urea transporters and assimilation systems. Moreover, only in the genome
of M. smegmatis additional ammonium transporters, several copies of glutamate synthase-
encoding gens and several genes encoding different types of GDH and GS were identified.
Recent studies revealed the changing activities of glutamine synthetase, aminating and
deaminating GDH in response to changing ammonium concentrations in the cells (Harper et
al., 2010). Obviously, M. smegmatis possesses a variety of different genes involved in
nitrogen metabolism rather typical for other bacteria such as Agrobacterium, Burkholderia or
Pseudomonas species (Amon et al., 2009). Most interestingly, genes encoding two different
major regulatory proteins of nitrogen metabolism in actinomycetes were identified in
M. smegmatis (for an overview see figure 5). A protein showing 42 % sequence homology to
C. glutamicum AmtR (see above) was recognized, as well as a homolog of S. coelicolor
GlnR (see above) with 60 % identity (Amon et al., 2009). The study also exhibited that
M. smegmatis GlnR is closer related to homologs in Nocardia farcinia or Rhodococcus sp.
than to homologs in other mycobacteria. The assumption that GlnR is the major regulator of
nitrogen metabolism and an activator of transcription of its target genes in M. smegmatis was
verified in first experiments with a glnR deletion strain. This strain was no longer able to grow
under addition of MSX, a glutamate analog that blocks GS activity (Berlicki, 2008). Moreover,
the glnR deletion strain did not show enhanced transcripts of glnA, amtB and amt1 under
Introduction 15
S. coelicolor
Bifidobacterium sp.
T. fusca
P. acnes
A. naeslundii
C. glutamicum
C. efficiens
C. diphtheriae
M. smegmatis
M. tuberculosis
M. bovisM. avium
N. farcinica
Rhodococcus sp.
A. mediterranei
S. avermitilis
C. pseudogenitalium
C. accolens
S. griseus
S. roseum
Frankia sp.
C. michiganensis
M. abscessus
S. arenicolaR. salmoninarum
…
…
…
GlnRAmtR
nitrogen limitation (Amon et al., 2008). Additionally, a conserved sequence upstream of these
genes was identified, suggesting an influence of GlnR on the transcription of its target genes
by binding and thus activating RNA polymerase (Amon et al., 2009). Nothing is known about
signal transduction and activation of the regulator protein so far, even though GlnR was
associated by sequence analyses to the OmpR-family of transcriptional regulators (Amon et
al., 2008). The OmpR/EnvZ two-component system is very well investigated in E. coli,
regulating osmolarity response. Depending on changing osmolarity, membrane-bound
sensor histidine kinase EnvZ is autophosphorylated and thus able to (de)phosphorylate
OmpR at a specific aspartate residue (Mattison et al., 2002). OmpR is responsible for
osmolarity-dependent gene expression. This happens by binding of the regulator to specific
sequences in the promoter regions of its target genes. Phosphorylated OmpR-P binds to its
target DNA in a “discontinuous, galloping manner” (Yoshida et al., 2006). OmpR-like
structures such as an N-terminal phosphorylation domain with highly conserved aspartate
residues and a C-terminal DNA binding domain were identified for GlnR in M. smegmatis
(Amon et al., 2008). A corresponding sensor histidine kinase could not be detected so far, as
its gene is not located close to glnR, which is actually typical for members of bacterial two-
component systems.
Fig. 5: Distribution of GlnR and AmtR as putative transcriptional regulators for nitrogen metabolism in actinomycetes. Figure according to Amon (2010). Experimentally verified species are highlighted bold. References for these are: Jakoby et al. (2000); Fink et al. (2002); Nolden et al. (2002); Yu et al. (2006); Amon et al. (2008). Full species names are: Actinomyces naeslundii, Amycolatopsis mediterranei, Bifidobacterium longum, Clavibacter michiganensis ssp. michiganensis, Corynebacterium accolens, Corynebacterium diphtheriae, Corynebacterium efficiens, Corynebacterium glutamicum, Corynebacterium pseudogenitalium, Frankia alni, Mycobacterium abscessus, Mycobacterium avium, Mycobacterium bovis, Mycobacterium smegmatis, Mycobacterium tuberculosis, Nocardia farcinica, Propionibacterium acnes, Renibacterium salmoninarum, Rhodococcus erythropolis, Rhodococcus jostii, Rhodococcus opacus, Salinispora arenicola, Streptomyces avermitilis, Streptomyces coelicolor, Streptomyces griseus, Streptosporangium roseum and Thermobifida fusca.
Introduction 16
2.3 Aims of this study
Nitrogen metabolism in mycobacteria is not well investigated, although it is a fundamental
system of these often pathogenic organisms. This study obtains a detailed characterization
of nitrogen regulation in the facultative non-pathogenic species M. smegmatis, while the
regulatory protein GlnR is the focus of attention.
Intensive studies of the genome of M. smegmatis revealed uptake and assimilation systems
for various nitrogen sources (Amon et al., 2009). According to that, it is a first objective of this
study to identify different substrates that can be used as single nitrogen source and to
determine the involvement of GlnR in the corresponding processes. As not many procedures
are established so far for investigating nitrogen metabolism and control in mycobacteria, the
generation of a functional in vivo reporter system to measure nitrogen- or GlnR-dependent
promoter activities of different target genes is another important part of this study.
As the global regulator GlnR is the center of attention, this work concentrates on the one
hand on the protein itself, including protein purification, the generation of a GlnR-specific
antibody and DNA binding studies. Binding of purified GlnR protein to promoter sequences
upstream of its target genes needs to be investigated in detail, so that eventually accurate
binding sequences can be determined. With these sequences, the “galloping” DNA binding
theory (Yoshida et al., 2006) can either be proven or disproved for GlnR. Moreover, an exact
binding sequence allows the search for further GlnR target genes in the genome of
M. smegmatis. On the other hand, global analysis methods are used to enlarge the GnR
regulon.
According to sequence homologies, GlnR is associated to the OmpR-family of transcriptional
regulators, which feature conserved aspartate residues as phosphorylation sites and a
corresponding sensor histidine kinase (Amon et al., 2008). Thus, another aim of this study is
to identify the kinase and to verify phosphorylation of GlnR. While a bioinformatic approach
searching for putative kinases was already performed (Amon, 2010), no data are available in
respect of the phosphorylation residues.
As the main objective of this study is a detailed characterization of GlnR, the global
regulatory protein of nitrogen metabolism in M. smegmatis, this work might also contribute to
a better understanding of nitrogen metabolism in mycobacteria in general, as the system
investigated for M. smegmatis might be transferred to the related pathogen M. tuberculosis.
To investigate this, first tests are carried out in this study using M. tuberculosis GlnR.
Materials and methods 17
3 Materials and methods
3.1 Bacterial strains and plasmids
E. coli, C. glutamicum and M. smegmatis strains used in this study are listed in table 1. Table
2 shows all plasmids.
Tab. 1: Bacterial strains with characteristics and references. StrR: resistance to streptomycin.
CamR: resistance to chloramphenicol.
Strain Genotype, phenotype Reference
E. coli
BL21 F- ompT gal [dcm] [Ion] hsdSB (rB
- mB
-)
Studier et al., 1990
DH5mcr endA1 supE44 thi-1 - recA1 gyrA96 relA1 deoR
Δ(lacZYA-argF) U169 80ΔlacZ ΔM15mcrA Δ(mmr
hsdRMS mcrBC)
Grant et al., 1990
Rosetta2 (DE3) BL21 with plasmid pRARE; lacYZ-deletion, no Lon and
OmpT proteases, CamR
Novagen, Darmstadt
C. glutamicum
ATCC 13032 wild type
Abe et al., 1967
M. smegmatis mc2
155
SMR5 rpsL-mutant of M. smegmatis mc2 155, high
transformation efficiency, StrR
Sambrook et al., 1989
Sander et al., 1995
MH1 SMR5 with deletion of glnR
M. Höller,
personal communication
Δmsmeg_1918 SMR5 with deletion of msmeg_1918
this study
Δmsmeg_1918 kin SMR5 with deletion of msmeg_1918 kinase domain
this study
Δmsmeg_5241 SMR5 with deletion of msmeg_5241
this study
Δmsmeg_1918
Δmsmeg_5241
SMR5 with deletion of msmeg_1918 and msmeg_5241 this study
Imsmeg_0426 SMR5 with insertion of pML814 into msmeg_0426
this study
Imsmeg_2106 SMR5 with insertion of pML814 into msmeg_2106
this study
InarB SMR5 with insertion of pML814 into msmeg_2837
(narB)
this study
Imsmeg_4989 SMR5 with insertion of pML814 into msmeg_4989
this study
Materials and methods 18
InarG SMR5 with insertion of pML814 into msmeg_5140
(narG)
this study
Imsmeg_5143 SMR5 with insertion of pML814 into msmeg_5143
this study
ML371
M. smegmatis mc2 155 with plasmid pSJ27 (bxb1 site
at the 3’-end of groEL1)
Kim et al., 2003
DSM 43756 wild type DSMZ; Lehmann and
Neumann, 1899
Tab. 2: Plasmids with characteristics and references. AmpR: resistance to ampicillin.
Plasmid Characteristics Reference
pASK-IBA5plus F1-IG, AmpR, tet repressor, ori, tet
P/O,
Strep-tag® II, polylinker, tIpp
IBA BioTAGnology,
Göttingen
pASK-IBA5+1918 pASK-IBA5plus with msmeg_1918 for
overexpression of Msmeg_1918 with
N-terminal Strep-tag II
Hiery, 2009
pASK-IBA5+5241 pASK-IBA5plus with msmeg_5241 for
overexpression of Msmeg_5241 with
N-terminal Strep-tag II
Hiery, 2009
pASK-IBA5+glnR pASK-IBA5plus with glnR for overexpression
of GlnR with N-terminal Strep-tag II
Hiery, 2009
pASK-IBA5+glnRAsp43Ala pASK-IBA5+glnR with point mutation to
Asp43Ala
this study
pASK-IBA5+glnRAsp43Asn pASK-IBA5+glnR with point mutation to
Asp43Asn
this study
pASK-IBA5+glnRAsp43Glu pASK-IBA5+glnR with point mutation to
Asp43Glu
this study
pASK-IBA5+glnRAsp48Ala pASK-IBA5+glnR with point mutation to
Asp48Ala
this study
pASK-IBA5+glnRAsp48Asn pASK-IBA5+glnR with point mutation to
Asp48Asn
this study
pASK-IBA5+glnRAsp48Glu pASK-IBA5+glnR with point mutation to
Asp48Glu
this study
pASK-IBA5+glnRAla45Ser pASK-IBA5+glnR with point mutation to
Ala45Ser
this study
pASK-IBA5+glnRAsp52Ala pASK-IBA5+glnR with point mutation to
Asp52Ala
this study
pASK-IBA5+glnRAsp52Asn pASK-IBA5+glnR with point mutation to
Asp52Asn
this study
pASK-IBA5+glnRAsp52Glu pASK-IBA5+glnR with point mutation to
Asp52Glu
this study
pASK-IBA5+glnRAsp43/48/52Ala pASK-IBA5+glnR with three point mutations
to Asp43/48/52Ala
this study
Materials and methods 19
pASK-IBA5+senX3* pASK-IBA5plus with truncated senX3 for
overexpression of SenX3* without N-terminal
transmembran domain
this study
pMal-c2 ptac, AmpR, pBR322 ori, M13 ori, malE, lacI
q,
lacZ, E. coli vector for protein purification
Guan et al., 1987
pMal-c2-1918 pMal-c2 with msmeg_1918 for purification of
an MBP-Msmeg_1918 fusion protein
this study
pMal-c2-5241 pMal-c2 with msmeg_5241 for purification of
an MBP-Msmeg_5241 fusion protein
this study
pMal-c2-glnR pMal-c2 with glnR for purification of an MBP-
GlnR fusion protein
this study
pMal-c2glnR M.tub. pMal-c2 with Rv0818 for purification of an
MBP-GlnR (M. tuberculosis) fusion protein
this study
pML814 COLE1 ori, FRT-hph-FRT, rpsL, AmpR M. Niederweis,
personal communication
pML814-D1918 pML814 with 1000 bp fragments upstream
and downstream of msmeg_1918, for
deletion mutagenesis
Bräu, 2008
pML814-D1918kin pML814 with 1000 bp fragments upstream
and downstream of msmeg_1918 kinase
domain, for deletion mutagenesis
this study
pML814-D5241 pML814 with 1000 bp fragments upstream
and downstream of msmeg_5241, for
deletion mutagenesis
this study
pML814-I0426 pML814 with 500 bp fragment of
msmeg_0426, for insertion mutagenesis
this study
pML814-I2106 pML814 with 500 bp fragment of
msmeg_2106, for insertion mutagenesis
this study
pML814-I2837 (narB) pML814 with 500 bp fragment of
msmeg_2837, for insertion mutagenesis
this study
pML814-I4989 pML814 with 500 bp fragment of
msmeg_4989, for insertion mutagenesis
this study
pML814-I5140 (narG) pML814 with 500 bp fragment of
msmeg_5140, for insertion mutagenesis
this study
pML814-I5143 pML814 with 500 bp fragment of
msmeg_5143, for insertion mutagenesis
this study
pMN234 aph, rpsL, pimyc-flpe, pBR322 ori, PAL5000
ori
M. Niederweis,
personal communication
pMN016 COLE1 ori, ori myc, hph, psmyc-mspA,
pAL5000
M. Niederweis,
personal communication
pMN016control pMN016, mspA gene removed
Bräu, 2008
pMN016glnR pMN016control with psmyc-glnR
(M. smegmatis)
Bräu, 2008
Materials and methods 20
pMN016glnR M. tub. pMN016control with psmyc-glnR
(M. tuberculosis)
Bräu, 2008
pMN016glnRAsp43Ala pMN016glnR with point mutation to
Asp43Ala
this study
pMN016glnRAsp43Asn pMN016glnR with point mutation to
Asp43Asn
this study
pMN016glnRAsp43Glu pMN016glnR with point mutation to
Asp43Glu
this study
pMN016glnRAsp48Ala pMN016glnR with point mutation to
Asp48Ala
this study
pMN016glnRAsp48Asn pMN016glnR with point mutation to
Asp48Asn
this study
pMN016glnRAsp48Glu pMN016glnR with point mutation to
Asp48Glu
this study
pMN016glnRAla45Ser pMN016glnR with point mutation to
Ala45Ser
this study
pMN016glnRAsp52Ala pMN016glnR with point mutation to
Asp52Ala
this study
pMN016glnRAsp52Asn pMN016glnR with point mutation to
Asp52Asn
this study
pMN016glnRAsp52Glu pMN016glnR with point mutation to
Asp52Glu
this study
pMN016glnRAsp43/48/52Ala pMN016glnR with three point mutations to
Asp43/48/52Ala
this study
pMN016glnR-his pMN016glnR with C-terminal his-tag (6 x His)
this study
pMN016his-glnR pMN016glnR with N-terminal his-tag (6 x His)
this study
pMN-gfpuv pMN016control with gfpuv
Y. Lu,
personal communication
pMN016-gfpuv pMN016, mspA removed, with psmyc-gfpuv
Y. Lu,
personal communication
pMN-amt1p-gfpuv pMN-gfpuv with 500 bp fragment upstream of
amt1
this study
pMN-amtAp-gfpuv pMN-gfpuv with 500 bp fragment upstream of
amtA
this study
pMN-amtBp-gfpuv pMN-gfpuv with 500 bp fragment upstream of
amtB
this study
pMN-gdhp-gfpuv pMN-gfpuv with 500 bp fragment upstream of
gdh
this study
pMN-glnAp-gfpuv pMN-gfpuv with 500 bp fragment upstream of
glnA
this study
pMN-glnRp-gfpuv pMN-gfpuv with 500 bp fragment upstream of
glnR
this study
Materials and methods 21
pMN-lacZ pMN016control with lacZ
this study
pMN016-lacZ pMN-lacZ with psmyc-lacZ
this study
pMN-amtAp-lacZ pMN-lacZ with 500 bp fragment upstream of
amtA
this study
pMN-amtBp-lacZ pMN-lacZ with 500 bp fragment upstream of
amtB
this study
pMN-amtRp-lacZ pMN-lacZ with 500 bp fragment upstream of
amtR
this study
pMN-gdhp-lacZ pMN-lacZ with 500 bp fragment upstream of
gdh
this study
pMN-glnAp-lacZ pMN-lacZ with 500 bp fragment upstream of
glnA
this study
pMN-glnRp-lacZ pMN-lacZ with 500 bp fragment upstream of
glnR
this study
pQE70 ptac, AmpR, ori COLE1, 6 x His, E. coli
vector for protein purification
Qiagen, Hilden
pQE70-glnR pQE70 with glnR, for expression of a GlnR-
6 x His fusion protein
this study
pUC19-his-glnR
pUC19 (AmpR, lacZα) with his-tag and glnR,
for expression of a 6 x His-GlnR fusion
protein
M. Höller,
personal communication
pWH948 COLE1, AmpR, lacZ, galK
J. Bürger,
personal communication
3.2 Cultivation of bacteria
3.2.1 Culture media for E. coli, C. glutamicum and M. smegmatis
Generally, LB (Luria-Bertani) medium (table 4) was used for growth of E. coli. For production
of agar plates, 15 g/l Bacto-Agar (Oxoid, Heidelberg) were added. C. glutamicum was
cultivated in BHI and CgC medium (Keilhauer et al., 1993).
Middlebrook 7H9 Broth (Becton/Dickinson, USA) was used as defined minimal medium for
M. smegmatis. For production of 7H10 agar plates, 15 g/l Bacto-Agar (Oxoid, Heidelberg)
were added. Cells were incubated in 7H9-N medium to cause nitrogen starvation. SOC
medium was used to cultivate cells after electroporation. To induce phosphate starvation,
cells were transferred from ST to ST-P medium (according to Gebhard et al., 2006). All
media used in this study are listed in table 3.
Materials and methods 22
Tab. 3: Media used for cultivation of E. coli, C. glutamicum and M. smegmatis strains.
Medium
Ingredients (per l)
LB (Luria-Bertani)
10 g tryptone, 5 g yeast extract, 10 g sodium chloride. Sterilization by autoclavation at 121°C for 20 minutes.
BHI
37 g Brain Heart Infusion (Difco, Detroit, USA and Oxoid, Heidelberg). Sterilization by autoclavation at 121°C for 20 minutes.
CgC
42 g MOPS, 20 g (NH4)2SO4, 5 g urea, 0.5 g KH2PO4, 0.5 g K2HPO4, pH (NaOH) 7.0. After autoclavation addition of: 10 ml 100 mM CaCl2, 10 ml 1 M MgSO4, 200 µg biotin, 1 ml trace element solution, 80 ml 50 % (w/v) glucose.
7H9
0.5 g ammonium sulfate, 0.5 g L-glutamic acid, 0.1 g sodium citrate, 1 mg pyridoxine, 0.5 mg biotin, 2.5 g disodium phosphate, 1 g monopotassium phosphate, 0.04 g ferric ammonium citrate, 0.05 g magnesium sulfate, 0.5 mg calcium chloride, 1 mg zinc sulfate, 1 mg copper sulfate, 4 ml 50 % (v/v) glycerin, pH 6.6. After autoclavation at 121°C for 20 minutes 2.5 ml 20 % (v/v) Tween80 were added.
7H9-N
Composition as 7H9 medium, absence of nitrogen sources ammonium sulfate, L-glutamic acid and ferric ammonium citrate.
SOC
20 g tryptone, 5 g yeast extract, 0.5 g sodium chloride, 2.5 ml 1 M potassium chloride, 10 ml 1 M magnesium chloride, 10 ml 1 M magnesium sulfate, 1.8 ml 20 % (w/v) glucose. Sterilization by filtration.
ST
0.5 g magnesium sulfate, 2 g citric acid, 1 g L-asparagine, 0.3 g potassium chloride, 2 ml 50 % (v/v) glycerin, 320 µl 0.5 M ferric chloride, 1 ml 100 mM ammonium chloride, 9.13 ml 3 M dipotassium phosphate. After sterilization by autoclavation at 121°C for 20 minutes 2.5 ml 20 % (v/v) Tween80 were added.
ST-P
Composition as ST medium, absence of phosphate source dipotassium phosphate.
Trace element solution
28.5 g FeSO4 x 7H2O, 16.5 g MnSO4 x H2O, 6.4 g ZnSO4 x 7H2O, 764 mg CuSO4 x 5H2O, 128 mg CoCl2 x 6H2O, 44 mg NiCl2 x 6H2O, 64 mg Na2MoO4 x 2H2O, 48 mg H3BO3, 50 mg SrCl2, 50 mg BaCl2 x 2H2O, 28 mg KAl(SO4)2 x 12H2O, pH (H2SO4) 1.
3.2.2 Antibiotics
For selection of resistant bacteria, antibiotics were added to the media as shown in table 4.
Tab. 4: Antibiotics used to select resistant bacteria.
Antibiotic Final concentration E. coli Final concentration M. smegmatis
Ampicillin 100 µg/ml -
Chloramphenicol 25 µg/ml -
Hygromycin B 200 µg/ml 50 µg/ml
Kanamycin 60 µg/ml 25 µg/ml
Streptomycin - 400 µg/ml
Materials and methods 23
3.2.3 Growth conditions
All E. coli and M. smegmatis strains were cultivated at 37°C and 125 rpm in a rotary shaker
(SM30, Edmund Bühler GmbH, Tübingen), while baffled flasks were used to provide
abundant agitation. C. glutamicum was treated equally at 30°C. Growth was observed by
measuring the optical density at a wavelength of 600 nm (oD600) in plastic cuvettes (bio one,
Greiner, Essen). For this purpose, the photometer Ultraspec 2100 pro (Amersham
Biosciences, USA) was used.
For isolation of plasmid DNA (section 3.3.1.1), E. coli cells were cultivated overnight in 4 ml
LB medium with an adequate antibiotic. E. coli used for preparation of chemically competent
cells (section 3.4.1) were treated equally. For protein purification from E. coli, 800 ml LB
medium with an adequate antibiotic were inoculated to an oD600 of 0.1. For growing cells with
an MBP-tagged protein, 2 % glucose was added to the medium. At an oD600 of 0.4-0.6,
overexpression of the protein of interest was induced by adding either 1 mM IPTG or 1 µg/ml
doxycycline. Afterwards cells were further incubated for four hours at 37°C (with doxycycline
in the dark) and treated as described in section 3.3.3.2.
For cultivation of M. smegmatis, the media were inoculated following a standard scheme to
assure growth of the clotting cells. First, 1 ml 7H9 medium was inoculated in a reaction tube
and vortexed intensely. After that, the cells were incubated for five minutes at 37°C under
strong agitation and then used to inoculate 20 ml 7H9 medium as overnight culture. After
growth of at least 12 hours, fresh 7H9 medium was inoculated to an oD600 of 0.3. The oD600
was measured every two hours. In order to cause nitrogen starvation, cultures that reached
exponential growth phase (approximately oD600 of 0.8) were centrifuged for 10 minutes at
4,000 x g and 4°C, resuspended and incubated in 7H9-N medium for 30 minutes. For
preparation of total RNA or enzyme activity, fluorescence and β-galactosidase
measurements, cells were also harvested by centrifugation (10 min, 4,000 x g, 4°C) and
further treated as described in sections 3.3.2.1 and 3.4.7-10. To generate growth curves, the
oD600 was measured every two, later every four hours. For preparation of chromosomal DNA,
cells were grown in 100 ml 7H9 medium overnight. For preparation of total cell extract, 500
ml 7H9 medium were inoculated to an oD600 of 0.3 and cells were grown until exponential
growth phase. All strains used in this study were stored as permanent cultures in Roti®-Store
tubes (Roth, Karlsruhe) at -80°C.
Materials and methods 24
3.3 Procedures in molecular biology
3.3.1 Procedures to work with DNA
3.3.1.1 Isolation of plasmid DNA from E. coli
E. coli cells carrying the plasmid of interest were grown overnight in 4 ml LB medium
containing the corresponding antibiotic. Cells were harvested by centrifugation (1 min,
11,000 x g) and further treated using the NucleoSpin® Plasmid kit (Macherey-Nagel, Düren)
as recommended by the supplier.
For preparation of higher amounts of plasmid DNA, E. coli cells were grown overnight in 100
ml LB medium and then harvested by centrifugation (10 min, 6,000 x g). Plasmid preparation
was carried out using the QIAprep®Midipräp kit (Qiagen, Hilden) following the instructions of
the supplier. Subsequently, plasmids were analyzed by agarose gel electrophoresis (section
3.3.1.3).
3.3.1.2 Isolation of plasmid DNA from M. smegmatis
Plasmid preparation from M. smegmatis was carried out using the NucleoSpin® Plasmid kit
(Macherey-Nagel, Düren) as recommended by the supplier. Because of the resistance of the
mycobacterial cell wall, 2 µg/µl lysozyme (Merck, Darmstadt) were added to buffer A1. After
incubation for three hours at 37°C the samples were treated as described in section 3.3.1.1.
3.3.1.3 Gel electrophoresis and extraction of DNA from agarose gels
Plasmid DNA or DNA fragments were analyzed by gel electrophoresis. Depending on the
size of DNA, 0.8-4 % agarose gels were used in 1 x TAE buffer (Sambrook et al., 1989). 6 x
loading dye was added to the samples which were dispersed by electrophoresis at 10 V/cm
of gel length. Additionally, DNA marker (peqGOLD DNA ladder, peqlab Biotechnologie
GmbH, Erlangen) was applied to the gel to determine the size of DNA fragments. After that,
ethidium bromide solution was used to stain the DNA which was subsequently detected
using the Doc Print 1000 Gel documentation (peqlab Biotechnologie GmbH, Erlangen). If
necessary, DNA was excised and isolated from the agarose gel using the NucleoSpin®
Extract kit (Macherey-Nagel, Düren) and following the instructions of the supplier. DNA
Materials and methods 25
concentrations were determined at a wavelength of 260 nm (ε = 5 cm2/mg) in the Nanodrop®
spectrometer ND-100 (peqlab Biotechnologie GmbH, Erlangen). Purity was analyzed by
determination of the quotient of A260 / A280, which is 1.8-2.0 for pure DNA.
1 x TAE buffer:
40 mM Tris, 0.5 mM EDTA, pH (acetic acid) 7.5
6 x loading dye:
0.25 % (w/v) bromphenol blue, 0.25 % (w/v) xylene cyanol FF, 40 % (w/v) sucrose
3.3.1.4 Preparation of chromosomal DNA from M. smegmatis
For preparation of chromosomal DNA phenol chloroform extraction was used. For this
purpose, M. smegmatis strains were cultivated in 20 ml 7H9 medium overnight. On the next
day, 100 ml 7H9 medium were inoculated, which were again incubated overnight. On the
following day, cells were harvested by centrifugation (15 min, 3,000 x g, 4°C) and the cell
pellet was resuspended in 3 ml TE buffer. 300 µl lysozyme solution (10 µg/µl) and 30 µl
RNAseA solution (10 µg/µl) were added, followed by 90 minutes of incubation at 37°C and
low agitation (400 rpm, “HeizThermoMixer” MHR20/23, HLC BioTech, Bovenden). After that,
210 µl 20 % (w/v) SDS and 60 µl proteinase K solution (10 µg/µl) were added. The samples
were inverted and incubated for two hours at 65°C. 600 µl 5 M NaCl and 480 µl 10 % (w/v)
CTAB solution were added, followed by further 30 minutes of incubation at 65°C. 4.5 ml of a
phenol-chlorophorm-isoamyl alcohol mixture (25:24:1) were added. After centrifugation at
8,900 x g and 4°C for 15 minutes, the upper phase was transferred into a fresh reaction tube
containing 4.5 ml of a chlorophorm-isoamyl alcohol mixture (24:1) and again centrifuged at
8,900 x g and 4°C for 15 minutes. Again, the upper phase was transferred into a fresh
reaction tube containing 3 ml isopropanol. After inversion of the tubes, the visible DNA was
transferred into a new reaction tube. The DNA was washed twice in 800 µl 70 % (v/v) ethanol
by centrifugation at 6,500 x g and 4°C for 10 minutes and subsequently dried for 10 minutes
in the vacuum centrifuge Speed Vac® (Savant, USA). To dissolve the DNA pellet, 500 µl TE
buffer were added and the sample was incubated at room temperature overnight.
TE buffer:
100 mM Tris, 0.1 mM EDTA, pH (HCl) 8
Materials and methods 26
3.3.1.5 Polymerase chain reaction (PCR)
Polymerase chain reaction (PCR) is the favored method for amplification of specific DNA
fragments (Mullis et al., 1986). In this study, either genomic or plasmid DNA containing the
fragment of interest was used as template. Primers were designed by MWG (Ebersberg) and
diluted in H2O to a final concentration of 100 pmol/µl. The melting temperature of each primer
was calculated including 2°C for breaking of hydrogen bonds between adenine and thymine
and 4°C for guanine and cytosine. Thus, the specific annealing temperature for each PCR
reaction was set to melting temperature minus 4°C. The reactions were carried out in a
Mastercycler® gradient (Eppendorff, Hamburg) or Primus 96 (peqlab Biotechnologie GmbH,
Erlangen) instrument. For amplification of small DNA fragments, PuRe Taq Ready-To-Go
PCR beads (GE Healthcare, Munich) were used as recommended by the supplier. For
amplification of genes or DNA fragments bigger that 1000 bp, Phusion DNA polymerase
(NEB, Schwalbach), which has an additional proofreading activity, was used.
Composition of a 25 µl PCR sample with Taq beads:
1 µl chromosomal or plasmid DNA
1 µl primer forward
1 µl primer reverse
22 µl H2O
Composition of a 20 µl PCR sample with Phusion DNA polymerase:
4 µl 5 x Phusion DNA polymerase buffer (NEB, Schwalbach)
1 µl chromosomal or plasmid DNA
1 µl primer forward
1 µl primer reverse
1 µl 10 mM dNTP mixture (peqlab Biotechnologie GmbH, Erlangen)
1 µl Phusion DNA polymerase (NEB, Schwalbach)
11 µl H2O
In an initial step, template DNA was denatured for five minutes at 95°C (Taq) or 98°C
(Phusion). Subsequently, 30 repeats of denaturation, primer annealing and DNA synthesis
were performed. Therefore, 15-30 seconds at 95°C or 98°C were followed by 15-30 seconds
at 55°C to 68°C depending on the primer sequence, and one minute per kb (Taq) or 30
seconds per kb (Phusion) at 72°C. Synthesis of DNA fragments was finished in a final
incubation step at 72°C for five minutes. PCR products were analyzed by agarose gel
electrophoresis (see section 3.3.1.3) and, if necessary, purified with the NucleoSpin® Extract
kit (Macherey-Nagel, Düren) as recommended by the supplier.
Materials and methods 27
3.3.1.6 Two-step PCR
Two-step PCR was carried out to induce specific point mutations into the glnR gene.
Therefore, a primer carrying a specific base exchange was used in a first PCR reaction,
which was performed as described in section 3.3.1.5. Then, 10 µl of the first PCR product
carrying the desired exchange were added to a second PCR replacing the forward primer in
a 25 µl reaction. Subsequently, the eventual PCR product carrying the desired base
exchange was purified as described in section 3.3.1.3.
3.3.1.7 Purification and enrichment of DNA
Ethanol precipitation was performed to purify DNA and to increase the concentration. For this
purpose, 1/10 volume 3 M sodium acetate pH 4.8 was given to the DNA sample. After
vortexing, 2.5-fold volume 100 % ethanol was added. After inversion, the precipitated nucleic
acids were centrifuged (15 min, 13,000 x g). The DNA pellet was washed with 2.5-fold
volume 70 % (v/v) ethanol (5 min, 13,000 x g) and dried for 10 minutes in the vacuum
centrifuge Speed Vac® (Savant, USA). Finally, the pellet was suspended in H2O or TE buffer.
TE buffer:
100 mM Tris, 0.1 mM EDTA, pH (HCl) 8
3.3.1.8 Restriction of DNA
Assumption for cloning of different DNA fragments into vectors is the existence of compatible
ligation sites. Therefore, vectors and DNA fragments were treated with one or two restriction
enzymes as recommended by the supplier (NEB, Schwalbach). The samples were incubated
for one to three hours at 37°C or room temperature depending on the restriction enzyme. If
appropriate, 1 µl CIP (calf intestine phosphatase, Roche, Penzberg), was added to
dephosphorylate 5’-ends of vector DNA. A 20 µl restriction sample was composed as follows:
x µl DNA (200-2000 ng)
2 µl NEB buffer
2 µl 10 x BSA (NEB, Schwalbach, optional)
0.5 µl restriction enzyme I
0.5 µl restriction enzyme II (optional)
x µl H2O
Materials and methods 28
After treatment with restriction and dephosphorylating enzymes, DNA was purified by gel
electrophoresis and using the NucleoSpin® Extract kit (Macherey-Nagel, Düren) as described
in section 3.3.1.3.
3.3.1.9 Ligation of DNA fragments
For ligation of restricted DNA fragments and vectors, T4 DNA ligase (NEB, Schwalbach) or
Quick DNA ligase (NEB, Schwalbach) was used.
Composition of a 10 µl ligation sample with T4 ligase:
x µl vector (100 ng)
x µl DNA fragment (5-10 x overage)
1 µl 10 x T4 ligase buffer (NEB, Schwalbach)
0.5 µl T4 ligase
x µl H2O
Composition of a 20 µl ligation sample with Quick ligase:
x µl vector (100 ng)
x µl DNA fragment (5-10 x overage)
10 µl 2 x Quick ligase buffer (NEB, Schwalbach)
1 µl Quick ligase
x µl H2O
Ligation was carried out for two hours at room temperature or at 15°C overnight. The
complete sample was used for transformation of 100 µl competent E. coli cells as described
in section 3.4.2.
3.3.1.10 Sequencing of DNA
According to the chain termination method described by Sanger et al. (1977), DNA fragments
were sequenced. A sequencing sample was composed of 400-700 ng DNA, 10 pmol of an
oligonucleotide primer and 3 µl Terminator Ready Reaction Mix (Applied Biosystems, USA).
This mix contained didesoxynucleotides labeled with fluorescent dye as chain terminators.
Each sample was filled with H2O to a final volume of 10 µl. Sequencing reactions were
performed using the following PCR program:
Materials and methods 29
The resulting DNA fragments were precipitated as described in section 3.3.1.7, solved in 12
µl formamide and investigated with the ABI PRISM Genetic Analyser 310 (Applied
Biosystems, Freiburg). Data were further analyzed with the Clone Manager software (Sci-Ed,
North Carolina, USA).
For further sequence analyses, samples containing 30 µl of plasmid DNA (30-100 ng/µl) and
10 µl of an appropriate sequencing primer (10 pmol/µl) were sent to GATC Biotech
(Konstanz). Data were again analyzed using the Clone Manager software (Sci-Ed, North
Carolina, USA).
3.3.1.11 Gel retardation and competition assays
To detect binding of proteins like GlnR to their target DNA, gel retardation experiments were
carried out. For this, a digoxigenin-labeled DNA fragment containing a putative GlnR binding
site was incubated with purified GlnR protein. Subsequently, the mixture was loaded to a
native gel. Binding of the protein should slow down passing of the DNA through the gel.
The 200-300 bp target DNA for the gel shift assays was synthesized by PCR (refer to section
3.3.1.5) and purified by gel electrophoresis (section 3.3.1.3). For labeling of DNA and setup
of the reaction mixture for gel shift assays, the DIG Gel Shift kit, 2nd Generation (Roche
Diagnostics, Mannheim) was used. First, the purified DNA fragments were diluted 1:1 in TEN
buffer, incubated for 10 minutes at 95°C and shortly centrifuged after cooling down to
15-25°C. The following composition was mixed on ice:
10 µl diluted DNA fragment
4 µl DIG labeling buffer
4 µl cobalt dichloride
1 µl DIG ddUTP solution
1 µl terminal transferase
Incubating the samples for 15 minutes at 37°C ensured that the enzyme attached the
digoxigenin-labeled ddUTPs to the 3’-ends of the DNA. To stop the reaction, 2 µl 0.2 M
EDTA (pH 8) and 3 µl H2O were added. To test the functionality of the generated DNA
probes, these were applied to a positively charged nylon membrane (Roche Diagnostics,
96°C 10 s
25 x 50-65°C 5 s
60°C 4 min
Materials and methods 30
Mannheim) in various dilutions. Labeling efficiency was detected by comparing the signal
strengths to a control DNA. For gel shift assays, DNA dilutions of 1:100-1:200 were used. As
protein sample, total cell extract of M. smegmatis or purified proteins were used (see
sections 3.3.3.1 and 3.3.3.2). A 10 µl reaction was composed as follows:
2 µl 5 x binding buffer
1 µl dilution of the labeled DNA fragment
0.5 µl poly lysine (if required)
1-3 µl competitor DNA polyd[I-C] (if required)
x µl protein or cell extract
x µl H2O
Samples were incubated for 15 minutes at room temperature, when protein-DNA complexes
were formed. After that, 2.5 µl of DNA loading dye (Roche Diagnostics, Mannheim) were
added to the samples. Separation by gel electrophoresis was performed in native 6 %
polyacrylamide gels (Anamed Electrophorese GmbH, Darmstadt) for 1.5 hours at 80 V. As
running buffer 0.5 x TBE buffer (Sambrook et al., 1989) was used. Subsequently, the labeled
DNA was blotted onto a positively charged nylon membrane (Roche Diagnostics, Mannheim)
by electroblotting for one hour at 300 mA and 30 V. The DNA was fixed to the membrane by
UV radiation (2 x Autocrosslink, UV-Stratalinker® 1800, Stratagene, Heidelberg). Blocking of
the membrane was conducted by incubation in 1 x blocking solution (Roche Diagnostics,
Mannheim) for 30 minutes. Then, alkaline phosphatase conjugated anti-digoxigenin Fab
fragments (Roche Diagnostics, Mannheim) were added in a 1:10.000 dilution. After 30
minutes of incubation, the membrane was washed for 2 x 15 minutes in washing buffer.
Accordingly, the membrane was equilibrated in detection buffer for three minutes. The
membrane was subsequently covered and incubated with 10 µl CSPD reagent (Roche
Diagnostics, Mannheim), diluted in 990 µl detection buffer, for 15 minutes at 37°C. Finally,
light emission was detected using Amersham HyperfilmTM MP (GE Healthcare, Munich) or a
ChemidocTM XRS+ molecular imager (Biorad, Munich).
Similarly to the protocol of gel shift assays, competitive assays were carried out. For this
purpose, unlabeled, overlapping 50 or 25 bp DNA fragments were added to the DNA-protein
samples. So, their function as inhibitors of GlnR-binding to its target DNA was tested.
TEN buffer:
10 mM Tris, 1 mM EDTA, 0.1 M NaCl, pH (HCl) 8.0
Materials and methods 31
1 l 10 x TBE buffer:
108 g Tris, 53 g boric acid, 40 ml 0.5 M EDTA, pH (HCl) 8.0
Loading dye:
0.2 % (w/v) bromphenol blue, 40 % (w/v) glycerin, 60 % (v/v) 0.25 x TBE buffer
10 x blocking solution:
10 g blocking reagent (Roche Diagnostics, Mannheim) were suspended in 100 ml maleic
acid buffer and solved by heating to 60°C. After autoclavation for 20 minutes at 121°C, the
solution was further diluted if required.
Maleic acid buffer:
0.1 M maleic acid, 0.15 M NaCl, pH (NaOH) 7.5
Washing buffer:
Maleic acid buffer with 0.3 % Tween20
Detection buffer:
0.1 M Tris, 0.1 M NaCl, pH (NaOH) 9.0
CSPD solution:
1:100 dilution of CSPD reagent (Roche Diagnostics, Mannheim) in detection buffer
3.3.1.12 Electrophoretic mobility shift assay (EMSA)
EMSAs were also used to detect binding of GlnR to its target DNA. In principal, the binding
reaction was performed as described in section 3.3.1.11, but the DNA was not labeled with
any marker. Consequently, higher amounts of DNA fragment and purified protein were used.
After incubation of the DNA-protein samples, 2 µl loading dye were added and gel
electrophoresis was performed in 2 % agarose gels at 8 V/cm of gel length. Again, binding of
the protein should slow down passing of the DNA through the gel. After electrophoresis, DNA
was stained with ethidium bromide solution and detected with the Doc Print 1000 Gel
documentation (peqlab Biotechnologie GmbH, Erlangen).
1 x TAE buffer:
40 mM Tris, 0.5 mM EDTA, pH (acetic acid) 7.5
Materials and methods 32
6 x loading dye:
0.25 % (w/v) bromphenol blue, 0.25 % (w/v) xylene cyanol FF, 40 % (w/v) sucrose
3.3.1.13 Southern blot analysis
For detection of insertion or deletion mutants of M. smegmatis (see section 3.4.6), Southern
blot analyses were performed. For this purpose, the DIG High Prime DNA Labeling and
Detection Starter kit I (Roche Diagnostics, Mannheim) was used. First, an appropriate 300-
500 bp DNA probe was chosen, amplified by PCR (section 3.3.1.5) and isolated by gel
electrophoresis and extraction from the agarose block (section 3.3.1.3). This DNA fragment
was diluted to a final amount of 1 µg in 16 µl H2O and incubated for 10 minutes at 95°C. 4 µl
DIG High Prime (Roche Diagnostics, Mannheim) were added. After incubation of up to 20
hours at 37°C, 2 µl 0.2 M EDTA were added to stop the reaction. Finally, the samples were
incubated for 10 minutes at 65°C. To test the labeling efficiency, 1 µl of each sample was
applied to a positively charged nylon membrane (Roche Diagnostics, Mannheim) and treated
as described in section 3.3.1.11. Signals were detected by adding 40 µl NBT/BCIP (Roche
Diagnostics, Mannheim) and 1.96 ml detection buffer and incubation in the dark. TE buffer
was added to stop the reaction.
For the actual Southern blot analysis, 5 µg chromosomal DNA of M. smegmatis (see section
3.3.1.4) were digested overnight with appropriate restriction enzymes in a total volume of 20
µl (see section 3.3.1.8). The DNA samples were separated by gel electrophoresis in a 1 %
agarose gel (see section 3.3.1.3). If required, a digoxigenin-labeled DNA marker was added
to the gel (DNA Molecular Weight Marker VII, Roche Diagnostics, Mannheim). After that, the
gel was incubated for 15 minutes in depurination solution, for 2 x 15 minutes in denaturation
solution and for 2 x 10 minutes in neutralization solution. The DNA was subsequently
transferred to a positively charged nylon membrane (Roche Diagnostics, Mannheim) by a
capillary blot using a VacuGene vacuum pump (GE Healthcare, Munich) at 50 mbar. The gel
was covered with 20 x SSC. After three hours, the DNA was linked to the membrane by UV
radiation (2 x Autocrosslink, UV-Stratalinker® 1800, Stratagene, Heidelberg). The agarose
gel was stained with ethidium bromide to control successful blotting. The membrane was
incubated in 10 ml DIG Easy Hyb (Roche Diagnostics, Mannheim) for at least 30 minutes at
42°C. After addition of 3 µl DNA probe, which was denatured for five minutes at 95°C before,
the membrane was incubated overnight at 50°C rotating in a hybridization oven (HYBAIDTM,
Biometra, Göttingen). To remove unspecifically bound probe, the membrane was washed on
the next day for 2 x five minutes with washing buffer 2 at room temperature and for 2 x 15
minutes with washing buffer 3 at 68°C. The membrane was thereupon washed for three
Materials and methods 33
minutes in washing buffer and incubated for one hour in 1 x blocking solution. Then, alkaline
phosphatase conjugated anti-digoxigenin Fab fragments (Roche Diagnostics, Mannheim)
were added in a 1:10.000 dilution. After 30 minutes of incubation, the membrane was
washed for 2 x 15 minutes in washing buffer. Accordingly, the membrane was equilibrated for
three minutes in detection buffer. Signals were detected by addition of 10 ml detection buffer
with 200 µl NBT/BCIP (Roche Diagnostics, Mannheim) and incubation in the dark. The
reaction was stopped by adding TE buffer.
1 x TAE buffer:
40 mM Tris, 0.5 mM EDTA, pH (acetic acid) 7.5
6 x loading dye:
0.25 % (w/v) bromphenol blue, 0.25 % (w/v) xylene cyanol FF, 40 % (w/v) sucrose
Depurination solution:
0.25 M HCl (36.44 ml 25 % (v/v) HCl, H2O to 1 l)
Denaturation solution:
1.5 M NaCl, 0.5 M NaOH
Neutralization solution:
0.5 M Tris, 1.5 M NaCl, pH (HCl) 7.5
20 x SSC:
3 M NaCl, 0.3 M sodium citrate, pH (HCl) 7.0 Washing buffer 2:
2 x SSC, 0.1 % (w/v) SDS
Washing buffer 3:
0.2 x SSC, 0.1 % (w/v) SDS
10 x blocking solution:
10 g blocking reagent (Roche Diagnostics, Mannheim) were suspended in 100 ml maleic
acid buffer and solved by heating to 60°C. After autoclavation for 20 minutes at 121°C, the
solution was further diluted if required.
Materials and methods 34
Maleic acid buffer:
0.1 M maleic acid, 0.15 M NaCl, pH (NaOH) 7.5
Washing buffer:
Maleic acid buffer with 0.3 % Tween20
Detection buffer:
0.1 M Tris, 0.1 M NaCl, pH (NaOH) 9.0
TE buffer:
100 mM Tris, 0.1 mM EDTA, pH (HCl) 8.0
3.3.2 Procedures to work with RNA
3.3.2.1 Isolation of total RNA from M. smegmatis
For isolation of total RNA from M. smegmatis, cells were grown as described in section 3.2.3.
7 ml samples were taken and centrifuged for two minutes at 8,000 x g and 4°C.
Subsequently, the cell pellet was frozen in liquid nitrogen and stored at -80°C. RNA isolation
was performed using the NucleoSpin® RNA II kit (Macherey-Nagel, Düren). For this purpose,
cells were thawed on ice, resuspended in RA1 buffer containing 1 % (v/v) 2-mercaptoethanol
and transferred to Cryo tubes (Thermo Scientific, Denmark) containing glass beads. Cells
were disrupted by vigorous shaking at 6.5 m s-1 for 30 seconds in a FastPrep FP120
instrument (Q-BIOgene, Heidelberg). After five minutes of incubation on ice, the disruption
step was repeated. After that, the samples were centrifuged for three minutes at 13,000 x g
and 4°C. While cell debris and glass beads were discarded, the supernatant was added to
350 µl 70 % (v/v) ethanol and mixed by vortexing. After that, the solution was transferred to
RNA purification columns from the NucleoSpin® RNA II kit (Macherey-Nagel, Düren). Total
RNA was isolated using the kit as recommended by the supplier, whereat the RNA was
routinely treated with DNAse (peqlab Biotechnologie GmbH, Erlangen) to avoid
contamination with chromosomal DNA. This guaranteed a sufficient purity of total RNA for
Dot blot experiments (see section 3.3.2.4). Finally, the RNA was eluted in 60 µl RNAse-free
H2O. Furthermore, for quantitative real time RT PCR (section 3.3.2.5) or microarray
experiments (section 3.3.2.6), total RNA was treated with TURBO-DNase (Ambion, Austin,
USA) and again purified according to the NucleoSpin® RNA II kit (Macherey-Nagel, Düren)
Materials and methods 35
protocol. Otherwise, the RNeasy kit (Qiagen, Hilden) was used as recommended by the
supplier.
RNA concentrations were analyzed at a wavelength of 260 nm (ε = 5 cm2/mg) in the
Nanodrop® spectrometer ND-100 (peqlab Biotechnologie GmbH, Erlangen). Purity was
determined by the quotient of A260 / A280, which is 2.0 for pure RNA. Samples were stored at
-80°C until further usage.
3.3.2.2 RNA gel electrophoresis
Gel electrophoresis was used to test the quality of isolated RNA (see section 3.3.2.1). For
this purpose, 5 µl RNA loading buffer were added to 3 µl purified RNA. The mixture was
incubated for 10 minutes at 65°C. After cooling of the samples for five minutes on ice, they
were analyzed by gel electrophoresis according to the evaluation of DNA (refer to section
3.3.1.3).
RNA loading buffer:
0.2 % (w/v) bromphenol blue, 0.2 % (w/v) xylene cyanol, 65 % (v/v) formamide, 12 % (v/v)
formaldehyde, 2 x MOPS buffer, 2 % (w/v) sucrose
10 x MOPS buffer:
200 mM MOPS, 50 mM sodium acetate, 10 mM EDTA, pH (NaOH) 7.0
3.3.2.3 Synthesis of digoxigenin-labeled RNA probes
For specific detection of certain mRNA species in total RNA samples, digoxigenin-labeled
RNA probes were used. The probes were synthesized by in vitro transcription. Initially, an
approximately 500 bp DNA fragment was amplified by PCR (see section 3.3.1.5) using a
reverse primer with a specific T7 promoter sequence at its 5’-end. Digoxigenin-11-dUTPs
instead of dUTPs were added to the labeling reaction. The composition for an in vitro
transcription sample was as follows:
14 µl purified PCR product
2 µl DIG RNA Labeling Mix (Roche Diagnostics, Mannheim)
2 µl 10 x RNA polymerase buffer (NEB, Schwalbach)
1 µl T7 RNA Polymerase (NEB, Schwalbach)
Materials and methods 36
Incubation for two hours at 37°C ensured the generation of a digoxigenin-labeled RNA probe
by T7 RNA polymerase. Then, 1 µl RNase-free peqGOLD DNaseI (peqlab Biotechnologie
GmbH, Erlangen) was added. The sample was again incubated for 25 minutes at 37°C to
ensure digestion of template DNA. After that, the functionality of the generated probe was
tested (see test of gel shift fragments, section 3.3.1.11). All probes were stored at -80°C until
further usage.
3.3.2.4 RNA hybridization analysis (Dot blot)
To analyze gene transcript levels, RNA hybridization experiments were carried out. For this
purpose, 1 µg total RNA of M. smegmatis (see section 3.3.2.1) was mixed with 100 µl 10 x
SSC marked with bromphenol blue and transferred onto a positively charged nylon
membrane (Roche Diagnostics, Mannheim). Therefore, the Minifold I Dot Blotter (Schleicher
& Schuell, Dassel) and a VacuGene vacuum pump at 20 mbar (GE Healthcare, Munich)
were used. Before that, the membrane had been equilibrated in 10 x SSC. When transfer of
the RNA samples was completed, the membrane was dried for five minutes at 100 mbar.
After that, RNA was crosslinked by UV radiation (2 x Autocrosslink, UV-Stratalinker® 1800,
Stratagene, Heidelberg). The membrane was subsequently incubated for one hour in 12.5 ml
prehybridization solution at 50°C in the hybridization oven HYBAIDTM (Biometra, Göttingen).
After 1.2 µl digoxigenin-labeled RNA probe (see section 3.3.2.3) were added, the reaction
temperature was set to 68°C and hybridization occurred overnight. On the next day, the
membrane was washed for 2 x 15 minutes at room temperature with washing buffer 2. Then,
the membrane was washed for 2 x 25 minutes at 68°C with washing buffer 3 and for five
minutes at room temperature with washing buffer. The membrane was incubated for one
hour in 25 ml 1 x blocking solution. For further treatment and detection see section 3.3.1.11.
Prehybridization solution:
50 ml formamide, 20 ml 10 x blocking buffer, 25 ml 20 x SSC, 1 ml 10 % (w/v) sodium lauroyl
sarcosinate, 0.2 ml 10 % (w/v) SDS, 3.8 ml H2O
20 x SSC:
3 M NaCl, 0.3 M sodium citrate, pH (HCl) 7.0
Washing buffer 2:
2 x SSC, 0.1 % (w/v) SDS
Materials and methods 37
Washing buffer 3:
0.2 x SSC, 0.1 % (w/v) SDS
10 x blocking solution:
10 g blocking reagent (Roche Diagnostics, Mannheim) were suspended in 100 ml maleic
acid buffer and solved by heating to 60°C. After autoclavation for 20 minutes at 121°C, the
solution was further diluted if required.
Maleic acid buffer:
0.1 M maleic acid, 0.15 M NaCl, pH (NaOH) 7.5
Washing buffer:
Maleic acid buffer with 0.3 % Tween20
Detection buffer:
0.1 M Tris, 0.1 M NaCl, pH (NaOH) 9.0
3.3.2.5 Quantitative real time RT PCR
Quantitative real time RT PCR was performed to identify differences in the quantity of a
specific mRNA. To achieve this, cells were incubated under nitrogen starvation (see section
3.2.3) and total RNA was prepared as described before (see section 3.3.2.1). RT PCR is
based on quantification of mRNA levels by transcription of cDNA followed by a common PCR
resulting in the amplification of a specific DNA fragment. Total RNA was used as a template
for reverse transcription. Primers were generated by MWG (Ebersberg) and dissolved in H2O
to a final concentration of 100 pmol/µl. To guarantee constant polymerase efficiency, all
amplified DNA fragments were of 100 bp size. The iScript One-Step RT-PCR kit with SYBR
Green (Biorad, Munich) was used for setting up the reactions.
Composition of a 25 µl real time RT PCR sample:
12.5 µl SYBR mix (Biorad, Munich)
0.5 µl primer forward
0.5 µl primer reverse
0.5 µl reverse transcriptase (Biorad, Munich)
1 µl H2O
10 µl total RNA
Materials and methods 38
Real time RT PCR program:
10 min 50°C
5 min 95°C
10 sec 95°C
45 x 15 sec 57°C
10 sec 72°C
1 min 95°C
1 min 55°C
81 x 10 sec 55-95°C
For all real time RT PCR experiments, the MyiQ Single-Color Real Time PCR Detection
system (Biorad, Munich) was used. In the first 10 minutes at 50°C, mRNA was transcribed by
the reverse transcriptase into cDNA. Incubation for five minutes at 95°C ensured
denaturation of the DNA/RNA hybrid. During the next 45 cycles, a specific cDNA product was
amplified. The amount of PCR product was determined after each cycle. Therefore, the
increase of fluorescence was monitored, as the fluorescent dye SYBR Green 1 is able to
bind double stranded DNA. Cq values were calculated when the sample fluorescence
crossed the threshold line, which was set automatically by the analysis software to separate
background fluorescence. In 81 cycles, where the temperature was risen from 55°C to 95°C,
melt curves were generated to analyze the purity and specificity of the amplified PCR
products. To guarantee the quality of the experiment, a no template control (H2O instead of
RNA) was carried along for each tested mRNA. Also to control the specificity of the PCR
product, each sample was analyzed in a 4 % agarose gel, where only the specific 100 bp
band should be visible.
Primarily, RNA dilution series were tested in duplicates. 100, 10, 1 and 0.1 ng RNA were
used. From the determined Cq values, a standard curve was calculated for every dilution
series. The slope of the curve was used to calculate the efficiency of the PCR reaction. All
primer pairs with an efficiency of 90-105 % were used for further experiments. To analyze
differences in gene expression, 10 ng RNA of the M. smegmatis wild type and the glnR
deletion strain were used for each reaction. Of each sample, at least 3 replicates were used
to determine the relative transcript level of various target genes compared to a reference
gene, whose transcript level did not differ significantly under the tested conditions. The MyiQ
Optical Software provided by the supplier (Biorad, Munich) was used to analyze the data.
Standard curves were analyzed using the applications “Gene Expression” and “Melt Curves”,
differences in transcript levels were quantified using the application “Gene Expression
Analysis”. Relative fold expression ratios were calculated according to Pfaffl et al. (2001)
using the following formula:
Materials and methods 39
E target Relative expression ratio = E reference
3.3.2.6 cDNA microarrays
To compare mRNA levels in the total genome of different M. smegmatis strains, cDNA
microarrays were carried out. For this purpose, total RNA of M. smegmatis was prepared
(see section 3.3.2.1). The RNA was transcribed into cDNA, labeled with cy3 and cy5
fluorescence markers and bound to 60 bp oligonucleotides, which represented the whole
M. smegmatis genome and were fixed to a microarray chip. These steps were performed at
the Department of Biochemistry, Friedrich-Alexander University Erlangen-Nuremberg, using
the Two-Color Microarray-Based Gene Expression Analysis protocol (Agilent Technologies,
Waldbronn). The microarray chip was also designed by Agilent Technologies. For data
analyses, the program GeneSpring GX 11 (Agilent Technologies, Waldbronn) was used.
3.3.3 Procedures to work with proteins
3.3.3.1 Preparation of total cell extract
For preparation of total cell extract, 500 ml C. glutamicum or M. smegmatis cells were grown
as described in section 3.2.3 and harvested by centrifugation (10 min, 4,000 x g, 4°C). After
the pellet was resuspended in 20 ml basic buffer, 500 µl protease inhibitor Complete (Roche
Diagnostics, Mannheim) and a spot of lysozyme (Merck, Darmstadt) were added. The cells
were subsequently disrupted using the sonication instrument SonoPlus (BANDELIN
electronic, Berlin) for 5 x 30 seconds at 60 % capacity. Between the intervals, samples were
incubated for five minutes on ice. Cell debris was removed by centrifugation (30 min, 14,000
x g, 4°C). The supernatant was transferred into a new reaction tube and stored at 4°C until
further usage.
Basic buffer:
100 mM Tris, 150 mM NaCl, 1 mM EDTA, pH (HCl) 8.0
Cq target (wt - ΔglnR)
Cq reference (wt - ΔglnR)
Materials and methods 40
3.3.3.2 Protein purification via affinity chromatography
All tagged M. smegmatis proteins were overexpressed in E. coli Rosetta2. For that, cells
were grown as described in section 3.2.3. To induce overexpression of proteins tagged with
6 x His or MBP (maltose binding protein), 1 mM IPTG was added, whereas overexpression
of proteins with Strep-tag was induced by adding 1 µg/ml doxycycline. After four hours of
incubation, cells were harvested by centrifugation (10 min, 4,000 x g, 4°C). The cell pellet
was stored at -80°C until further usage or directly solved in 20 ml basic buffer (His, Strep or
MBP). 500 µl protease inhibitor Complete (Roche Diagnostics, Mannheim) and a spot of
lysozyme (Merck, Darmstadt) were added. Cells were subsequently disrupted using the
sonication instrument SonoPlus (BANDELIN electronic, Berlin) for 3 x 30 seconds at 50 %
capacity. Between the intervals, the samples were incubated for five minutes on ice. Cell
debris was removed by centrifugation (30 min, 14,000 x g, 4°C). The resulting cell extract
was filtered through Filtropur S 0.2 filter (Sarstedt, Nümbrecht) to remove remaining
granules.
His-tagged proteins were purified using an Äkta prime system with a 1 ml HighTrap affinity
column (GE Healthcare, Munich) following the protocol of the supplier. After loading the cell
extract onto the column and washing it with His basic buffer, His-tagged proteins were eluted
by adding rising concentrations of imidazole. MBP-tagged proteins were purified using the
same system with a 10 ml amylose resin affinity column (GE Healthcare, Munich) according
to the supplier’s protocol. MBP-tagged proteins were eluted from the column by adding rising
concentrations of maltose. Strep-tagged proteins were purified using a 1 ml Strep-TactinR-
SepharoseR matrix (IBA BioTAGnology, Göttingen) in a Poly-Prep chromatography column
(Biorad, Munich) following the description of the supplier. In order to elute Strep-tagged
proteins, D-desthiobiotin was added. Columns were regenerated following the
manufacturers’ protocols. All elution fractions were collected and stored at 4°C until further
usage.
For further purification or to separate proteins of different size, gel filtration was carried out.
Therefore, an Äkta system with a Superdex G250 column was used as recommended by the
supplier (GE Healthcare, Munich). After 1-2 column volumes of gel filtration buffer, the
protein sample was manually loaded onto the Äkta system.
His basic buffer:
300 mM NaCl, 50 mM NaH2PO4, 10 mM imidazole, pH (NaOH) 8.0
His elution buffer:
300 mM NaCl, 50 mM NaH2PO4, 500 mM imidazole, pH (NaOH) 8.0
Materials and methods 41
Strep basic buffer:
100 mM Tris, 500 mM NaCl, 1 mM EDTA, pH (HCl) 8.0
Strep elution buffer:
100 mM Tris, 500 mM NaCl, 1 mM EDTA, 2.5 mM D-desthiobiotin, pH (HCl) 8.0
Strep regeneration buffer:
100 mM Tris, 500 mM NaCl, 1 mM EDTA, 1 mM HABA, pH (HCl) 8.0
MBP basic buffer:
20 mM Tris, 200 mM NaCl, 1 mM EDTA, pH (HCl) 7.4
MBP elution buffer:
20 mM Tris, 200 mM NaCl, 1 mM EDTA, 20 mM maltose, pH (HCl) 7.4
Gel filtration buffer:
20 mM Tris, 200 mM NaCl, pH (HCl) 8.0
All buffers were sterilized by filtration.
3.3.3.3 Quantification and enrichment of proteins
Protein concentrations were measured according to Bradford (1976). 0, 2, 4, 6, 8 and 10 µg
bovine serum albumine (BSA) were used to generate a standard curve. All samples were
filled with H2O to a final volume of 800 µl. Subsequently, 200 µl Biorad Protein Assay
(Biorad, Munich) were added. After vortexing, the samples were incubated for 20 minutes at
room temperature and vortexed again. Measurements were carried out in plastic cuvettes
(bio one, Greiner, Essen) in the photometer Ultraspec 2100 pro (Amersham Biosciences,
USA) at a wavelength of 595 nm against a reference consisting of 800 µl H2O and 200 µl
Biorad Protein Assay (Biorad, Munich).
The Nanodrop® spectrometer ND-100 (peqlab Biotechnologie GmbH, Erlangen) was also
used to determine protein concentrations. With the application “Protein A280”, the protein
concentration was measured at 280 nm considering the molecular weight and the extinction
coefficient of the purified protein.
Materials and methods 42
To increase the amount of protein in a sample, it was concentrated using Centriprep
centrifugal filters with a pore size of 10 kDa (Millipore, Massachusetts, USA). First, the filter
was equilibrated with elution buffer of the particular protein (see section 3.3.3.2) by
centrifugation for five minutes at 3,000 x g and 4°C. After that, the buffer was completely
removed, the protein sample was added to the filter and also centrifuged at 3,000 x g and
4°C for 30 minutes. Subsequently, the flow through was removed. This procedure was
repeated until the desired volume of protein sample remained.
3.3.3.4 SDS polyacrylamide gel electrophoresis
14 % SDS polyacrylamide gels were used for electrophoretic separation of protein samples
(according to Schägger and von Jagow, 1987). The gels contained urea and SDS, leading to
denaturation of the proteins.
Composition of a separation gel:
3.75 ml acrylamide/bisacrylamide (37.5 %/1 %)
3.75 ml Schägger gel buffer
4.05 g urea
3.75 µl TEMED
37.5 µl 10 % (w/v) APS
Composition of a stacking gel:
250 µl acrylamide/bisacrylamide (37.5 %/1 %)
775 µl Schägger gel buffer
2 ml H2O
2.5 µl TEMED
25 µl 10 % (w/v) APS
Loading buffer was added to the protein samples. After incubation for five minutes at 95°C,
the samples were loaded onto the gel. For gel electrophoresis, a BlueVertical 101 apparatus
(Serva Electrophoresis GmbH, Heidelberg) was used. First, the voltage was set to 50 V. It
was risen to 120 V as soon as the protein samples had crossed the stacking gel. As running
buffers cathode and anode buffers were used. To determine the size of the investigated
proteins, protein markers (peqGOLD Protein Marker II or peqGOLD Prestained Protein-
Marker IV, peqlab Biotechnologie GmbH, Erlangen) were added to the gel.
Materials and methods 43
Schägger gel buffer:
3 M Tris, 1 M HCl, 0.3 % (w/v) SDS
5 x loading buffer:
20 % (w/v) SDS, 60 % (w/v) glycerol, 250 mM Tris, 10 % (v/v) 2-mercaptoethanol, 0.01 %
(w/v) serva blue G-250, pH (HCl) 6.8
Cathode buffer:
0.1 M Tris, 0.1 M tricine, 0.1 % (w/v) SDS
Anode buffer:
0.2 M Tris, pH (HCl) 8.9
3.3.3.5 Native polyacrylamide gel electrophoresis
Electrophoretic separation of proteins was also performed using native polyacrylamide gels,
where no denaturation of the proteins occurred.
Composition of a native gel:
2.5 ml acrylamide/bisacrylamide (19 %/1 %)
1 ml 10 x TBE buffer
6.195 ml H2O
5 µl TEMED
300 µl 10 % (w/v) APS
After native loading buffer was added to the protein samples, the mixture was loaded onto
the gel. Gel electrophoresis was performed in a BlueVertical 101 apparatus (Serva
Electrophoresis GmbH, Heidelberg) at 100 V. 1 x TBE buffer was used as running buffer. To
determine the size of the investigated proteins, protein markers (peqGOLD Protein Marker II
or peqGOLD Prestained Protein-Marker IV, peqlab Biotechnologie GmbH, Erlangen) were
added to the gel.
1 l 10 x TBE buffer :
108 g Tris, 53 g boric acid, 40 ml 0.5 M EDTA, pH (HCl) 8.0
Materials and methods 44
4 x native loading buffer:
15 % (w/v) glycerin, 125 mM Tris, 1 mM EDTA, bromphenol blue, pH (HCl) 6.8
3.3.3.6 Staining with Coomassie Brilliant Blue
Proteins separated in SDS or native polyacriylamide gels (see sections 3.3.3.4 and 3.3.3.5)
were stained with Coomassie Brilliant Blue (Sambrook et al., 1989). For this purpose, the
polyacrylamide gel was incubated in staining solution at room temperature for 15 minutes.
Subsequently, it was decolorized for 1-5 hours in 10 % (v/v) acetic acid.
Staining solution:
45 % (v/v) methanol, 10 % (v/v) acetic acid, 0.1 % (w/v) Coomassie Brilliant Blue G-250
3.3.3.7 Western blot analysis
To detect proteins with specific antibodies, Western blot analyses were carried out. After
protein samples had been separated in SDS or native polyacrylamide gels, they were
dispatched to a polyvinylidene difluoride membrane (Millipore Immobilon P, Roth, Karlsruhe)
by electroblotting. For this purpose, the membrane, equilibrated in 60 % (v/v) methanol and
transfer buffer, was put on filter paper which was also equilibrated in transfer buffer. The
protein gel was put on top and covered with filter paper again deposed in transfer buffer.
Blotting was carried out for one hour at 0.8 mA per cm2 of membrane. After that, the
membrane was incubated in 1 x TBS buffer for five minutes and subsequently in blocking
solution for one hour. Then, a specific antibody (His, MBP or GlnR, each generated in
rabbits) was added in a 1:10.000 dilution and the membrane was incubated overnight. On
the next day, the membrane was washed for 3 x five minutes in TBS-T buffer and after that,
an anti-antibody with alkaline phosphatase (Anti-Mouse or Anti-Rabbit IgG, Sigma-Aldrich,
Steinheim) was added in a 1:10.000 dilution in blocking solution. The membrane was again
washed for 3 x five minutes in TBS-T buffer.
For detection of anti-GlnR or anti-MBP, the BCIP/NBT alkaline phosphatase substrate (Roth,
Karlsruhe) was used. For this, 65 µl BCIP and NBT stock solutions were diluted in 10 ml
detection buffer. The reaction was stopped by adding H2O. For detection of anti-His, the ECL
Western blot plus kit (GE Healthcare, Munich) was used as recommended by the supplier.
The signal was detected on Amersham HyperfilmTM MP (GE Healthcare, Munich).
Materials and methods 45
Transfer buffer:
25 mM Tris, 0.2 M glycine, 20 % (v/v) methanol, pH (HCl) 8.5
1 l 10 x TBS buffer:
24.2 g Tris, 80 g NaCl, pH (HCl) 7.6
TBS-T buffer:
1 x TBS buffer, 0.1 % (v/v) Tween20
Blocking solution:
15 ml 10 x TBS buffer, 135 ml H2O, 7.5 g dry milk, 150 µl Tween20
NBT stock solution:
0.5 g 4-nitro blue tetrazolium chloride (NBT) were dissolved in 10 ml 70 % (v/v)
dimethylformamide and stored at -20°C.
BCIP stock solution:
0.5 g 5-bromo-4-chloro-3-indolyl phosphate toluidine salt (BCIP) were dissolved in 20 ml
100 % dimethylformamide and stored at -20 °C.
Detection buffer:
100 mM NaCl, 5 mM MgCl2, 100 mM Tris, pH (NaOH) 9.5
3.3.3.8 Pull down assays
To identify GlnR interaction partners in pull down assays, GlnR protein with Strep-tag
overexpressed in E. coli Rosetta2 was used (see sections 3.2.3 and 3.3.3.2). First, the Strep-
GlnR containing E. coli cell extract was loaded onto a 1 ml Strep-TactinR-SepharoseR matrix
(IBA BioTAGnology, Göttingen) in a Poly-Prep chromatography column (Biorad, Munich).
After three washing steps with 1.5 ml strep washing buffer, total cell extract of M. smegmatis
(see section 3.3.3.1) was added. The washing steps were repeated, followed by five elution
steps with 500 µl strep elution buffer each. Purified GlnR bound to the column as well as
possible GlnR interaction partners were analyzed in SDS polyacrylamide gel electrophoresis
(see section 3.3.3.4). Visible protein bands were excised from the gel and sent to ZMMK,
University of Cologne, for mass spectroscopic analysis (MALDI-ToF-MS).
Materials and methods 46
3.3.3.9 Radioactive phosphorylation of proteins
Protein phosphorylation was investigated using radioactive [γ-32P] ATP supplied by Hartmann
Analytics, Braunschweig.
Composition of a 10 µl phosphorylation reaction:
1.5 µl [γ-32P] ATP (0.05 µM)
1 µl ATP (5 µM)
1 µl protein (here: sensor histidine kinase, 1µg)
6.5 µl TKMD buffer
The mixture was prepared on ice, whereas radioactive material was added at last. A sample
with H2O instead of ATP was used as a negative control. All samples were incubated at
30°C. After 10 minutes of incubation, 5 µl purified GlnR protein (10 x amount of kinase) were
added, followed by another 20 minutes of incubation. At different time points, 3 µl loading dye
were added and the samples were placed on ice. After that, the proteins were separated in
SDS PAGE (see section 3.3.3.4). To detect radioactivity, the gels were wrapped in plastic foil
and placed on a phosphor imaging plate for 90 minutes at -80°C. Signals were detected
using the BAP-IP MP 2025 reader (Fujifilm, Düsseldorf). To determine phosphorylation of
GlnR, some modifications were made to the protocol such as using higher amounts of
protein or adding 5 mM α-ketoglutarate or Na-glutamate or total cell extract of M. smegmatis.
The signal strengths detected on the phosphor imaging plate were analyzed using the
program ImageJ (http://rsbweb.nih.gov/ij/).
For phosphorylation of GlnR, acetyl [32P] phosphate was produced. For this purpose, 0.19 ml
pyridine, 0.3 ml 0.33 M K2HPO4 and 0.1 ml [32P] phosphoric acid were mixed on ice.
Subsequently, 22 µl acetic acid anhydride were slowly added. After three minutes of
incubation on ice, 4 M LiOH was added until pH 7.0 was reached. 4.5 ml 100 % ethanol were
added after another three minutes on ice and after that, the sample was incubated for one
more hour on ice. Accordingly, the sample was centrifuged for five minutes at 8,000 x g and
4°C and washed twice with 5 ml 100 % ethanol. After the pellet was dried for two hours, it
was solved in resuspension buffer.
The concentration of generated acetyl [32P] phosphate was measured in a Spectro-
Photometer (GE Healthcare, Munich) at 620 nm. Acetyl phosphate concentrations from 0.25
to 2.5 mM were used to generate a standard curve. Treatment of GlnR with acetyl [32P]
phosphate was performed according to Hiratsu et al. (1995) and Bouché et al. (1998). GlnR
was incubated with rising amounts of acetyl [32P] phosphate for 30 minutes at 30°C or with
50 mM acetyl [32P] phosphate, while samples were taken after 1, 5, 10, 15, 30 and 60
Materials and methods 47
minutes. For detection of radioactive signals in SDS PAGE, the samples were treated as
described above.
TKMD buffer:
50 mM Tris, 200 mM KCl, 5 mM MgCl2, 5 mM DTT, pH (HCl) 7.5, sterilization by filtration
5 x loading dye:
20 % (w/v) SDS, 60 % (w/v) glycerol, 250 mM Tris, 10 % (v/v) 2-mercaptoethanol,
0.01 % (w/v) serva blue G-250, pH (HCl) 6.8
Resuspension buffer:
50 mM Tris, 0.1 mM EDTA, 1 mM DTT, 5 % (w/v) glycerol, pH (HCl) 7.5
3.4 Genetic manipulation of bacteria
3.4.1 Preparation of competent E. coli cells
To generate chemically competent E. coli, the cells were cultivated in 4 ml LB medium
overnight. With this overnight culture, 100 ml LB medium were inoculated to an oD600 of 0.1
and cultivated to an oD600 of 0.4. The cells were subsequently centrifuged for 10 minutes at
4,000 x g and 4°C, before the cell pellet was resuspended in 40 ml cold, 50 mM CaCl2 and
incubated for 30 minutes on ice. After that, the cells were again centrifuged for 10 minutes at
4,000 x g and 4°C. The cell pellet was solved in 5 ml cold, 50 mM CaCl2. After 10 minutes
incubation on ice, 1.3 ml cold, 87 % glycerin were added and 100 µl aliquots were frozen in
liquid nitrogen. The competent cells were stored at -80°C until further usage.
3.4.2 Transformation of competent E. coli cells
Transformation of chemically competent E. coli cells (section 3.4.1) was performed using
heat shock process. After a 100 µl aliquot of cells was thawed on ice, 1-2 µl plasmid DNA
(section 3.3.1.1) or 10-20 µl ligation (section 3.3.1.9) were added. The mixture was incubated
for 30 minutes on ice. Absorption of plasmid DNA into the cells took place when a heat shock
was performed for 90 seconds at 42°C. Cells were subsequently incubated for another 30
minutes on ice, before 1 ml LB or SOC medium (see table 3, section 3.2.1) was added. After
that, the cell suspension was cultivated for one hour at 37°C and 700 rpm using a TS 100
Materials and methods 48
Thermoshaker (peqlab Biotechnologie GmbH, Erlangen). Finally, 200 µl of the cell
suspension were plated on LB plates containing the appropriate antibiotic (retransformation
with plasmids). For transformation with a ligation sample, the complete cell suspension was
centrifuged (2 min, 5,000 x g), resuspended in the backflow of medium and completely plated
on LB plates containing the appropriate antibiotic. The plates were incubated for 24 hours at
37°C.
3.4.3 Preparation of competent E. coli Rosetta2 cells and TSS transformation
Overexpression of tagged M. smegmatis proteins was carried out in E. coli Rosetta2 cells
which had been transformed using the TSS method according to Chung et al. (1989). For
preparation of competent cells, these were cultivated in 4 ml LB medium to an oD600 of 0.5.
2 ml of this cell suspension were centrifuged for one minute at 10,000 x g and 4°C, before
the cell pellet was solved in 200 µl cold TSS solution. 0.5-1 µg plasmid DNA was added
subsequently and the mixture was incubated for 30 minutes on ice. After addition of 800 µl
LB medium, the cells were regenerated for one hour at 37°C and 400 rpm using a TS 100
Thermoshaker (peqlab Biotechnologie GmbH, Erlangen). The complete sample was plated
on LB plates containing 25 µg/ml chloramphenicol and a second, appropriate antibiotic.
100 ml TSS solution:
10 g polyethylene glycol, 5 ml 100 % (v/v) DMSO, 5 ml 1M MgCl2, 50 ml 2 x LB medium,
sterilization by filtration
3.4.4 Preparation of electrocompetent M. smegmatis cells
To prepare electrocompetent M. smegmatis cells, 100 ml 7H9 medium were inoculated and
cultivated to an oD600 of 0.8. After that, cells were centrifuged (10 min, 4,000 x g, 4°C) and
the cell pellet was solved in 25 ml cold, 10 % (v/v) glycerin with 0.05 % (v/v) Tween80. After
recentrifugation, the remaining cell pellet was resuspended in 10 ml cold, 10 % (v/v) glycerin
with 0.05 % (v/v) Tween80 and centrifuged once more. Finally, the cell pellet was solved in
5 ml cold, 10 % (v/v) glycerin with 0.05 % (v/v) Tween80. 100 µl aliquots were immediately
frozen in liquid nitrogen and stored at -80°C until further usage.
Materials and methods 49
3.4.5 Transformation of electrocompetent M. smegmatis cells
Transformation of electrocompetent M. smegmatis cells was performed by electroporation.
After 100 µl competent cells (section 3.4.4) were thawed on ice, 1 µg plasmid DNA was
added. The mixture was incubated for further 10 minutes on ice and then transferred to a
cold electroporation cuvette with 2 mm electrode clearance (peqlab Biotechnologie GmbH,
Erlangen). Electroporation was carried out using a Gene-Pulser (Biorad, Munich) at 2.5 kV,
1000 Ω and 25 µF. Subsequently, cells were supplied with 1 ml SOC medium (see table 3,
section 3.2.1) and recovered for three hours at 37°C and 700 rpm using a TS 100
Thermoshaker (peqlab Biotechnologie GmbH, Erlangen). The complete cell suspension was
centrifuged (3 min, 5,000 x g), resuspended in the backflow of medium and completely plated
on 7H10 plates containing an appropriate antibiotic. The plates were incubated for 2-5 days
at 37°C.
3.4.6 Generation of genomic insertion and deletion mutants of M. smegmatis
To generate insertions or deletions in the genome of M. smegmatis, cells were transformed
(see section 3.4.5) with the plasmid pML814 carrying homologous sequences of the target
genes. After incubation of 4-7 days on 7H10 agar plates containing 50 µg/ml hygromycin B,
the arisen colonies were transferred to new 7H10-hygromycin plates to exclude
unspecifically grown colonies. From these cultures, the chromosomal DNA was prepared
(see section 3.3.1.4) and tested in Southern blot analyses (section 3.3.1.13). This procedure
was sufficient to determine mutants with insertion of the plasmid into target genes. While
generating deletion mutants with two homologous sequences upstream and downstream of
target genes, single and double cross overs occurred. This was also investigated in Southern
blot analyses (section 3.3.1.13). Cells showing single cross over were further cultivated
overnight at 37°C in 4 ml 7H9 medium containing 50 µg/ml hygromycin B. After that, cells
were filtered using a Filtropur S 5 µm filter (Sarstedt, Nümbrecht) and again cultivated as
described before. Afterwards, the oD600 was set to 0.05 and different dilutions were plated on
7H10 plates containing 50 µg/ml hygromycin B.
Using this procedure, cells were scattered and chances for a second single cross over were
increased. This was again examined in Southern blot analyses (section 3.3.1.13). After a
chromosomal double cross over, the target gene was exchanged against a hygromycin
resistance gene. To remove this, cells were transformed (section 3.4.5) with another plasmid,
pMN234, carrying the gene for Flpe recombinase for recombination of FRT sites, and plated
on 7H10 plates containing 25 µg/ml kanamycin. The resulting colonies were also cultivated
overnight at 37°C in 4 ml 7H9 medium containing 25 µg/ml kanamycin, filtered and plated on
Materials and methods 50
7H10 plates containing 25 µg/ml kanamycin as described above. Finally, colonies were
plated on 7H10 plates containing 50 µg/ml hygromycin B and 400 µg/ml streptomycin,
respectively. In a last Southern blot analysis (section 3.3.1.13), the removal of the
hygromycin resistance gene was monitored.
3.4.7 Fluorescence measurements
To determine GlnR-dependent promoter activities, the green fluorescent protein (GFP) was
used as a reporter. For this purpose, different promoter fragments were cloned into vectors
carrying the gfpuv gene. M. smegmatis cells were transformed with this constructs by
electroporation (see section 3.4.5) and cultivated as described in section 3.2.3. When cells
reached the exponential growth phase, a 10 ml sample was harvested by centrifugation
(10 min, 4,000 x g, 4°C) and resuspended in 1 x PBS buffer. To analyze the influence of
nitrogen starvation on the promoter activities, the rest of the cultures was centrifuged
(10 min, 4,000 x g, 4°C), resuspended in 7H9-N medium and incubated for further
30 minutes. Finally, another 10 ml sample was taken as described above.
After the samples were excited at a wavelength of 395 nm, the emission between 490 and
520 nm was detected in the fluorimeter Fluorolog 3 Double Spectrometer (Spex, Edison,
USA). Promoter strength was calculated depending on the fluorescence at 508 nm and the
dry weight of the cells per ml. An oD600 of 1 corresponds to 0.36 mg dry weight per ml
(Weinand, 2004).
1 l 1 x PBS buffer:
8 g NaCl, 3.58 g Na2HPO4 x 12H2O, 0.2 g KCl, 0.24 g K2HPO4, pH (HCl) 7.4
3.4.8 Fluorescence microscopy
M. smegmatis cells were grown, harvested and resuspended in 1 x PBS buffer as described
in section 3.4.7. 5 µl of the solution were transferred to an object slide and covered with a
cover slip. Fluorescence was detected using the LSM reverse laser microscope (Zeiss,
Göttingen) at the Institute for Clinical Microbiology, Friedrich-Alexander University Erlangen-
Nuremberg.
Materials and methods 51
3.4.9 β-galactosidase assays
To generate a more sensitive reporter system for measuring promoter activities, the lacZ
gene coding for β-galactosidase was used. M. smegmatis strains carrying plasmids
expressing the lacZ gene under the control of different promoters were grown as described in
section 3.4.7. When cells reached the exponential growth phase, the oD600 was exactly
determined and 1 ml sample was centrifuged (2 min, 4,000 x g, 4°C), subsequently frozen in
liquid nitrogen and stored at -80°C.
On the next day, the cell pellets were thawed on ice and resuspended in 1 ml 1 x Z buffer
before they were transferred to Cryo tubes (Thermo Scientific, Denmark) containing glass
beads. Cells were disrupted as described in section 3.3.2.1. Cell debris and glass beads
were removed by centrifugation (3 min, 13,000 x g, 4°C). The supernatant was transferred to
a new reaction tube. 300 µl 1 x Z buffer were mixed with 25 µl 0.1 % SDS, 50 µl CHCl3 and
200 µl 5 x Z buffer with 2-mercaptoethanol. 500 µl of the cell supernatant were added at last.
After 20 minutes of incubation at 28°C, 200 µl fresh ONPG solution were added under
vortexing. Samples were further incubated until a strong yellow coloring was visible. Then the
reaction was stopped by adding 500 µl 1M Na2CO3. Finally, the absorption at 420 and 550
nm was measured using the photometer Ultraspec 2100 pro (Amersham Biosciences, USA).
β-galactosidase activity was calculated in Miller Units according to the following formula:
MU =
5 x Z buffer:
300 mM Na2HPO4 x 12 H2O, 200 mM NaH2PO4 x H2O, 50 mM KCl, 5 mM MgSO4 x H2O
5 x Z buffer with 2-mercaptoethanol:
50 ml 5x Z buffer, 850 µl 2-mercaptoethanol
ONPG solution:
4 mg/ml ONPG in 1 x Z buffer with 2-mercaptoethanol
A420 - 1.75 x A550
A600 x V x t
Materials and methods 52
3.4.10 Determination of urease activity
For determination of urease activity in M. smegmatis, an indophenol test was performed
according to Jahns et al. (1988), in which ammonium can be detected. Cells were grown as
described in section 3.2.3. When cells reached exponential growth, 20 ml were harvested by
centrifugation (10 min, 4,000 x g, 4°C), washed in 20 ml KH2PO4 buffer and resuspended in
500 µl KH2PO4 buffer. The rest of the cells was also centrifuged (10 min, 4,000 x g, 4°C),
washed and incubated for 30 minutes in 7H9-N medium, before another sample was taken
as described above.
Cells were transferred to Cryo tubes (Thermo Scientific, Denmark) containing glass beads
and disrupted by vigorous shaking at 6.5 m s-1 for 30 seconds in a FastPrep FP120
instrument (Q-BIOgene, Heidelberg). After five minutes of incubation on ice, the disruption
step was repeated twice. After that, samples were centrifuged for 20 minutes at 13,000 x g
and 4°C to remove cell debris and glass beads. Protein concentrations of all samples were
measured using the application “Protein A280” of the Nanodrop® spectrometer ND-100
(peqlab Biotechnologie GmbH, Erlangen). 50 and 200 µl cell extract were filled with KH2PO4
buffer to a final volume of 1 ml and incubated for 10 minutes at 37°C. After that, 50 µl of a
200 mM urea solution were added, followed by further incubation at 37°C for 15 minutes. To
start the indophenol reaction, 1 ml solution 1 and 1 ml solution 2 were added to each sample,
followed by another incubation at 50°C for 15 minutes. “Blind samples” (addition of urea after
solution 1 and 2) used as references to the actual samples were carried along, as well as
rising concentrations of ammonium (100 µM to 5 mM) to generate a calibration curve. The
absorption of all samples at a wavelength of 546 nm was measured in plastic cuvettes (bio
one, Greiner, Essen) in the photometer Ultraspec 2100 pro (Amersham Biosciences, USA).
Urease activity was calculated as units per mg protein according to the following formula:
Urease activity =
KH2PO4 buffer:
50 mM KH2PO4, pH (KOH) 7.0
Solution 1:
4.72 ml phenol, 0.025 g sodium nitroprusside in 100 ml H2O
Solution 2:
6.25 g NaOH, 13.125 ml sodium hypochlorite in 250 ml H2O
µmol generated ammonium
1 min x mg protein
Results 53
4 Results
4.1 General analyses of nitrogen metabolism and control in M. smegmatis
4.1.1 Utilization of different nitrogen sources
At the beginning of this study, only few experimental data were available about the ability of
M. smegmatis to use different nitrogen sources and especially about the role of GlnR in the
corresponding processes. In a bioinformatic approach, various genes coding for uptake and
assimilation systems for ammonium, nitrate, nitrite, urea and others were identified,
suggesting the ability of M. smegmatis to utilize a variety of different substrates as nitrogen
sources (Amon et al., 2009). Furthermore, ammonium, alanine, asparagine, glutamic acid,
glutamine, nitrate, nitrite and urea have already been proven to suffice as single nitrogen
source for the M. smegmatis wild type (Iwainsky and Sehrt, 1967; Ahmad et al., 1986;
Sritharan et al., 1987).
In this study, all amino acids, bases and different inorganic substrates were tested. Growth of
the M. smegmatis wild type SMR5 and the glnR deletion strain MH1 was observed over 72
hours in 7H9-N minimal medium, to which either 10 or 100 mM of the corresponding
substrate were added as putative nitrogen source. Substances such as tryptophan, tyrosine,
adenine, guanine, thymine, uracil and uric acid were only added in 10 mM, as higher
amounts were not dissolved in the medium. Moreover, nitrite concentrations higher than
10 mM were toxic for the cells. Significant changes in growth behavior were only inspected
within the first 32 hours. All growth experiments were carried out in triplicates, while one
representative growth curve for each putative nitrogen source is shown in figure 6 and 7. A
sample with 7H9 minimal medium was always carried along as a positive control, where the
generation time of SMR5 as well as of MH1 was 4-5 hours and a maximum oD600 of 4 was
reached (see figure 8 and 9). 7H9-N lacking any nitrogen source was used as negative
control; as expected, no growth was detected and cells reached a maximum oD600 of 0.7,
which was less than two doublings. To distinguish between growth behavior of the wild type
and the glnR deletion strain, a 7H9 sample to which MSX was added was carried along.
MSX is a glutamate analog that blocks GS activity (Berlicki, 2008). It has already been
shown before, that due to artificially caused nitrogen starvation the glnR deletion strain MH1
was no longer able to grow in this medium compared to the wild type (Amon et al., 2008).
Independently from the concentration, no growth was detected when glycine, phenylalanine,
adenine, thymine, creatinine, glucosamine or N-acetylglucosamine were used as nitrogen
Results 54
Results 55
Fig. 6: Growth of M. smegmatis with different substrates used as single nitrogen source. Substrates were added in a final concentration of 10 mM. □: SMR5 (wild type strain); ■: MH1 (glnR deletion strain); ○: wild type strain DSM 43756.
Results 56
Results 57
Fig. 7: Growth of M. smegmatis with different substrates used as single nitrogen source. Substrates were added in a final concentration of 100 mM. □: SMR5 (wild type strain); ■: MH1 (glnR deletion strain); Δ: SMR5 (addition of trace element solution); ○: wild type strain DSM 43756.
sources (see figure 6 and 7). Surprisingly, although also classified as nitrogen source for
M. smegmatis before (Iwainsky and Sehrt, 1967), no growth was visible with urea. As a
result, the same growth experiment was carried out adding a trace element solution required
for growth of C. glutamicum (see table 3, section 3.2.1) and moreover, with an alternative
M. smegmatis wild type strain, namely DSM 43756, which corresponds to type strain NCTC
8159. But even these cells were not able to utilize urea as single nitrogen source under the
tested conditions (see figure 6 and 7).
However, M. smegmatis SMR5 grew poorly in media where isoleucine, leucine, lysine,
methionine, tryptophan, tyrosine or methylamine was used as nitrogen source (figure 6 and
7). The cells showed a generation time of up to 30 hours which was slightly improved at
higher substrate concentrations (figure 8A) and reached an oD600 of fairly higher than 1
(figure 9A). Nevertheless, cells were able to grow on 7H10 agar plates containing these
substances, indicating that they could still be used as nitrogen sources (figure 10).
Detectable growth of the wild type close to 7H9 minimal medium existed in media with
aspartic acid, cysteine, glutamic acid, histidine, threonine and valine as well as guanine,
uracil, ammonium chloride, ammonium sulfate, ethanolamine, ferric ammonium citrate,
potassium nitrate, sodium nitrite and uric acid as single nitrogen source (figure 6 and 7). In
some cases, growth rates were even improved by increasing the substrate concentration, but
never reached 7H9 level (figure 8A), whereas the maximum oD600 in 7H9 medium was partly
outrun (figure 9A). Maximum growth of the wild type SMR5 was achieved using the amino
acids alanine, arginine, asparagine, glutamine, serine and proline as single nitrogen source
(figure 6 and 7). While growth rates such as in 7H9 medium were not quite reached (figure
8A), the maximum oD600 was easily exceeded (figure 9A).
Recapitulating these data, it was found that M. smegmatis can indeed utilize a variety of
organic and inorganic substances as single nitrogen source to guarantee growth. Regarding
Results 58
GlnR as the major regulatory protein of nitrogen metabolism in M. smegmatis, the question
arose if it is also involved in uptake and/or assimilation of these newly found nitrogen
sources. For this purpose, all growth experiments were also carried out with the glnR
deletion strain MH1. While growth in some media was unaffected by the absence of GlnR,
there was a distinct difference in media with alanine, histidine, proline, serine, guanine,
uracil, ethanolamine, potassium nitrate, sodium nitrite and uric acid, where the glnR deletion
strain showed extremely reduced or no growth compared to the wild type. This was observed
with either 10 or 100 mM substrate concentration (figure 6 and 7). The generation times of
MH1 were intensely increased compared to the wild type (figure 8B), while the maximum
oD600 was reduced (figure 9B). Reduced growth of the glnR deletion strain was also
observed when aspartic acid, isoleucine, leucine, lysine and methionine were used as single
nitrogen source, even though the wild type showed very slow and poor growth (see figure 6,
7, 8B and 9B). These results indicated that GlnR is indeed involved in uptake and/or
assimilation of a multitude of different substances that can be used as nitrogen sources.
Growth was not only tested in liquid cultures, but also on 7H10 agar plates. 10 mM of every
substrate that has been tested before were added to 7H10-N agar plates as single nitrogen
source. Plates were incubated for 48 hours, confirming the data obtained before: the
M. smegmatis wild type or the glnR deletion strain did not grow on plates containing glycine,
phenylalanine, adenine, thymine, creatinine, glucosamine, N-acetylglucosamine or urea
(figure 10). On plates, it could no longer be distinguished between poor and strong growth of
the wild type, as large colonies were visible on plates containing all other tested substrates
(figure 10). Furthermore, the slight differences in growth between wild type and glnR deletion
strain in media containing aspartic acid, isoleucine, leucine, lysine and methionine as well as
the strong difference in media containing histidine and ethanolamine monitored before were
no longer detectable due to the long incubation time of the plates. Nevertheless, growth
differences in media containing alanine, proline, serine, guanine, uracil, potassium nitrate,
sodium nitrite and uric acid were clearly visible (figure 10).
Results 59
A
B
Fig. 8: Generation times calculated from growth curves of M. smegmatis. A. Comparison of generation times of the wild type SMR5 in all media where growth was observed (see figure 6 and 7). B. Comparison of the generation times of wild type and glnR deletion strain in media where growth of the wild type was observed before. Generation times higher than 35 h are represented by open bars (only MH1, indicating no growth in these media). Turquoise: generation times in 7H9 medium as a control; light blue: 10 mM substrate; dark blue: 100 mM substrate; filled bars: wild type SMR5; patterned bars: glnR deletion strain MH1.
Results 60
A
B
Fig. 9: Maximum oD600 reached during growth of M. smegmatis. A. Comparison of the maximum oD600 of the wild type SMR5 in all media where growth was observed (see figure 6 and 7). B. Comparison of the maximum oD600 of wild type and glnR deletion strain in media where growth of the wild type was observed before. Turquoise: oD600 in 7H9 medium as control; light blue: 10 mM substrate; dark blue: 100 mM substrate; filled bars: wild type SMR5; patterned bars: glnR deletion strain MH1.
Results 61
His Ile Leu Lys Met
Phe Pro Ser Thr Trp
Sodium nitrite Urea Uric acid
7H10 7H10-N Ala Arg Asn
Asp Cys Gln Glu Gly
Tyr Val Adenine Guanine Thymine
Uracil Ammonium chloride Ammonium sulfate Creatinine Ethanolamine
Ferric ammonium citrate Glucosamine Methylamine N-acetylglucosamine Potassium nitrate
Fig. 10: Growth of M. smegmatis on 7H10 agar plates. Each plate contained 10 mM of a putative nitrogen source. 7H10 and 7H10-N minimal medium were carried along, each as positive and negative control. Amino acids, bases and inorganic substances were tested as single nitrogen source for the wild type SMR5 (left) and the glnR deletion strain MH1 (right). Plates were incubated for 48 hours.
4.1.2 Relation between growth behavior and initiation of nitrogen response
It was of special interest for this study not only to identify substrates which can be utilized as
nitrogen sources by M. smegmatis, but also to identify the regulatory network behind these
processes. For that reason, it was tested which substrate caused nitrogen response in the
wild type SMR5 (see figure 11). Nitrogen response is defined as the upregulation of genes
involved in central nitrogen metabolism to guarantee sufficient nitrogen (ammonium) supply
under limiting conditions. For M. smegmatis, it has already been shown that the transcript
levels of the genes glnA (encoding glutamine synthetase I), amtB and amt1 (encoding
ammonium transporters) were enhanced when cells were transferred from nitrogen-rich
medium to a medium lacking any nitrogen source (Amon et al., 2008).
Results 62
No growth Poor growth Growth
7H9
7H9-N
Gly
Phe
Adenine
Thymine
Creatinine
Glucosamine
N-acetylglucosamine
Urea
7H9
7H9-N
Ile
Leu
Lys
Met
Trp
Tyr
Methylamine
7H9
7H9-N
Ala
Arg
Asn
Asp
Cys
Gln
Glu
His
Pro
Ser
amtB amtB amtB
Thr
Val
Guanine
Uracil
Ammonium chloride
Ammonium sulfate
Ethanolamine
Ferric ammonium citrate
Potassium nitrate
Sodium nitrite
Uric acid
amtB
Fig. 11: Transcript level of amtB in M. smegmatis SMR5 incubated with different substrates as single nitrogen source. After 20 minutes growth in the different media, total RNA was prepared from the cells and hybridized with an amtB probe. Samples were divided corresponding to the growth ability observed before. A 7H9 sample was carried along as negative control (weak signal), a 7H9-N sample as positive control (strong signal of amtB). An enhanced amtB transcript level was seen in media with phenylalanine, adenine, thymine, N-acetylglucosamine, tyrosine, methylamine, arginine, glutamic acid, histidine, proline, threonine, ethanolamine, potassium nitrate and sodium nitrite.
In this study, the genes amtA and amtB (encoding ammonium transporters) as well as urtA
(encoding a urea transporter) were tested in the wild type SMR5 depending on different
nitrogen sources. As the results for these three genes were similar, only amtB is shown in
figure 11. Surprisingly, a clear correlation between growth ability and nitrogen response was
not detected. An increase of transcript was monitored in media with phenylalanine, adenine,
thymine, N-acetylglucosamine, tyrosine, methylamine, arginine, glutamic acid, histidine,
proline, threonine, ethanolamine, potassium nitrate and sodium nitrite, while the cells were
only able to utilize half of these substrates as nitrogen sources.
Only a very small amount or no transcript was detected in the other 21 tested media (see
figure 11), again independently from the ability of the bacteria to use them as nitrogen
sources. This led to the conclusion that uptake and assimilation of these substrates is not
subject to nitrogen control in M. smegmatis.
Results 63
amtB
Controls Addition of ammonium Addition of glutamine
0 5 10 15 30 60 0 5 10 15 30 60 min
Special attention was paid to the samples containing ammonium, glutamine and glutamate.
Regarding nitrogen metabolism, a very important question is which molecule indicates the
nitrogen status of the cells and is thus responsible for activation of nitrogen response.
Considering the GDH/GS/GOGAT-model (see section 2.2.1), these mechanisms are used to
provide the cells with sufficient amounts of nitrogen in form of glutamine and glutamate. It
has already been shown in this study that nitrogen response of M. smegmatis is activated
when glutamate is supplied as the only nitrogen source, and not activated or even inhibited in
the presence of ammonium or glutamine (figure 11). A second RNA hybridization experiment
revealed the correlation of these observations. Cells were grown with 100 mM glutamate as
single nitrogen source, before 100 mM ammonium chloride or glutamine were added. The
mRNA levels of amtA, amtB and urtA were monitored at different time points. As the results
for these three genes were similar, only amtB is shown in figure 12.
Fig. 12: Transcript level of amtB, depending on the substrate used as nitrogen source. Cells were incubated in medium containing 100 mM glutamate (control 1, positive) and in media containing 100 mM glutamate and 100 mM ammonium chloride or 100 mM glutamine, respectively (control 2 and 3, negative). When cells reached exponential growth phase, 100 mM ammonium chloride or glutamine were added to control 1, respectively, and samples were taken after 0, 5, 10, 15, 30 and 60 minutes.
As observed before, the transcript level of amtB was high when glutamate was used as
single nitrogen source. As a control, samples with glutamate and glutamine, and glutamate
and ammonium were carried along, showing no amtB signal. This indicated a negative and
stronger influence of glutamine and ammonium to the activation of nitrogen response
compared to glutamate. When 100 mM ammonium or glutamine were added to cells already
growing in medium with glutamate, the amtB signal was intensely decreased after five
minutes and completely disappeared after 10 minutes. Thus, it can be concluded that
glutamate is not the indicator of the nitrogen status of M. smegmatis; it is rather possible that
the intracellular glutamine level, which is increased by GS using ammonium, signalizes the
cells’ nitrogen surplus or limitation.
Results 64
0
0.5
1
1.5
2
SMR5 +N DSM43756 +N SMR5 -N DSM43756 -N
µm
olN
H4
+m
in-1
(mg
pro
tein
)-1
Urease activity in M. smegmatisUrease activity in M. smegmatis
µm
olN
H4
+m
in-1
(mg
pro
tein
)-1
SMR5 +N DSM 43756 +N SMR5 -N DSM 43756 -N
4.1.3 Uptake and assimilation of urea
Surprisingly, performing growth experiments with M. smegmatis using different substances
as single nitrogen source, no growth was detected upon the addition of urea (see section
4.1.1). Nevertheless, various genes important for uptake and assimilation of urea exist in
M. smegmatis (Amon et al., 2009) and growth with urea as nitrogen source has already been
described (Iwainsky and Sehrt, 1967). To exclude mutations in the laboratory strain SMR5
used in this study, growth experiments were repeated with an alternative wild type strain,
DSM 43756, also considered as urease-positive (www.dsmz.de). But even this strain was not
able to utilize urea as nitrogen source under the tested conditions (see section 4.1.1).
Consequently, the ability of these two M. smegmatis strains to degrade urea was
determined. As ureases catalyze hydrolysis of urea to CO2 and ammonia, the production of
ammonium was measured using an indophenol reaction. Urease activities of SMR5 and
DSM 43756, prior incubated under nitrogen surplus and starvation, were calculated as µM
produced ammonium per minute per mg protein (figure 13).
Fig. 13: Urease activity measurement in M. smegmatis strains SMR5 and DSM 43756. Cells were previously incubated under nitrogen surplus (+N) and starvation (-N). Urease activity was calculated as µM produced ammonium per minute per mg protein.
As shown in figure 13, both M. smegmatis strains had similar urease activities of 1 µmol
produced ammonium per minute per mg protein, which were barely increased under nitrogen
starvation. This indicated that a functional urease converting urea into ammonium existed in
both of the tested strains, even though no growth was observed with urea as single nitrogen
source under the tested conditions. Thus, the reason for this still remains unknown.
Results 65
4.1.4 Generation of an in vivo reporter system for nitrogen response
So far, this study revealed the response of M. smegmatis on gene transcript level to varying
nitrogen sources and suggested an important role of GlnR in these processes. To further
investigate this, a functional system, which can be used to characterize nitrogen- and
especially GlnR- dependent response, should be developed. In C. glutamicum, a closely
related actinomycete, a reporter system based on GFP, the green fluorescent protein, has
already been established (Jeßberger, 2008). With this system, it was possible to monitor
changes in promoter activities of gdh, amtA and amtB (and others), according to the nitrogen
status of the cells or the presence or absence of AmtR, the global regulatory protein of
nitrogen metabolism in this species (see section 2.2.3). Since GlnR has a great influence on
the transcript levels and thus promoter activities of amtB and glnA in M. smegmatis (Amon et
al., 2008), their corresponding promoter sequences were cloned upstream of the gfpuv gene
into an appropriate M. smegmatis vector and cells of the wild type and the glnR deletion
strain were transformed with these constructs. Additionally, also promoter sequences of
amtA, gdhA (msmeg_5442, further described as gdh) and glnR were used, as well as a
promoterless construct as negative control and a construct with psmyc, a strong
mycobacterial promoter, as positive control.
Cells were incubated in 7H9 medium until exponential growth phase and then transferred
into nitrogen-free medium, followed by another 30 minutes of incubation. Promoter activities
of all samples were calculated depending on the fluorescence and the dry weight of the cells
per ml. Contrary to expectations, fluorescence and thus promoter activity decreased under
nitrogen starvation (see figure 14). Detectable promoter activity was only seen in cells
transformed with psmyc-gfp, a strong and nitrogen-independent mycobacterial promoter;
whereas signals were significantly lower than in similar measurements with C. glutamicum
(Jeßberger, 2008). None of the remaining promoters showed increased activity under
nitrogen starvation, although this was expected for amtA, amtB and glnA promoter in the wild
type and should only be reversed in the absence of GlnR (MH1). In fact, promoter activities
of all tested constructs decreased under nitrogen starvation in the wild type as well as in the
glnR deletion strain (figure 14). Even when experimental conditions were varied from using
higher amounts of cells to longer or shorter incubation times in nitrogen-free medium or
adding MSX to induce nitrogen starvation, no stronger fluorescence signal could be detected
in any of the tested constructs (data not shown). This led to the conclusion that this GFP-
dependent system for measuring changes in nitrogen response was not functional in M.
smegmatis. This was also confirmed by fluorescence microscopy, where only cells
transformed with the psmyc-gfp construct were detected (figure 15).
Results 66
SMR5 MH1
Promoter activities M. smegmatis SMR5 vs. MH1
- psmyc amtAp amtBp glnAp gdhp glnRp - psmyc amtAp amtBp glnAp gdhp glnRp
SMR5 MH1
Pro
mote
r activity
900000
800000
700000
600000
500000
400000
300000
200000
100000
0
Fig. 14: Promoter activities of M. smegmatis strains SMR5 and MH1. Both strains, carrying gfpuv constructs with no promoter, psmyc, amtAp, amtBp, glnAp, gdhp and glnRp, were grown under nitrogen surplus and limitation. After fluorescence was measured at 508 nm, promoter activities were calculated as fluorescence per oD600 x 0.36 g dry weight per ml. Filled bars: wild type SMR5; striped bars: glnR deletion strain MH1; light blue: 7H9 medium, nitrogen surplus; dark blue: 7H9-N medium, nitrogen starvation.
Fig. 15: Fluorescence microscopy of M. smegmatis strains SMR5 and MH1. Only cells
transformed with the construct psmyc-gfpuv showed fluorescence.
Results 67
β-galactosidase activities SMR5 vs. MH1
Activity
(MU
)
Activity
(MU
)
psmyc - amtAp amtBp glnAp gdhp glnRp - amtAp amtBp glnAp gdhp glnRp
SMR5 MH1 SMR5 MH1
180
160
140
120
100
80
60
40
20
0
30
25
20
15
10
5
0
Due to the fact that a reporter system for detection of changes in nitrogen response based on
GFP was not functional in M. smegmatis, another reporter system based on β-galactosidase
activity measurements was tested. For this purpose, the gfpuv gene was replaced by the
lacZ gene (from E. coli, derived from pWH948, see table 2, section 3.1) in the existing
constructs (see above). These were again used to transform cells of the M. smegmatis
strains SMR5 and MH1. Cells were grown as described above. β-galactosidase activities
were calculated in Miller units from optical density of the samples at 600, 550 and 420 nm
and are shown in figure 16. Again, the strongest activity was obtained with the psmyc
construct, independently from nitrogen supply. Different from the GFP-system, an increase of
promoter activity for the amtA, amtB and glnA promoter was observed in the wild type under
nitrogen starvation, not for gdh and glnR promoter. In the strain MH1 lacking GlnR, no
increase of activity for any tested promoter was detected under nitrogen starvation. These
results confirmed the expectation that the presence of GlnR is necessary for an enhanced
activity of the promoters of amtA, amtB and glnA, even though the calculated
β-galactosidase activities were very low and the differences between nitrogen surplus and
starvation were not distinctly demonstrated.
Fig. 16: β-galactosidase activities of M. smegmatis strains SMR5 and MH1. Cells were transformed with plasmids carrying the lacZ gene under the control of psmyc, amtAp, amtBp, glnAp, gdhp and glnRp. After cells were grown in 7H9 medium until exponential growth phase and incubated for further 30 minutes under nitrogen starvation, β-galactosidase activities were calculated depending on optical density of the samples at 420, 550 and 600 nm. Filled bars: wild type SMR5; striped bars: glnR deletion strain MH1; light blue: 7H9 medium, nitrogen surplus; dark blue: 7H9-N medium, nitrogen starvation.
Results 68
4.1.5 Purification of GlnR
Considering the data obtained in this study so far, it is clear that the regulatory protein GlnR
plays an important role in M. smegmatis, generally in uptake and assimilation of different
nitrogen sources and particularly in the regulation of genes involved in nitrogen metabolism,
such as amtA, amtB or glnA. No data of the GlnR protein itself were available at the
beginning of this study. Therefore, another important aim of this study was to develop
functional overexpression and purification methods to supply high amounts of pure GlnR
protein for further experiments such as DNA binding assays or the generation of a GlnR-
specific antibody. Efforts to purify GlnR with different approaches are described below.
A very common approach to isolate a specific protein from total cell extract is to add a tag
consisting of six histidine residues, which binds specifically to a Ni2+ matrix in affinity
chromatography. First, an E. coli Rosetta2 strain carrying a pUC19-his-glnR construct (see
table 2, section 3.1) was used. This strain also carried a second plasmid, pRARE, encoding
rarely used tRNA species in E. coli. When cells reached exponential growth, overexpression
of the protein was induced by adding IPTG. After four hours, cells were harvested and
disrupted. After that, the His-GlnR protein was separated from total cell extract by binding of
the tag to a Ni2+ NTA matrix in an affinity column (see figure 17A). Binding was released by
adding rising concentrations of imidazole. The size of the purified protein was tested in SDS
PAGE and in Western blot analysis using a His-specific antibody. Size of M. smegmatis GlnR
combined with six additional histidine residues was 30 kDa. Weak bands of this size were
detected both in SDS PAGE and Western blot (figure 17A), but another band of
approximately 13 kDa was dominant. This appearance in Western blot analysis, where a His-
specific antibody was used, led to the conclusion that His-GlnR was either dismantled during
purification or not even correctly synthesized in E. coli.
Therefore, the his-glnR construct was cloned into the vector pMN016 suitable for
M. smegmatis SMR5. This strain was grown for 10 hours to mid-exponential growth phase
and harvested subsequently. The his-glnR construct was constitutively expressed from the
non-inducible, strong mycobacterial promoter psmyc. His-tagged proteins were again
separated from total cell extract as described above and purification was controlled in SDS
PAGE and Western blot using a His-specific antibody (figure 17B). Only a single band at size
of approximately 60 kDa was visible and identified via mass spectroscopic analysis as
GroEL1, the bigger subunit of a mycobacterial chaperone, naturally equipped with seven
histidine residues at its C-terminal end and thus blocking the binding sites at the Ni2+ NTA
matrix. As it was not possible to purify His-GlnR from M. smegmatis SMR5, another strain
was used, namely M. smegmatis ML371. In this strain, DNA of the mycobacteriophage BxbI
is integrated at the 3’-end of the groEL1 gene changing the ability of the GroEL1 protein to
bind to the purification column. This new strain was transformed with the pMN016his-glnR
Results 69
construct and treated as described above. SDS PAGE and Western blot analysis using a
His-specific antibody revealed that only one specific protein with a size of 30 kDa was
purified (figure 17C), most likely His-GlnR. Figure 17A-C shows all results for purification of
GlnR bound to an N-terminal His-tag. These results were also obtained when the six histidine
residues were attached to the C-terminus of GlnR (data not shown).
In parallel, a different approach using MBP (maltose binding protein) as affinity tag was
carried out. Here, GlnR was fused to the C-terminus of MBP by cloning the glnR gene into
the vector pMal-c2. E. coli Rosetta2 cells were transformed with this construct and treated as
described above. The gene fusion was overexpressed for four hours in the presence of
IPTG. After cells were harvested and disrupted, the MBP-GlnR fusion protein was separated
from total cell extract by binding of MBP to an amylose resin matrix in affinity
chromatography (figure 17D). The pure fusion protein was released by adding rising
concentrations of maltose. Purity was tested once more in SDS PAGE and Western blot
analysis using an MBP-specific antibody. As MBP is a large protein of a size of 44 kDa, the
MBP-GlnR fusion protein was detected at a size of approximately 71 kDa (figure 17D). After
the fusion protein was cleaved by protease factor Xa at its cleavage site, the resulting
proteins were separated by gel filtration. While two peaks indicating two protein fractions of
different size were identified during gel filtration, a single 30 kDa band representing GlnR
could not be detected in SDS PAGE (figure 17D), indicating that it was not possible to cleave
the MBP-GlnR fusion protein without the loss of GlnR. Nevertheless, the fusion protein was
used in a variety of following experiments, as MBP did not affect e.g. DNA binding manners
of GlnR (see section 4.1.7).
Furthermore, GlnR was also attached to an N-terminal Strep-tag by cloning the glnR gene
into the vector pASK-IBA5plus. The construct was used to transform E. coli Rosetta2 cells as
described above. Cells were again incubated until exponential growth phase, before
overexpression of the strep-glnR fusion was carried out for four hours in the dark in the
presence of doxycycline. After cells were harvested and disrupted, Strep-tagged proteins
were purified using a Strep-TactinR-SepharoseR matrix in a hand column. The Strep-tagged
GlnR protein was released by adding D-desthiobiotin and could be detected in SDS PAGE
and Western blot analysis using a Strep-specific antibody (figure 17E). Later in this study,
other M. smegmatis proteins such as Msmeg_1918 and Msmeg_5241 (see section 4.3.1), as
well as M. tuberculosis GlnR (see section 4.5) were purified via MBP- or Strep-tag. Strep-
tagged GlnR was also used in following experiments such as DNA binding assays,
phosphorylation experiments, pull down assays or the generation of a GlnR-specific
antibody.
Results 70
85 kDa
70 kDa
30 kDa
15 kDa
10 kDa
Purification protocol SDS PAGE Western blot
72 kDa
34 kDa
17 kDa
10 kDa
A
72 kDa
55 kDa
60 kDa
B
30 kDa
72 kDa
34 kDa
C
D
80 kDa
70 kDa72 kDa
55 kDa
E
85 kDa
70 kDa
50 kDa
30 kDa
15 kDa
1 2
55 kDa
34 kDa
50 kDa
30 kDa
SDS PAGE Western blot
Gel filtration SDS PAGE
1
2
Fig. 17: Purification of M. smegmatis GlnR. Purification protocols (Äkta apparatus) are shown as far as available, as well as detection of purified proteins in SDS PAGE and Western blot analyses. A. Purification of His-GlnR from E. coli Rosetta2. Samples indicated by a peak in the purification protocol did not show sufficient amounts of protein at GlnR size of 30 kDa, neither in SDS PAGE nor in Western blot using a His-specific antibody. B. Purification of His-GlnR from M. smegmatis SMR5. SDS PAGE, Western blot with His-specific antibody and mass spectroscopic analyses showed the 60 kDa protein GroEL1. C. Purification of His-GlnR from M. smegmatis ML371. Due to changes in GroEL1, only the 30 kDa His-GlnR protein was detected in SDS PAGE and Western blot. D. Purification of MBP-GlnR from E. coli Rosetta2. The 71 kDa fusion protein was detected both in SDS PAGE and Western blot using an MBP-specific antibody. Cleavage of the fusion and purification of the single GlnR protein via gel filtration did not result in a protein of correct size of 30 kDa. E. Purification of Strep-GlnR from E. coli Rosetta2 in a hand column. The Strep-GlnR protein was detected at a size of 30 kDa both in SDS PAGE and Western blot analysis using a Strep-specific antibody.
Results 71
72 kDa
55 kDa
36 kDa
4.1.6 Generation of a GlnR-specific antibody
To detect even small amounts of GlnR in different experimental samples or cell extracts, it is
greatly beneficial to have an antibody that specifically binds GlnR. For that purpose, high
amounts of GlnR were purified using the Strep-system as described in section 4.1.5. After
testing of rabbit pre-immune serums, 2 mg Strep-GlnR were sent to Pineda AK Service,
Berlin, where an appropriate rabbit was immunized with the protein sample. Every 30 days,
the specificity of the originating antibody was tested in Western blot analysis using purified
GlnR and total cell extract of the M. smegmatis wild type strain SMR5 as targets. Figure 18
shows the results of the Western blot analysis after 150 days.
Fig. 18: Ability of the GlnR-specific antibody to distinctly bind GlnR. Western blot analysis was carried out after 150 days. The antibody was used in a 1:50.000 dilution. Targets were purified Strep-GlnR, MBP-GlnR, Strep-Msmeg_1918, purified AmtR protein of C. glutamicum and total cell extract of M. smegmatis strains SMR5 and MH1.
As expected, the antibody was able to detect purified Strep-GlnR (31 kDa) which had been
used to immunize the rabbit before. Furthermore, also GlnR protein purified with MBP-tag
(71 kDa) was bound by the antibody. Another M. smegmatis protein, Msmeg_1918, also
attached to a Strep-tag, was visible at size of 54 kDa, indicating that the antibody recognized
not only GlnR, but also the Strep-tag, no matter which protein was attached. But the
specificity of the antibody was still guaranteed, as purified AmtR protein from C. glutamicum
was not detected. Moreover, the antibody was specific enough not only to detect purified
GlnR, but also GlnR protein in total cell extract of M. smegmatis SMR5 at a size of 28 kDa.
No signal was detected when total cell extract of the glnR deletion strain MH1 was used.
Consequently, the generation of a GlnR-specific antibody was successful and the functional
antibody could be used for further experiments such as detecting GlnR mutants (see section
4.3.2).
Results 72
4.1.7 DNA binding ability of purified GlnR
At the beginning of this study, it was already clear that GlnR has a great influence on the
transcript levels of genes involved in nitrogen metabolism in M. smegmatis, such as amtB or
glnA (Amon et al., 2008). Due to the fact that the mRNA signals of these genes were
dramatically decreased in the glnR deletion strain compared to the wild type under nitrogen
starvation, it was assumed that GlnR works as transcriptional activator of its target genes.
Such a protein activates transcription by RNA polymerase by binding to specific sites at the
promoter region of its target gene. In a previous study where no purified GlnR was available,
DNA binding assays were performed using a 220 bp DNA fragment directly upstream of the
amtB start codon and total cell extract of M. smegmatis strains SMR5 and MH1 (Bräu, 2008).
Indeed, a slight shift of the DNA on an electrophoretic gel was detected in the SMR5 sample,
which was even increased when total cell extract of this strain incubated under addition of
MSX was used, and which was not visible using total cell extract of the glnR deletion strain
MH1. MSX is a glutamate analog that blocks GS activity (Berlicki, 2008) and thus, induces
nitrogen response in the wild type strain (Amon et al., 2008). These results led to the
conclusion that GlnR actually binds to the promoter region of amtB and that this is even
enhanced under nitrogen limitation.
To investigate these processes in detail, purified GlnR (see section 4.1.5) was necessary.
While a detailed characterization of DNA binding manners of GlnR is presented later in this
study (see section 4.2.4), it is shown in figure 19 that every GlnR protein purified with a
different approach (see section 4.1.5) was able to bind to the 220 bp amtB promoter
fragment described above. The digoxigenin-labeled DNA fragments were separated via gel
electrophoresis and later visualized using an anti-digoxigenin-alkaline-phosphatase
conjugate. When rising amounts of purified GlnR were added, a distinct shift of DNA was
visible, as the DNA-protein complex of bigger mass passed slower through the gel than pure
DNA. Binding of His-GlnR to the amtB promoter fragment was obtained by adding protein
amounts of 200 ng or higher. In figure 19, GlnR attached to an N-terminal His-tag purified
from M. smegmatis ML371 is shown, but the same results were seen when a C-terminal His-
tag fusion or even the wild type strain SMR5 expressing nearly exclusively groEL1 (see
section 4.1.5) was used (data not shown). Due to the large size of the maltose binding
protein (44 kDa) compared to a small His- or Strep-tag, binding of the MBP-GlnR fusion
protein to the DNA was first detected at a protein amount of 400 ng. A sample in which only
800 ng of purified MBP were used was added as a control showing that pure MBP had no
effect on DNA binding (figure 19). Furthermore, binding of purified Strep-GlnR to the
digoxigenin-labeled amtB promoter fragment was observed when protein amounts of 100 ng
or higher were used (figure 19). It was monitored that the more purified GlnR was added, the
higher the shift of the DNA was, indicating that GlnR indeed binds to its target DNA in a
Results 73
His-GlnR MBP-GlnR Strep-GlnR
Binding of purified GlnR to target DNA
“galloping” manner as it was presumed before (Yoshida et al., 2006; Amon et al., 2008). Shift
of DNA attached to MBP-GlnR was largest due to the large size of the fusion protein. This
experiment gave a first hint that DNA binding of GlnR in vitro is independent from further
activation mechanisms of the protein, such as phosphorylation.
Fig. 19: Binding of GlnR protein to its target DNA. A 220 bp digoxigenin-labeled DNA fragment directly upstream of the amtB start codon was used as target. A sample of free DNA was carried along as a control in every approach. The following amounts of His-GlnR (here: N-terminal His-tag, purified from M. smegmatis ML371) were added: 200, 400, 600, 800 and 1000 ng. After a sample with free DNA and one with 800 ng pure maltose binding protein as controls, MBP-GlnR was added in amounts of 50, 100, 200, 400, 800, 1000, 1500 and 2000 ng. Strep-GlnR was added after a control sample of free DNA in amounts of 100, 200, 400, 800, 1600 and 3200 ng.
4.2 Characterization of the GlnR regulon
4.2.1 Global approach using DNA microarray analyses
Little was known about the role of GlnR in nitrogen metabolism in M. smegmatis at the
beginning of this study. First experiments revealed enhanced transcript levels of the genes
amtB and amt1, encoding ammonium transporters, and glnA, encoding GS I, under nitrogen
limitation when GlnR was present. These data were obtained performing RNA hybridization
experiments and real time RT PCR (Amon et al., 2008), indicating that GlnR is the
transcriptional activator of genes involved in nitrogen metabolism. A multitude of further
nitrogen-related genes was identified in M. smegmatis in a bioinformatic approach (Amon et
al., 2009). Among these were various glnA-like genes encoding different types of glutamine
synthetases, gltBD encoding glutamate synthase, glnE encoding ATase putatively involved in
posttranslational regulation of GSI, various genes involved in uptake and hydrolysis of urea,
nirBD and the nar operon encoding assimilatory nitrate and nitrite reductases, genes
encoding various nitrate/nitrite transporters, glnK and glnD encoding signal transduction
Results 74
proteins of nitrogen control well understood in the related actinomycete C. glutamicum (see
section 2.2.3), and also amtR encoding a putative second regulatory protein of nitrogen
metabolism (for an overview, see Amon et al., 2009). Moreover, first experiments of this
study (see section 4.1.1) revealed that GlnR has great influence on uptake and assimilation
of different substrates such as guanine, uracil, nitrate, nitrite and uric acid or the amino acids
alanine, proline and serine which can be used by M. smegmatis as nitrogen sources.
Therefore, more putative and so far unknown permeases or transport proteins as well as
different metabolic enzymes were assumed to be controlled by GlnR. This is supported by a
closer look at nitrogen control in actinomycetes related to M. smegmatis. Whereas in
C. glutamicum at least 40 genes involved in nitrogen metabolism are controlled by the global
regulatory protein AmtR (see section 2.2.3), influence of the transcriptional regulator GlnR on
at least 15 target genes was reported for S. coelicolor (Fink et al., 2002; Tiffert et al., 2008).
All these data indicate that in M. smegmatis a multitude of further GlnR target genes might as
well exist.
To verify this, a global analysis of total gene transcripts was carried out in a DNA microarray
experiment. Therefore, the M. smegmatis wild type SMR5 and the glnR deletion strain MH1
were incubated in 7H9 medium until exponential growth and then transferred into nitrogen-
free medium. After another 30 minutes, cells were harvested and total RNA was prepared.
Transcription of the RNA with labeling of the resulting cDNA with cy3 and cy5 fluorescent
markers, as well as hybridization of the samples with oligonucleotides representing the whole
M. smegmatis genome on a microarray chip was performed at the Department of
Biochemistry, Friedrich-Alexander University Erlangen-Nuremberg. In a first experiment, total
transcript of the wild type SMR5 grown under nitrogen surplus was compared to that
obtained under nitrogen starvation. A second assay revealed differences in total transcript
between the wild type and the glnR deletion strain, both cultivated under nitrogen starvation.
Data were exposed to different analysis procedures until all M. smegmatis genes whose
transcript levels differed between +N and -N or between wild type and glnR deletion strain by
a factor higher than 3 were shown. Results of these analyses are summarized in figure
20-23. Here, all genes identified in the transcriptome analysis are represented in %
according to their COG (Clusters of Orthologous Groups) numbers. Dividing proteins and
their corresponding genes into COGs based on orthologous relationships (Tatusov et al.,
2003) makes it easier to understand their individual structure and function. The complete lists
of genes with changing transcript levels between nitrogen surplus and starvation or between
wild type and glnR deletion strain can be viewed in section 7.2.
Results 75
When total transcript of the M. smegmatis wild type was compared under nitrogen surplus
and starvation, mRNA levels of 231 genes were found to be decreased under nitrogen
starvation, but only by a maximum factor of 15, indicating that these genes were not involved
in nitrogen stress response. Classification of these genes into COGs is shown in figure 20.
50 % of these genes were allocated to the major group metabolism, including genes for lipid
(COG_I), carbohydrate (COG_G), inorganic ion (COG_P) and amino acid (COG_E) transport
and metabolism, as well as genes for secondary metabolites biosynthesis, transport and
catabolism (COG_Q), energy production and conversion (COG_C), coenzyme (COG_H) and
nucleotide (COG_F) transport and metabolism. Another 27 % were allocated to the major
category poorly characterized with genes of predicted (COG_R) or unknown (COG_S)
function or no COG classification (X). 16 % of the genes with decreased transcripts in the
wild type under nitrogen starvation belonged to the group information storage and
processing, with genes involved in translation, ribosomal structure and biogenesis (COG_J),
transcription (COG_K) and replication, recombination and repair (COG_L). The remaining
7 % correlated with the group cellular processes and signaling, with genes involved in
posttranslational modification, protein turnover, chaperones (COG_O), cell
wall/membrane/envelope biogenesis (COG_M), cell cycle control, cell division, chromosome
partitioning (COG_D), signal transduction mechanisms (COG_T), cell motility (COG_N) and
intracellular trafficking, secretion and vesicular transport (COG_U). Only 4 % of these 231
genes are described as putatively involved in nitrogen metabolism.
In contrast, the amount of transcripts of 284 genes was enhanced in the wild type under
nitrogen starvation compared to nitrogen surplus by factors of up to 99. These data indicated
that the transcripts of a variety of genes in M. smegmatis are increased as soon as the
organism is exposed to nitrogen starvation. Contrary to the genes with decreased mRNA
levels (see above), 12.5 % of these 284 genes are associated with nitrogen metabolism.
Figure 21 shows the classification of these genes into COGs. 49 % of these genes were
poorly characterized, either not in COG (X), or of predicted (COG_R) or unknown (COG_S)
function. 37 % belonged to the major category metabolism, with genes involved in transport
and metabolism of amino acids (COG_E) and inorganic ions (COG_P), as well as in energy
production and conversion (COG_C) and biosynthesis, transport and catabolism of
secondary metabolites (COG_Q). Furthermore, genes involved in transport and metabolism
of coenzymes (COG_H), carbohydrates (COG_G), lipids (COG_I) and nucleotides (COG_F)
were found. 8 % of the genes with enhanced transcripts in the wild type under nitrogen
starvation were allocated to information storage and processing, with genes involved in
transcription (COG_K), translation, ribosomal structure and biogenesis (COG_J), replication,
recombination and repair (COG_L) and chromatin structure and dynamics (COG_B).
Results 76
M. smegmatis SMR5: decreased transcript levels of 231 genes under nitrogen starvation
Metabolism
Poorly characterized
Information storage and processing
Cellular processes and signaling
Metabolism
I: Lipid transport and metabolism
G: Carbohydrate transport and metabolism
P: Inorganic ion transport and metabolism
Q: Secondary metabolites biosynthesis, transport and catabolism
E: Amino acid transport and metabolism
C: Energy production and conversion
H: Coenzyme transport and metabolism
F: Nucleotide transport and metabolism
Poorly characterized
X: Not in COG
R: General function prediction only
S: Function unknown
Information storage and processing
J: Translation, ribosomal structure and biogenesis
K: Transcription
L: Replication, recombination and repair
Cellular processes and signaling
O: Posttranslational modification, protein turnover, chaperones
M: Cell wall/membrane/envelope biogenesis
D: Cell cycle control, cell division, chromosome partitioning
T: Signal transduction mechanisms
N: Cell motility
U: Intracellular trafficking, secretion and vesicular transport
Fig. 20: Allocation of 231 M. smegmatis SMR5 genes with decreased transcript levels under nitrogen starvation into COGs.
Results 77
M. smegmatis SMR5: increased transcript levels of 284 genes under nitrogen starvation
Poorly characterized
Metabolism
Information storage and processing
Cellular processes and signaling
Poorly characterized
Metabolism
X: Not in COG
R: General function prediction only
S: Function unknown
Information storage and processing
Cellular processes and signaling
O: Posttranslational modification, protein turnover, chaperones
T: Signal transduction mechanisms
M: Cell wall/membrane/envelope biogenesis
D: Cell cycle control, cell division, chromosome partitioning
V: Defense mechanisms
U: Intracellular trafficking, secretion and vesicular transport
E: Amino acid transport and metabolism
P: Inorganic ion transport and metabolism
C: Energy production and conversion
Q: Secondary metabolites biosynthesis, transport and catabolism
H: Coenzyme transport and metabolism
G: Carbohydrate transport and metabolism
I: Lipid transport and metabolism
F: Nucleotide transport and metabolism
K: Transcription
J: Translation, ribosomal structure and biogenesis
L: Replication, recombination and repair
B: Chromatin structure and dynamics
Fig. 21: Allocation of 284 M. smegmatis SMR5 genes with increased transcript levels under nitrogen starvation into COGs.
Results 78
SMR5 vs. MH1 -N: increased transcript levels of 6 genes in the glnR deletion strain
Poorly characterized; X: not in COG
Cellular processes and signaling; O: Posttranslational
modification, protein turnover, chaperones
The remaining 6 % belonged to cellular processes and signaling, namely to posttranslational
modification, protein turnover, chaperones (COG_O), signal transduction mechanisms
(COG_T), cell wall/membrane/envelope biogenesis (COG_M), cell cycle control, cell division,
chromosome partitioning (COG_D), defense mechanisms (COG_V) and intracellular
trafficking, secretion and vesicular transport (COG_U).
These data indicated that M. smegmatis indeed changes its pattern of transcripts due to
sudden nitrogen starvation. While the mRNA levels of genes involved in carbohydrate, lipid
or energy metabolism were decreased, those of genes involved in nitrogen metabolism were
enhanced to maintain a nitrogen status sufficient for survival of the cells.
Most interesting for this study was the comparison of transcript levels between the wild type
SMR5 and the glnR deletion strain MH1 under nitrogen starvation. This experiment resulted
in a change of transcripts of 131 genes. Of these, the mRNA amounts of only 6 genes were
increased in the glnR deletion strain compared to the wild type (figure 22). While four of
these genes were not characterized in COGs, the remaining two belonged to cellular
processes and signaling as part of COG_O (posttranslational modification, protein turnover,
chaperones) and were not associated with nitrogen metabolism.
Fig. 22: Allocation of 6 M. smegmatis genes into COGs. These genes showed increased transcript levels under nitrogen starvation in the glnR deletion strain MH1 compared to the wild type SMR5.
In contrary, transcripts of 125 genes were decreased in the glnR deletion strain compared to
the wild type up to a factor of 136, leading to the first conclusion that GlnR might be involved
in expression of these genes under nitrogen limitation. This was also supported by the fact
that more than 33 % of these genes are described as putatively involved in nitrogen
metabolism. Allocating these genes into COGs (see figure 23), it was apparent that 52 %
belonged to the metabolism group, with more than half of these genes associated to amino
acid transport and metabolism (COG_E). This corroborated the thesis that GlnR is indeed
responsible for expression of a variety of genes involved in amino acid metabolism. Further
genes were designated to energy production and conversion (COG_C), transport and
Results 79
SMR5 vs. MH1 -N: decreased transcript levels of 125 genes in the glnR deletion strain
Metabolism
Poorly characterized
X: Not in COG
R: General function prediction only
S: Function unknown
Information storage and processing
Cellular processes and signaling
M: Cell wall/membrane/envelope biogenesis
O: Posttranslational modification, protein turnover, chaperones
V: Defense mechanisms
T: Signal transduction mechanisms
E: Amino acid transport and metabolism
C: Energy production and conversion
P: Inorganic ion transport and metabolism
F: Nucleotide transport and metabolism
G: Carbohydrate transport and metabolism
I: Lipid transport and metabolism
Q: Secondary metabolites biosynthesis, transport and catabolism
H: Coenzyme transport and metabolism
K: Transcription
J: Translation, ribosomal structure and biogenesis
Metabolism
Poorly characterized
Information storage and processing
Cellular processes and signaling
Fig. 23: Allocation of 125 M. smegmatis genes into COGs. These genes showed decreased transcript levels under nitrogen starvation in the glnR deletion strain MH1 compared to the wild type SMR5.
Results 80
metabolism of inorganic ions (COG_P), nucleotides (COG_F), carbohydrates (COG_G),
lipids (COG_I) and coenzymes (COG_H), as well as to secondary metabolites biosynthesis,
transport and catabolism (COG_Q). The next often detected group of genes (34 %) was
poorly characterized, either not in the COG-system (X) or of predicted (COG_R) or unknown
(COG_S) function. Furthermore, 9 % of the genes with decreased transcript levels under
nitrogen starvation in the glnR deletion strain were putatively involved in information storage
and processing, namely in transcription (COG_K) and translation, ribosomal structure and
biogenesis (COG_J). The remaining 5 % were allocated to the cellular processes and
signaling group, namely to cell wall/membrane/envelope biogenesis (COG_M),
posttranslational modification, protein turnover, chaperones (COG_O), defense mechanisms
(COG_V) and signal transduction mechanisms (COG_T).
A closer look was taken on the 125 genes which showed decreased mRNA levels in the glnR
deletion strain MH1 compared to the wild type SMR5 under nitrogen starvation. The
classification into COGs gave a first hint that GlnR is indeed responsible for transcriptional
activation of these genes, especially as many genes involved in uptake and assimilation of
amino acids or other possible nitrogen sources were detected. As this classification does not
show the factor of difference of transcript levels between presence and absence of GlnR, the
125 genes of interest are again listed in table 5, including the msmeg_ gene number, the fold
change of transcripts, the annotation of the gene and the corresponding COG number.
Tab. 5: List of all 125 M. smegmatis genes obtained from a DNA microarray experiment that showed decreased transcript levels by a factor higher than 3 in the glnR deletion strain MH1 compared to the wild type SMR5 under nitrogen starvation. The msmeg_ gene numbers as well as the fold change of transcripts, an annotational description and the corresponding COG numbers are given. Data are sorted by the strength of fold change in an ascending manner. Genes chosen for further analyses are highlighted in blue.
Locus tag Fold change
Description COG number
msmeg_3358 3.02 YaeQ protein COG4681S
msmeg_4965 3.07 hypothetical protein X
msmeg_6507 3.07 glycogen debranching enzyme GlgX (glgX) COG1523G
msmeg_1792 3.12 conserved hypothetical protein X
msmeg_4567 3.14 conserved hypothetical protein COG1305E
msmeg_4382 3.15 dehydrogenase-reductase SDR family member 10 COG1028IQR
msmeg_4011 3.26 putative pyrimidine permease RutG COG2233F
msmeg_2116 3.33 PTS system, glucose-specific IIBC component COG1263G
msmeg_4570 3.34 conserved hypothetical protein COG2308S
msmeg_2187 3.36 urea amidolyase COG1984E
msmeg_4569 3.48 conserved hypothetical protein COG2307S
msmeg_1292 3.48 FAD binding domain in molybdopterin dehydrogenase protein COG1319C
msmeg_4171 3.58 ribose transport system permease protein RbsC COG1172G
msmeg_3994 3.64 short chain dehydrogenase COG0300R
msmeg_5648 3.68 hypothetical protein X
msmeg_2189 3.68 allophanate hydrolase (atF) COG0154J
msmeg_0393 3.73 Fmt protein COG2226H
Results 81
msmeg_1153 3.73 FAD dependent oxidoreductase X
msmeg_6659 3.74 hypothetical protein X
msmeg_6332 3.79 amino acid ABC transporter, permease protein COG1174E
msmeg_3626 3.89 urease, beta subunit (ureB) COG0832E
msmeg_5083 4.00 conserved hypothetical protein X
msmeg_1152 4.01 citrate-proton symporter COG2814G
msmeg_5331 4.04 UDP-glucoronosyl and UDP-glucosyl transferase family X
msmeg_1151 4.08 DNA-binding protein COG1396K
msmeg_5783 4.10 acetyltransferase, GNAT family X
msmeg_1155 4.16 carnitinyl-CoA dehydratase COG1024I
msmeg_1157 4.17 short chain dehydrogenase COG0300R
msmeg_3912 4.20 acetoacetyl-CoA reductase COG1028IQR
msmeg_0565 4.33 putative glycosyl transferases group 1 COG0438M
msmeg_1184 4.40 serine esterase, cutinase family X
msmeg_1156 4.44 dihydrodipicolinate synthetase COG0329EM
msmeg_1185 4.46 transcriptional regulator, AsnC family COG1522K
msmeg_1089 4.61 hypothetical protein X
msmeg_1088 4.63 glutamyl-tRNA(Gln)-aspartyl-tRNA(Asn) amidotransferase COG0154J
msmeg_0505 4.72 probable sugar ABC transporter, substrate-binding protein COG1653G
msmeg_6880 4.92 hydrophobic amino acid ABC transporter, putative COG0683E
msmeg_6879 4.97 Nat permease for neutral amino acids NatD COG0559E
msmeg_3722 5.04 bifunctional coenyme PQQ synthesis protein C-D X
msmeg_1596 5.05 transcriptional regulator COG1309K
msmeg_6264 5.06 putative oxidoreductase COG0665E
msmeg_2523 5.11 efflux ABC transporter, permease protein, putative X
msmeg_4381 5.14 amidase COG2421C
msmeg_1090 5.24 amidase COG0154J
msmeg_1508 5.54 amino acid permease-associated region COG0531E
msmeg_5729 5.75 hydantoin racemase COG4126E
msmeg_6733 6.32 hydrolase, carbon-nitrogen family COG0388R
msmeg_2748 6.36 soluble pyridine nucleotide transhydrogenase (sthA) COG1249C
msmeg_1085 6.41 dipeptide transport system permease protein DppB COG0601EP
msmeg_2569 6.61 oxidoreductase, 2OG-Fe(II) oxygenase family COG3491R
msmeg_0429 6.64 putative ferric uptake regulator X
msmeg_6878 6.97 inner-membrane translocator COG4177E
msmeg_6263 7.01 glutamate synthase family protein COG0069E
msmeg_6262 7.40 FwdC-FmdC family protein COG0070E
msmeg_1295 7.42 transthyretin COG2351R
msmeg_3402 7.82 cytosine permease, putative COG1457F
msmeg_5356 8.15 hypothetical protein X
msmeg_1296 8.73 uricase COG3648Q
msmeg_0780 8.79 phosphotransferase enzyme family protein COG2334R
msmeg_6877 8.90 branched-chain amino acid transport system ATP-binding protein COG0411E
msmeg_0566 8.94 aliphatic amidase COG0388R
msmeg_3403 9.26 formamidase COG0388R
msmeg_1990 9.45 conserved hypothetical protein X
msmeg_1086 9.94 ABC transporter permease protein COG1173EP
msmeg_0778 10.22 putative transcriptional regulator COG2188K
msmeg_6261 10.36 glutamine amidotransferase, class II COG0067E
msmeg_6660 10.75 permease, cytosine-purines, uracil, thiamine, allantoin family COG1457F
msmeg_6817 11.34 RNA polymerase sigma factor, sigma-70 family COG1595K
msmeg_1052 11.63 amino acid carrier protein COG1115E
msmeg_6259 11.67 ammonium transporter (amt1) COG0004P
msmeg_6881 11.75 transcriptional regulator, GntR family COG1802K
msmeg_2185 12.81 conserved hypothetical protein COG3665S
Results 82
msmeg_2525 14.19 amino acid permease superfamily COG0531E
msmeg_1293 14.73 xanthine-uracil permeases family protein COG2233F
msmeg_2978 15.78 ABC transporter ATP-binding protein COG0410E
msmeg_6260 16.11 glutamine synthetase, type III (glnT) COG0174E
msmeg_4206 16.44 molybdopterin oxidoreductase X
msmeg_3400 17.66 glutamyl-tRNA(Gln) amidotransferase subunit A COG0154J
msmeg_0572 17.72 conserved hypothetical protein X
msmeg_2427 18.22 protein-P-II uridylyltransferase (glnD) COG2844O
msmeg_4637 18.43 conserved hypothetical protein X
msmeg_3401 18.68 LamB-YcsF family protein COG1540R
msmeg_1988 18.75 conserved hypothetical protein X
msmeg_1597 18.80 Transcription factor WhiB X
msmeg_2979 18.88 ABC transporter ATP-binding protein COG4674R
msmeg_2981 19.17 branched-chain amino acid ABC-type transport system COG0559E
msmeg_6115 19.21 phosphoglycerate dehydrogenase COG0111HE
msmeg_6735 19.26 amino acid permease, putative COG0531E
msmeg_1087 19.33 oligopeptide ABC transporter ATP-binding protein X
msmeg_6116 19.89 conserved hypothetical protein COG3195S
msmeg_5084 20.59 glycosyl transferase, group 2 family protein COG0463M
msmeg_5359 21.35 cyanate hydratase (cynS) COG1513P
msmeg_5360 22.01 formate-nitrate transporter COG2116P
msmeg_4501 22.33 sodium:dicarboxylate symporter COG1301C
msmeg_4635 22.90 ammonium transporter family protein (amtA) COG0004P
msmeg_2980 23.33 putative membrane protein COG4177E
msmeg_2524 24.34 ABC transporter, ATP-binding protein COG1136V
msmeg_2522 24.38 efflux ABC transporter, permease protein X
msmeg_5358 25.10 acetamidase-Formamidase family COG2421C
msmeg_4294 26.01 glutamine synthetase, type I (glnA2) COG0174E
msmeg_5765 29.55 globin COG2346R
msmeg_4638 30.14 vanillate O-demethylase oxidoreductase COG1018C
msmeg_4636 31.81 hypothetical protein X
msmeg_2186 32.35 conserved hypothetical protein COG3665S
msmeg_0570 32.58 conserved hypothetical protein X
msmeg_6816 33.03 molybdopterin oxidoreductase COG0243C
msmeg_0432 34.03 uroporphyrinogen-III synthetase COG1587H
msmeg_4290 34.13 glutamine synthetase, type I (glnA) COG0174E
msmeg_0569 34.95 flavoprotein involved in K+ transport COG2072P
msmeg_0779 35.16 short-chain dehydrogenase-reductase SDR COG1028IQR
msmeg_0781 36.20 amino acid permease COG0531E
msmeg_1987 42.51 conserved hypothetical protein COG4766E
msmeg_5730 45.31 permease for cytosine-purines, uracil, thiamine, allantoin COG1953FH
msmeg_1082 47.68 putative response regulator COG2197TK
msmeg_0571 48.04 hydrolase, carbon-nitrogen family COG0388R
msmeg_2184 48.27 amino acid permease COG0531E
msmeg_0428 48.97 nitrite reductase [NAD(P)H] small subunit (nirD) COG2146PR
msmeg_2426 51.56 nitrogen regulatory protein P-II (glnK) COG0347E
msmeg_1084 51.81 peptide-opine-nickel uptake family ABC transporter COG0747E
msmeg_0427 52.06 nitrite reductase [NAD(P)H], large subunit (nirB) COG1251C
msmeg_0433 54.53 nitrite extrusion protein (narK3) COG2223P
msmeg_2425 56.21 ammonium transporter (amtB) COG0004P
msmeg_6734 62.84 dibenothiophene desulfuriation enzyme A COG2141C
msmeg_2526 66.62 copper methylamine oxidase COG3733Q
msmeg_2982 136.17 putative periplasmic binding protein (urtA) COG0683E
Results 83
This list of putative GlnR target genes includes genes already described to be involved in
nitrogen metabolism in M. smegmatis, such as msmeg_2425 (amtB; 56.21 fold change),
msmeg_4290 (glnA; 34.13 fold change) and msmeg_6259 (amt1; 11.67 fold change; see
also Amon et al., 2008). Furthermore, genes of known function in nitrogen metabolism of
related species such as C. glutamicum or S. coelicolor (see section 2.2.3) were detected.
These were msmeg_2426/2427 (glnK and glnD; 51.56 and 18.22 fold change) or
msmeg_0427/0428 (nirBD; 52.06 and 48.97 fold change). These genes were chosen for
further analyses to experimentally verify the microarray data. Moreover, a variety of other
interesting genes was tested. These included genes with a very high fold change of transcript
levels and genes putatively involved in uptake and assimilation of different nitrogen sources
to test correlation of the data with growth experiments (see section 4.1.1). These were
msmeg_0781, msmeg_1052, msmeg_2184 and msmeg_6735 (different permeases and
transporters for amino acids; 36.2, 11.63, 48.27 and 19.26 fold change), as well as
msmeg_1293, msmeg_2748, msmeg_4011, msmeg_5730 and msmeg_6660 (transporters
for purines and pyrimidines; 14.73, 6.36, 3.26, 45.31 and 10.75 fold change). Also urea
transport and assimilation systems were found: msmeg_2187 (urea amidolyase; 3.36 fold
change), msmeg_2982 (urtA; 136.17 fold change), msmeg_2981 (urtB; 19.17 fold change)
and msmeg_3626 (urease; 3.89 fold change). In addition to that, msmeg_0566 and
msmeg_1090 (amidases; 8.94 and 5.24 fold change), msmeg_0433 and msmeg_5360
(nitrate/nitrite-associated genes; 54.53 and 22.01 fold change), msmeg_0571 (hydrolase;
48.04 fold change) and msmeg_2526 (copper methylamine oxidase; 66.62 fold change) were
focus of attention. The operon msmeg_6259-6264 (including amt1; 5.06-16.11 fold change)
was of special interest, as well as msmeg_4635 (amtA; 22.9 fold change), msmeg_4294
(glnA2; 26.01 fold change), msmeg_6816 (molybdopterin oxidoreductase; 33.03 fold change)
and msmeg_5765 (29.55 fold change), a globin gene not yet known to be involved in
nitrogen assimilation. Every gene used for further analyses such as RNA hybridization, real
time RT PCR or gel retardation experiments is highlighted blue in table 5.
4.2.2 Verification of the microarray data
In a global approach comparing total transcript of the M. smegmatis wild type SMR5 and the
glnR deletion strain MH1 incubated under nitrogen starvation, 125 putative target genes of
GlnR have been identified (see table 5, section 4.2.1). From these, several genes of either
very high changes in transcript levels between wild type and glnR deletion strain or putative
function in nitrogen metabolism were chosen for further investigations. Results of an RNA
hybridization experiment carried out for verification of the microarray data are shown in
Results 84
figures 24 and 25. Additionally, a putative connection between transcript levels and length of
nitrogen starvation in minutes can be seen in this approach. For this experiment,
M. smegmatis SMR5 and MH1 were grown under nitrogen surplus until exponential growth
phase and then transferred into nitrogen-free medium. After samples were taken at different
time points, total RNA was prepared and 1 µg was used in each case for hybridization with
specific RNA probes representing the genes of interest. Figure 24 demonstrates nitrogen-
and GlnR-dependent mRNA levels of 32 genes. While in the wild type (upper lane) a rising
mRNA signal was detected depending on the length of nitrogen starvation, this was not
observed in the glnR deletion strain (lower lane), confirming that GlnR plays an essential role
in transcriptional activation of these genes.
Interestingly, comparing the signal strength of various genes at the same time points, it was
apparent that they differed significantly. The maximum signal strength of nirB and narK3 e.g.
was reached after 60 minutes of nitrogen starvation, whereas this was observed for amtB,
glnA or amt1 after 30 minutes or even earlier regarding genes likes urtA or msmeg_2184.
These differences might result from variable activation abilities of GlnR, caused by deviating
binding sites in the promoter regions of the tested genes. Binding of GlnR to its target genes
is investigated in detail later in this study (see section 4.2.4). A connection between signal
strength in this experiment and fold change of transcripts obtained from the microarray
analysis can hardly be postulated, as processing of the two approaches is very different.
Furthermore, for some genes nitrogen- or GlnR-dependent transcript levels could not be
detected in RNA hybridization experiments (see figure 25). These were genes with low fold
change of mRNA levels obtained from the microarray analysis, such as msmeg_3626
(urease, 3.89 fold change) or msmeg_4011 (putative permease, 3.26 fold change).
Surprisingly, the other tested genes (msmeg_1084, 51.81 x; msmeg_5360, 22.01 x and
msmeg_6735, 19.26 x) showed a rather high fold change in the microarray analysis, but no
signal in the RNA hybridization experiment. No increase of signal strengths was also
obtained when the genes ureC1, ureC2, gltB, gltD and gdh, described as generally involved
in nitrogen metabolism (marked with *), were tested.
Results 85
Fig. 24: RNA hybridization experiment. 1 µg total RNA was used for hybridization with specific RNA probes against genes of interest. RNA was prepared from wild type (upper lane) and glnR deletion strain (lower lane), both incubated under nitrogen surplus (+N) and starvation (-N). Samples were taken at different time points (directly and 5, 10, 15, 30 and 60 minutes after induction of nitrogen starvation). 32 genes with increased transcript levels under nitrogen starvation in the wild type, but with no or weak signal in the glnR deletion strain, are shown.
+N -N0 5 10 15 30 60 +N -N0 5 10 15 30 60
msmeg_0427 (nirB)
msmeg_0433 (narK3)
msmeg_0571
msmeg_0779
msmeg_0781
msmeg_1052
msmeg_1090
msmeg_1293
msmeg_2184
msmeg_2425 (amtB)
msmeg_2426 (glnK)
msmeg_2427 (glnD)
msmeg_2522
msmeg_2526
msmeg_2748
msmeg_2981
msmeg_2982 (urtA)
msmeg_3400
msmeg_4290 (glnA)
msmeg_4294 (glnA2)
msmeg_4381
msmeg_4635 (amtA)
msmeg_4638
msmeg_5358
msmeg_5730
msmeg_5765 (glbN)
msmeg_6259 (amt1)
msmeg_6260 (glnT)
msmeg_6261
msmeg_6660
msmeg_6734
msmeg_6816
Results 86
+N -N0 5 10 15 30 60 +N -N0 5 10 15 30 60
msmeg_0566
msmeg_1084
msmeg_1094 (ureC1)*
msmeg_3225 (gltB)*
msmeg_3226 (gltD)*
msmeg_3625 (ureC2)*
msmeg_3626
msmeg_4011
msmeg_5360
msmeg_5442 (gdh)*
msmeg_6735
Fig. 25: RNA hybridization experiment. 1 µg total RNA was used for hybridization with specific RNA probes against genes of interest. RNA was prepared from wild type (upper lane) and glnR deletion strain (lower lane), both incubated under nitrogen surplus (+N) and starvation (-N). Samples were taken at different time points (directly and 5, 10, 15, 30 and 60 minutes after induction of nitrogen starvation). For 11 genes, no enhanced signal was found in the wild type under nitrogen starvation. No influence of GlnR was detected. *: genes described as involved in nitrogen metabolism, not found in microarray analysis.
Additionally, some genes of interest were chosen for further verification of the data obtained
in DNA microarray and RNA hybridization analyses by real time RT PCR. With this method,
changes in the amounts of transcript of a specific target gene can be detected precisely. For
this experiment, total RNA was prepared from M. smegmatis SMR5 and MH1, again grown
until exponential growth phase and then incubated for 30 minutes under nitrogen starvation.
Purity of the RNA was guaranteed by performing additional DNAse digest, followed by
control PCR that gave no results when RNA was used as template. In a real time RT PCR
experiment, RNA is transcribed into cDNA which serves as template for further amplification
of a gene of interest. In this study, a 100 bp DNA fragment of every target gene was
amplified. Amplification rates were monitored and efficiencies of the PCR reactions were
determined. An example for a standard curve with resulting PCR efficiency of 95 % for a
100 bp fragment of msmeg_2427 (glnD) is shown in figure 26A. Additional controls such as
melt curves and detection of the 100 bp fragments on 4 % agarose gels guaranteed the
quality of the experiment (see figure 26B). All 21 genes used for further experiments showed
a PCR efficiency of 90-105 %.
Results 87
PCR efficiency (%) R squared slope y-intercept
95.0 0.998 -3.447 26.823
A
B
1 2 3 4 5 6 7 8 9
Fig. 26: Real time RT PCR experiments determinating PCR efficiency of a 100 bp fragment of glnD. A. Amplification chart and determination of PCR efficiency from a standard curve using RNA amounts of 100, 10, 1 and 0.1 ng per reaction, carried out in duplicates. B. Quality control of PCR reaction by generation of a melt curve and by detecting the 100 bp fragments on agarose gel. 1-8: RNA dilution series in duplicates. 9: non-template control.
In a second run, amounts of specific transcripts were compared in the wild type and the glnR
deletion strain. Therefore, relative quantification was chosen, i.e. the amount of a specific
RNA template in the wild type was determined in relation to the amount in the glnR deletion
strain, which was set one. Additionally, a reference gene was needed for this calculation. The
gene msmeg_3084 (encoding G3PDH) was used, as its change of transcript level between
wild type and glnR deletion strain was less than 10 % (see figure 27A and B). So, after
experiments were carried out at least in triplicates, the relative fold expression of every target
gene in the wild type was calculated according to Pfaffl et al. (2001), considering PCR
efficiencies and Cq values of target and reference gene in the wild type and in the ΔglnR
sample (for experimental setup and calculations refer to section 3.3.2.5). Results are
summarized in figure 27B showing the GlnR-dependent increase of transcript of 20 genes in
the wild type under nitrogen starvation. Very high differences in transcript levels were
obtained for amtB, glnK, urtA, glnA, amtA and msmeg_6816. Significant changes were also
Results 88
400
350
300
250
200
150
100
50
03084 3084 0428 0779 1090 1293 2184 2425 2426 2427 2522 2526 2982 3400 4290 4294 4635 5730 5765 6259 6261 6816
nirD amtB glnK glnD urtA glnA glnA2 amtA glbN amt1
SMR5 0.9 3.4 12.4 2.6 8.4 18.0 340.4 47.7 19.0 6.7 10.5 169.8 23.5 59.6 21.2 103.6 8.5 11.5 6.0 10.9 188.5
A B
1.2
1.0
0.8
0.6
0.4
0.2
0
rela
tive e
xp
ressio
nra
tio
rela
tive e
xp
ressio
nra
tio
MH1 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0
monitored for msmeg_0779, msmeg_2184, glnD, msmeg_2526, msmeg_3400, glnA2,
msmeg_5765 (glbN) and msmeg_6261. The genes msmeg_1293, msmeg_2522,
msmeg_5730 and amt1 showed lower, but still detectable changes in this approach. In most
cases, the calculated transcript ratios deviated from those obtained in the previously shown
microarray analysis (section 4.2.1), which might be a result of different experimental
procedures. Nevertheless, the influence of GlnR on the transcripts of the tested genes was
again confirmed in this independent approach.
Fig. 27: Results of real time RT PCR analyses comparing transcript ratios of target genes in the M. smegmatis wild type and the glnR deletion strain. For this, total RNA of the strains SMR5 and MH1 incubated for 30 minutes under nitrogen starvation was prepared and used as template for reverse transcription and PCR reaction. Specific primers were used for amplification of 100 bp fragments of the target genes. A. The gene msmeg_3084 was carried along as a control; transcripts of this housekeeping gene (G3PDH) were not significantly different in wild type (blue bar) and glnR deletion strain (blue patterned bar). B. Relative fold transcript levels of 20 target genes in the wild type SMR5 were calculated (blue bars), while the amounts of transcripts in the glnR deletion strain were set one. Relative fold transcription levels were calculated in normalization to the reference gene msmeg_3084. Genes are sorted according to their msmeg_ numbers and the calculated transcript ratios in the wild type strain SMR5 are shown.
Recapitulating recent results, it can be stated that GlnR plays an important role in increasing
the amount of transcripts of various target genes under nitrogen starvation. This was proven
in three independent experimental approaches. First, in a global approach analyzing the
whole transcriptome of M. smegmatis wild type SMR5 and the glnR deletion strain MH1, 125
putative GlnR target genes were identified. These genes showed decreased mRNA levels
under nitrogen starvation in the absence of GlnR. More than 33 % of these genes are
putatively associated with nitrogen metabolism. A selection of these genes was further tested
in RNA hybridization experiments (see table 5, section 4.2.1). With this method, nitrogen-
Results 89
and GlnR-dependent transcript levels were confirmed for 32 genes (see figure 24). Using
real time RT PCR as another independent approach, GlnR-dependent transcripts of 20 target
genes found in the microarray analysis were monitored. Obviously, many new GlnR target
genes have been found, resulting in the question if the increase of their transcript levels is
due to binding of GlnR to the corresponding promoter sequences and thus activation of RNA
polymerase, or if it might be a secondary effect due to the absence of GlnR in the organism.
4.2.3 Binding of GlnR to promoter sequences of its target genes
Previous experiments in this study revealed that the increase of transcript levels of a
multitude of genes mainly involved in nitrogen metabolism depends on OmpR-type regulator
GlnR. It has already been shown that transcripts of amtB, amt1 and glnA are enhanced by
GlnR in response to nitrogen starvation (Amon et al., 2008). This was proven in this study for
more than 30 additional genes (see section 4.2.2). Furthermore, binding of purified GlnR
protein to a 220 bp promoter sequence upstream of amtB could be shown earlier in this
study (see section 4.1.7), supporting the idea that GlnR activates gene transcription by RNA
polymerase by binding to specific sequences in the promoter regions of its target genes. In
the following, binding of GlnR to upstream sequences of target genes identified before (see
section 4.2.1 and 4.2.2) is investigated.
Gel retardation experiments were performed as described in section 3.3.1.11 and 4.1.7. For
these, 200-300 bp fragments directly upstream of the target genes’ or operons’ start (refer to
figure 56, section 5.1.2) were amplified and labeled with digoxigenin for further detection.
After incubation with 400 ng purified MBP-GlnR, the samples were separated via gel
electrophoresis. The results of this experiment are shown in figure 28. Free DNA was
detected as the band proceeding furthest in the gel (lane 1), while a distinct shift was
monitored when DNA-GlnR complexes were formed (lane 2). When 3 µg (1000 fold surplus)
of competitor DNA polyd[I-C] were added (lane 3), a differentiation of specific and unspecific
binding was possible.
Results 90
0572 0781 2184 2425amtB 2526 2982urtA 3400
4290glnA 4294glnA2 4635 amtA 6259amt1 6660 6735
0427nirB 1052 1084 1090 1293 2748 2981
A
B
4638 5141narK 5734 5765glbN 6258 6734 6816
Fig. 28: Gel retardation experiments. 200-300 bp DNA fragments upstream of GlnR target genes labeled with digoxigenin were used. For each gene free DNA (lane 1), DNA plus 400 ng MBP-GlnR (lane 2) and DNA plus 400 ng MBP-GlnR plus 3 µg competitor DNA polyd[I-C] (lane 3) were tested. A. Target sequences with specific binding. B. Unspecific or no binding. Numbers indicate msmeg_ numbers.
Results 91
For 13 promoter fragments, specific binding of GlnR was spotted (figure 28A), as binding
was not inhibited by addition of surplus of competitor DNA. These were fragments upstream
of msmeg_0572, msmeg_0781, msmeg_2184, msmeg_2425 (amtB), msmeg_2526,
msmeg_2982 (urtA), msmeg_3400, msmeg_4290 (glnA), msmeg_4294 (glnA2),
msmeg_4635 (amtA), msmeg_6259 (amt1), msmeg_6660 and msmeg_6735. On the
contrary, 14 promoter regions with no or only unspecific binding of GlnR were found (figure
28B), as binding was not detected or was inhibited by addition of competitor DNA. These
fragments were located upstream of msmeg_0427 (nirB), msmeg_1052, msmeg_1084,
msmeg_1090, msmeg_1293, msmeg_2748, msmeg_2981, msmeg_4638, msmeg_5141
(narK), msmeg_5734, msmeg_5765 (glbN), msmeg_6258, msmeg_6734 and msmeg_6816.
Furthermore, promoter fragments upstream of msmeg_1091 and msmeg_3627 (ureE1 and
ureA2, encoding putative urea assimilating genes located in operons; not found in the
microarray analysis), but binding of GlnR could not be detected (Amon et al., 2008). These
data indicated that direct binding of GlnR to the promoter sequences of at least 13 target
genes and operons is indeed responsible for enhanced levels of transcripts, but also that
transcription of at least the same amount of genes must be regulated differently, presumably
by a secondary effect which is yet unknown or by influence of further transcriptional
regulatory proteins.
4.2.4 Determination of binding properties of GlnR
It has already been demonstrated in this study, that binding of GlnR to DNA promoter
sequences plays an important role for enhanced transcript levels of the corresponding target
genes. For approximately half of all tested promoter sequences, specific binding of GlnR was
demonstrated (see section 4.2.3) leading to the question which factors (e.g. binding site,
nitrogen status of the cells or activation of GlnR) determine whether GlnR binds or not. To
answer this, the definition of the DNA binding motif of GlnR was essential. This had already
been done in a previous study where upstream sequences of known GlnR target genes such
as amtB, glnA and amt1 of different mycobacteria were compared in a bioinformatic
approach resulting in a putative 44 bp DNA binding motif shown in figure 29 (Amon et al.,
2009). Four highly conserved domains were found indicating indeed at least two putative
binding sites for GlnR within these sequences.
Results 92
Fig. 29: DNA binding motif of GlnR determined in bioinformatic analysis of promoter regions of different target genes. Putative GlnR cis elements in M. smegmatis (msmeg), M. tuberculosis (H37rv), M. bovis (bovis) and M. avium (avium) upstream of the genes glnA, amtB and amt1 (only smeg) were compared (Amon et al., 2009).
To verify this in gel retardation experiments, the 220 bp region upstream of amtB was
chosen, as strong and specific binding of GlnR has been detected here before (see figure 28,
section 4.2.3). To localize the GlnR binding sites in detail, competitive gel retardation assays
were performed. Therefore, samples were set up as described before (see section 3.3.1.11
and 4.2.3). Each sample of 220 bp digoxigenin-labeled amtB promoter was mixed with 1 µg
purified MBP-GlnR (also GlnR-His, not shown) and additionally with one of eight non-labeled,
50 bp overlapping DNA fragments covering the whole promoter sequence. One of these
fragments containing the GlnR binding site would immediately inhibit the shift of labeled
DNA, as the protein would much likelier bind to the unlabeled DNA which was supplied in
1000 fold surplus. A model and the results of the first competitive gel retardation experiment
are shown in figure 30. Addition of fragments 1, 3, 7 and 8 did not lead to any inhibition of
the DNA shift caused by GlnR binding. Fragments 4 and 6 led to the strongest inhibition,
indicating that the GlnR binding site is located in between this 100 bp fragment. Interestingly,
when fragment 5 was added, the inhibition of the shift was almost abolished. Another weak
binding site might exist in fragment 2, as a very slight inhibition was also spotted here.
Results 93
- + 1 2 3 4 5 6 7 8
220 bp upstream region amtB
1
2
3
4
5
6
7
8
A
B
Fig. 30: Competitive gel retardation experiment. A. Model of eight overlapping 50 bp DNA fragments covering the 220 bp upstream region of amtB. B. When each of these fragments was added in 1000 fold surplus to gel retardation samples consisting of 220 bp digoxigenin-labeled amtB promoter fragment and purified GlnR, an inhibition of the shift was spotted for fragments 4, 6 and weakly 2. -: free DNA as negative control. +: DNA plus 600 ng MBP-GlnR as positive control.
Subsequently, new gel retardation experiments were performed to further specify the
localization. Therefore, the 50 bp fragments 4 and 6 which caused inhibition of GlnR-binding
to the 220 bp promoter fragment before were used as digoxigenin-labeled DNA probes. 25
and 15 bp DNA fragments were used as competitor DNA (figure 31A and C). Fragment 6.1
caused indeed a further inhibition of GlnR-binding to fragment 6, indicating that the binding
site is located within this 25 bp sequence (figure 31A and B). Further localization of the
binding site spotted in fragment 4 was not possible, as addition of 25 bp fragments 4.1, 4.2
and 4.3 did not lead to inhibition of the shift (figure 31C and D).
These results verified the supposed existence of more than one GlnR binding sites in the
promoter regions of its target genes. For amtB, two binding sites were experimentally
verified, one located 75-100 bp upstream (fragment 6.1), and the other 100-150 bp upstream
of the gene’s start codon (fragment 4). Sequence analyses revealed a putative third binding
site 50-75 bp upstream of the start codon (putatively fragment 6.3). An additional, fourth
binding site might exist 150-200 bp upstream of the start codon (fragment 2). These data
supported the “galloping” model which was predicted for GlnR binding before (Yoshida et al.,
2006; Amon et al., 2008).
Results 94
50 bp fragment 6 amtB
6a
6.2
6b
6.3
6c
6.1
6d
A
B
TGCGTTCACTTTCCGGAAACGCAACGGCAGCACCGGCGAAACGCCGGCAA
D
C
50 bp fragment 4 amtB
4.2
4.34.1
ACGACCTGTGCTTTGTCGGCGGGAAACATGAGCGTAACAGTGATCGGGAT
- + 6
- + 4
Fig. 31: Competitive gel retardation experiments. A. Model of three overlapping 25 bp DNA fragments (6.1-6.3) and four 15 bp fragments (6a-d) covering the 50 bp fragment 6 in the upstream region of amtB. B. Addition of these fragments in 1000 fold surplus to gel retardation samples containing 50 bp digoxigenin-labeled fragment 6 and 600 ng MBP-GlnR each. An inhibition of the shift was only detected for fragment 6.1. C. Model of three overlapping 25 bp DNA fragments (4.1-4.3) covering the 50 bp fragment 4 in the upstream region of amtB. D. When these fragments were added to gel retardation samples containing 50 bp digoxigenin-labeled fragment 4 and 600 ng MBP-GlnR each, no inhibition of the shifts was spotted. -: free DNA as negative control. +: DNA plus 600 ng MBP-GlnR as positive control.
Results 95
-GlnR-His+N GlnR-His-N
Another interesting point, next to the question where GlnR exactly binds, was if binding
depends on the nitrogen status of the cells. So far, GlnR-dependent increase of transcripts of
various target genes under nitrogen starvation has been identified in this study (see figure 24
and 27, section 4.2.2). It was also shown that this enhanced transcript levels partially
correlate with DNA binding of GlnR (see figure 28A, section 4.2.3). To analyze a putative
connection between binding affinity of the regulator protein to its target DNA and nitrogen
status of the cells, another gel retardation experiment was carried out. Therefore, two
samples of the M. smegmatis wild type SMR5 carrying a GlnR-His expression vector were
grown until exponential phase. While one was directly used for purification of the tagged
protein, the other was transferred into nitrogen-free medium and incubated for further
60 minutes before protein purification. Purification was carried out as described in section
4.1.5. Protein samples were used for binding to a 220 bp promoter fragment upstream of
amtB. Binding of GlnR to this sequence has already been shown (figure 19, section 4.1.7;
figure 28A, section 4.2.3; figure 30 and 31, see above).
When rising amounts of GlnR-His+N or GlnR-His-N were added to the amtB promoter
fragment, an increased shift of the DNA was spotted (figure 32). Considering previous results
obtained for purification of GlnR, this was surprising in two different ways. First, purification of
proteins from M. smegmatis SMR5 via His-tag results in loss of protein of interest (GlnR) in
favor of GroEL1 (see section 4.1.5). This gel retardation experiment confirmed the high DNA
binding affinity of GlnR, as only very small amounts of this protein in samples contaminated
with GroEL1 led to a shift of DNA (figure 32). Furthermore, as addition of both GlnR-His
proteins led to shift of DNA, it can be said that binding of GlnR in vitro is independent from
the nitrogen status of the cells the protein was purified from. Thus, the signal making GlnR
activate transcription of its target genes remained so far unclear. Further investigations
concerning putative modifications of GlnR are carried out later in this study (refer to section
4.3.2).
Fig. 32: Gel retardation experiment with 220 bp digoxigenin-labeled fragment upstream of amtB and purified GlnR. GlnR was purified via N-terminal His-tag from M. smegmatis SMR5 grown under nitrogen surplus (+N) and starvation (-N). Rising amounts of protein were added (380, 760, 1140, 1520 and 1900 ng).
Results 96
+N -N0 5 10 15 30 60 min
A B
4.2.5 Autoregulation of GlnR
It has already been demonstrated in this study that an increase of transcripts of more than 30
target genes depends on OmpR-type regulator GlnR (refer to section 4.2.2). Although
binding of GlnR to promoter sequences of its target genes has been investigated in detail,
the signal leading to activation of GlnR has not yet been identified and no correlation
between nitrogen status of the cells and DNA binding behavior of GlnR in vitro could be seen
(see section 4.2.4). Thus, another interesting point is the transcription of the glnR gene itself.
It is reported for the closely related actinomycete S. coelicolor, that the transcript of the glnR
gene is enhanced due to nitrogen limitation (Tiffert et al., 2008), which was not observed in
transcriptome analyses of M. smegmatis in this study. When total transcript of the wild type
SMR5 incubated under nitrogen surplus and starvation was compared, changes of transcript
levels of more than 500 genes were observed (see table 9 and 10, section 7.2), but
msmeg_5784 (glnR) was not among those genes. In a second approach, changes in
transcript levels (higher than 3) of 131 genes were revealed between wild type and glnR
deletion strain incubated under nitrogen starvation; again, the glnR gene was not detected
(see table 11 and 12, section 7.2). Nevertheless, additional experiments were carried out to
verify this. Nitrogen- and GlnR-dependence of the glnR gene was tested in an RNA
hybridization experiment (as described in section 4.2.2), but no increase of the transcript
level was detected at different time points under nitrogen starvation (figure 33A).
Furthermore, binding of purified MBP-GlnR protein to a 250 bp sequence upstream of the
glnR start codon was investigated (as described in section 4.2.3), but specific binding was
not detected (figure 33B).
Fig. 33: Investigation of regulation of the glnR gene. A. RNA hybridization experiment. 1 µg total RNA was used for hybridization with a specific glnR RNA probe. RNA was prepared from wild type (upper lane) and glnR deletion strain (lower lane), both incubated under nitrogen surplus (+N) and starvation (-N). Samples were taken at different time points (directly and 5, 10, 15, 30 and 60 minutes after induction of nitrogen starvation). B. Gel retardation experiment showing unspecific binding. A 250 bp digoxigenin-labeled glnR promoter fragment was used. Lane 1: free DNA, lane 2: DNA plus 400 ng MBP-GlnR, lane 3: DNA plus 400 ng MBP-GlnR plus 3 µg competitor DNA polyd[I-C].
Results 97
All data obtained from DNA microarray, RNA hybridization and gel retardation analyses
indicated that the glnR gene in M. smegmatis is obviously only weakly and constitutively
expressed. Contrary to observations in S. coelicolor, the glnR transcript level was not
enhanced due to nitrogen starvation. An autoregulation by GlnR was not monitored either.
4.3 Activation of GlnR
It has already been proven in this study that transcriptional activator GlnR is responsible for
enhanced transcript levels of at least 30 target genes under nitrogen starvation in
M. smegmatis (see section 4.2.2). Until now, nothing was known about the mechanism or the
putative interaction partner in M. smegmatis that signalizes GlnR to activate gene
transcription under nitrogen starvation. This mechanism is well understood in C. glutamicum
(refer to section 2.2.3). Under nitrogen starvation, the signal transduction protein GlnK is
adenylylated by GlnD and thus able to interact with transcriptional repressor AmtR. As a
consequence, the repressor is released from its target DNA and gene expression can take
place. Another system is described for E. coli (refer to section 2.2.2). Here, the PII signal
transduction protein is uridylylated by GlnD under nitrogen starvation and thus, no longer
able to interact with sensor histidine kinase NtrB which is subsequently autophosphorylated
and as a consequence able to phosphorylate NtrC. NtrC is a transcriptional regulator that
modulates expression of its target genes due to its phosphorylation state. Due to sequence
homologies, M. smegmatis GlnR is classified as OmpR-type transcriptional regulator (Amon
et al., 2008), for which a mechanism similar to the NtrB/NtrC-system applies. OmpR also
modulates transcription of its target genes after it has been phosphorylated by sensor
histidine kinase EnvZ. Because of these sequence homologies, it was assumed at the
beginning of this study that M. smegmatis GlnR might also be regulated depending on
nitrogen status of the cell via (de)phosphorylation by a sensor histidine kinase (Amon, 2010).
In the following, the search for a GlnR interaction partner (putative sensor histidine kinase)
and for evidence of phosphorylation of GlnR is described.
Results 98
A B
1
2
3
4
R W1 W2 W3 M W4 W5 W6 E1 E2 E3 E4 E5 W7 E2
70 kDa
60 kDa
50kDa
40 kDa
30 kDa
4.3.1 Search for GlnR interaction partner
Due to sequence homologies, M. smegmatis GlnR is characterized as a response regulator
belonging to a typical bacterial two-component system (Yoshida et al., 2006; Amon et al.,
2008). Again typical for such a system is that genes encoding response regulator and
corresponding sensor kinase are located in close vicinity to each other on the genome. This
is the case e.g. for NtrB/NtrC (genes located in operon glnAntrBC) and OmpR/EnvZ (genes
located in operon ompRenvZ) in E. coli. In contrast, M. smegmatis GlnR is characterized as
orphan response regulator (Amon, 2010), as the gene encoding its corresponding kinase is
not situated nearby, which makes its identification rather difficult. Due to this fact, different
approaches were used to find putative interaction partners of GlnR.
4.3.1.1 Global pull down analysis
First, a pull down experiment coupled with MALDI-ToF-MS was carried out. Therefore, the
Strep-GlnR protein was overexpressed in E. coli Rosetta2 and purified via affinity
chromatography as described in section 3.3.3.2 and 4.1.5. Before elution of the protein, total
cell extract of M. smegmatis SMR5 incubated for 60 minutes under nitrogen starvation was
added to the column leading to a mixture of Strep-GlnR and putative interaction partners in
the elution fractions. These fractions were separated in SDS PAGE (figure 34) and four
distinct bands at size of 55-75 kDa were analyzed via mass spectroscopy (University of
Cologne).
Fig. 34: Pull down experiment. A. Documentation of the experimental process in SDS PAGE. R: total cell extract of E. coli Rosetta2 with overexpressed Strep-GlnR. W1-W3: washing fractions. M: total cell extract of M. smegmatis SMR5 incubated for 60 minutes under nitrogen starvation. W4-W6: washing fractions. E1-E5: elution fractions. W7: washing fraction. B. Enlargement of elution fraction 2 (after enrichment of proteins) with purified Strep-GlnR at 31 kDa and four distinct protein bands at 55-75 kDa (see arrows), which were further investigated in MALDI-ToF-MS.
Results 99
A mass spectroscopic analysis revealed for protein 1 (approximately 75 kDa) closest relation
to a hypothetical protein CAT7_10475 from Carnobacterium sp. AT7 and for protein 4
(approximately 55 kDa) closest relation to a TetR-type transcriptional regulator from
Paenibacillus sp. JDR-2, indicating that these proteins were caught unspecifically. Protein 2
(approximately 70 kDa) was classified as glutamine synthetase I from E. coli, probably left
over from total Rosetta2 cell extract. Protein 3 (approximately 60 kDa) was the only
M. smegmatis protein found and classified as propionyl-CoA decarboxylase beta chain.
Propionyl-CoA decarboxylase is involved in fatty acid metabolism and thus probably no
interaction partner of GlnR.
4.3.1.2 Analyses of deletion and insertion mutants
As no GlnR interaction partner was found in a global pull down experiment (see section
4.3.1.1), another, bioinformatic approach was chosen. Genomic screening of various
actinomycete genomes was carried out (Amon, 2010). Here, the focus was on finding
putative sensor histidine kinases that appeared in every genome with a GlnR homolog and
were orphan kinases corresponding to the orphan location of glnR in the M. smegmatis
genome. Another condition was that these kinases should not appear in corynebacterial
genomes, as nitrogen metabolism in corynebacteria is regulated by AmtR. The screening
resulted in 22 putative sensor histidine kinases spotted in the genome of M. smegmatis that
met more or less accurate the criteria described above (for full list of candidates, see table
14, section 7.3, adapted from Amon, 2010). Four of these candidates were chosen for
further, experimental investigations: on the one hand, these were Msmeg_1918 and
Msmeg_5241, characterized as the best candidates that fulfilled all criteria according to
Amon (2010). On the other hand, Msmeg_4989, described as PhoR, was chosen. Although
homologs were also found in corynebacterial genomes (Amon, 2010), this kinase was of
special interest as it appeared also in transcriptome analyses carried out in this study. When
total transcript of the M. smegmatis wild type SMR5 was compared under nitrogen surplus
and starvation, it was found that the amount of transcript of msmeg_4989 was enhanced
under nitrogen starvation by a factor of 5.94 (refer to table 10, section 7.2).
Msmeg_0936, characterized as SenX3, was also a very interesting target for further
investigations, although it was also found in corynebacterial genomes and is not described
as orphan (Amon, 2010). Moreover, it is described as sensor histidine kinase of the
SenX3/RegX3-system controlling phosphate metabolism in M. smegmatis (Glover et al.,
2007), but in a recent publication (Rodríguez-García et al., 2009), a correlation between
phosphate and nitrogen metabolism was found in the related species S. coelicolor.
Results 100
A
B
D
C
1918
StuI BsaI
4122 bp
hph
StuI BsaI
2546 bp
BsaI
wt
d
wt (sco) d
1918StuI BsaI
4122 bp
StuI BsaI
3266 bp
BsaI
wt
d
Kin
hph
wt d
5241
BclI XmnI
4455 bp
hph
BclI XmnI
2149 bp
BclI
wt
d
wt d
4989
StuI StuI
6605 bp
pML814
StuI StuI
3813 bp
StuI
wt
i
wt i
Transcriptional control of nitrogen-involved genes such as glnR, glnA or amtB by PhoP
(RegX3 in M. smegmatis) was actually shown postulating “phosphate control over nitrogen
metabolism” in S. coelicolor.
Fig. 35: Southern blot analyses showing genomic situations in M. smegmatis wild type (wt) and deletion or insertion strains (d or i). A. Replacement of msmeg_1918 by hph. (sco): single cross over. B. Replacement of msmeg_1918 kinase domain by hph. C. Replacement of msmeg_5241 by hph. D. Insertion of plasmid pML814 into msmeg_4989.
Results 101
As a first experiment, deletion or insertion strains of three of the genes of interest were
generated as described in section 3.4.6. The plasmid pML814 (see table 2, section 3.1) was
inserted into msmeg_4989, leading to a disruption of the gene. The genes msmeg_1918 and
msmeg_5241 were completely replaced by a hygromycin resistance cassette, which was
subsequently removed by Flpe recombination. Additionally, only the putative kinase domain
of msmeg_1918 was deleted and a double deletion strain Δmsmeg_1918Δmsmeg_5241 was
generated. All genomic modifications were verified via Southern blot analysis showing DNA
fragments of distinct size for wild type and deletion or insertion strains (figure 35).
Putative effects of the chromosomal deletion of msmeg_1918 and msmeg_5241 or the
disruption of msmeg_4989 on nitrogen-dependent growth behavior and gene transcripts
were monitored. Growth experiments were carried out with all generated strains as described
in section 4.1.1. M. smegmatis wild type SMR5 and glnR deletion strain MH1 were carried
along as controls. As it was already described before (see section 4.1.1 and Amon et al.,
2008), no difference in growth of the wild type was observed when MSX was added to 7H9
minimal medium, whereas the glnR deletion strain MH1 was no longer able to grow after
addition of MSX (figure 36A). Furthermore, a deletion of the genes msmeg_1918 and
msmeg_5241 or a deletion of the kinase domain of msmeg_1918 as well as a disruption of
msmeg_4989 did not result in a change of growth behavior compared to the wild type. Figure
36A shows that this was detected for growth in 7H9 minimal medium and also for growth
under addition of MSX, which is supposed to cause nitrogen starvation to the cells by
interacting with glutamine synthetase I (Berlicki, 2008). Growth of the double deletion strain
Δmsmeg_1918Δmsmeg_5241 was also independent from MSX, but slightly reduced
compared to all other tested strains (figure 36A). The same growth experiments were also
performed using precursor strains where the hygromycin resistance gene hph has not yet
been removed. At this, no differences emerged to the strains without hph (data not shown),
except in the Δmsmeg_1918Δmsmeg_5241 strain, which showed even more reduced growth
(figure 36A). These data were clarified by comparing generation times and maximum oD600 of
the tested strains (figure 36B and C). While most of the strains showed a generation time of
about 4-5 hours and a maximum oD600 of 3-4, independently from presence or absence of
MSX, only for the glnR deletion strain MH1 a significantly enlarged generation time
(approximately 10 hours) and a reduced maximum oD600 (0.9) were detected. Moreover, also
a slightly enlarged generation time (6-8 hours) and a lower maximum oD600 (1.5-2) were
spotted for the strain Δmsmeg_1918Δmsmeg_5241, also independently from presence or
absence of MSX.
Results 102
Fig. 36: Growth of various M. smegmatis strains. A. Growth of the wild type SMR5, the glnR deletion strain MH1 and the strains Δmsmeg_1918, Δmsmeg_1918 kin, Δmsmeg_5241, Δmsmeg_1918Δmsmeg_5241 and Imsmeg_4989 was tested in 7H9 minimal medium (Δ), under addition of MSX (▲) and in 7H9-N (x). B. From these growth experiments, generation times were calculated in hours. C. The maximum oD600 of every tested strain is given. Light blue: 7H9-MSX. Dark blue: 7H9+MSX.
C
B
t [h
]
Maximum oD600
oD
600
Generation times
Ao
D6
00
t [h]
oD
60
0
t [h]
oD
60
0
t [h]
oD
60
0
t [h]
oD
60
0
t [h]
oD
60
0
t [h]
oD
60
0
t [h]
oD
60
0t [h]
Results 103
These data indicated that all tested M. smegmatis strains were still able to respond properly
to artificially caused nitrogen starvation. As MSX binds and thus blocks GS activity, further
growth of the cells can only be guaranteed by providing higher levels of GS and thus glnA
transcripts, which was proven to depend on GlnR (Amon et al., 2008). Consequently, GlnR
was still active in the tested strains and the putative activator of this response regulator was
not disabled. This gave a first hint that the corresponding GlnR interaction partner has not yet
been found.
Another interesting point obtained from these data was that a simultaneous deletion of
msmeg_1918 and msmeg_5241 obviously led to reduced growth even under nitrogen
surplus. As this was not seen for the single deletion mutants, it can be assumed that these
two kinases fulfill some function in growth of M. smegmatis in general and that a loss of one
of these kinases can be compensated by the other. Furthermore, a deletion of both of these
kinases was observed to lead to an even more reduced growth in the presence of
hygromycin.
In addition to the growth experiments, nitrogen-dependent transcript levels of genes involved
in nitrogen metabolism were investigated in every strain. As described in section 4.2.2, cells
were grown under nitrogen surplus until exponential growth phase and subsequently
transferred into nitrogen-free medium. Samples were taken at different time points. Signals of
the genes amtB (figure 37A), glnA (similar to amtB, not shown) and glnR (figure 37B) were
analyzed. As it has already been shown in this study, transcripts of GlnR target genes are
enhanced under nitrogen starvation in the wild type, whereas this is not the case in the
absence of GlnR (see figure 24, section 4.2.2). For that reason, total RNA samples of the
wild type SMR5 and the glnR deletion strain MH1 were carried along as controls. Transcript
levels were tested in the strains Δmsmeg_1918, Δmsmeg_1918 kin, Δmsmeg_5241,
Δmsmeg_1918Δmsmeg_5241 and Imsmeg_4989. As seen in figure 37, no significant
changes in transcript levels of amtB or glnR appeared in any of the tested mutant strains
compared to the wild type, indicating that nitrogen- and GlnR-dependent gene expression
was still completely functional in these strains.
Results 104
SMR5
MH1
Δmsmeg_1918
Δmsmeg_1918 kin
Δmsmeg_5241
Δmsmeg_1918Δmsmeg_5241
Imsmeg_4989
+N -N0 5 10 15 30 60 min +N -N0 5 10 15 30 60 min
amtB glnR
Fig. 37: RNA hybridization experiment. Total RNA from M. smegmatis strains SMR5, MH1, Δmsmeg_1918, Δmsmeg_1918 kin, Δmsmeg_5241, Δmsmeg_1918Δmsmeg_5241 and Imsmeg_4989, grown under nitrogen surplus (+N) and subsequently incubated under nitrogen starvation (-N) for one hour (time points 0, 5, 10, 15, 30 and 60 minutes), was used for hybridization with specific probes against the genes amtB and glnR.
4.3.1.3 Correlation between phosphate and nitrogen metabolism
Besides Msmeg_1918, Msmeg_5241 and Msmeg_4989, the putative involvement in GlnR
activation of another histidine kinase, namely SenX3, was postulated (see section 4.3.1.2).
Although this kinase is part of the two-component system SenX3/RegX3 regulating
phosphate metabolism in M. smegmatis (Glover et al., 2007), it might also be involved in
regulation of nitrogen-related genes, as described for S. coelicolor (Rodríguez-García et al.,
2009).
As a preliminary step to investigate a putative correlation between nitrogen and phosphate
metabolism in M. smegmatis, growth experiments were carried out. For this purpose, ST
medium was used according to Gebhard and Cook (2008). In this medium, L-asparagine and
ammonium chloride served as nitrogen sources, while K2HPO4 was used as phosphate
source (refer to table 3, section 3.2.1). As it can be seen in figure 38A, similar growth of the
M. smegmatis wild type SMR5 was monitored in both, 7H9 and ST medium. Cells were no
longer able to grow when ST-P medium was used, i.e. when no phosphate source was
available. Starting from that, further RNA hybridization experiments were performed. For this
purpose, cells were grown until exponential phase in ST or 7H9 medium, respectively. Then
they were transferred to either phosphate-free ST-P or nitrogen-free 7H9-N medium.
Samples were taken at different time points. After that, phosphate- or nitrogen-dependent
mRNA signals of different genes involved in phosphate (msmeg_0936 senX3, msmeg_0937
Results 105
A
oD
60
0
t [h]
A CB
+P -P10 1h 2h 4h 24h
senX3
regX3
pstS
amtB
glnR
senX3
regX3
pstS
+N -N0 5 10 15 30 60 min
SMR5
MH1
SMR5
MH1
SMR5
MH1
regX3 and msmeg_5782 pstS, encoding a phosphate ABC transporter) and nitrogen (amtB
and glnR) metabolism were monitored. However, no changes in senX3, regX3 or pstS
transcripts were spotted either due to phosphate or to nitrogen starvation (see figure 38B and
C). Transcript levels of nitrogen related genes amtB and glnR were also detected to be
independent from the phosphate status of the cells (figure 38B). These data gave a first
indication that the correlation between phosphate and nitrogen metabolism, which was
described for S. coelicolor (see above), does not apply for M. smegmatis.
Fig. 38: Analyses of growth and gene expression of M. smegmatis due to nitrogen and phosphate starvation. A. Growth in 7H9 (Δ), ST (♦) and ST-P (lacking phosphate, ◊) minimal medium. B. mRNA signals of senX3, regX3, pstS, amtB and glnR under phosphate surplus (+P) and 10 minutes and 1, 2, 4 and 24 hours after induction of phosphate starvation (-P). C. mRNA signals of senX3, regX3 and pstS under nitrogen surplus (+N) and 0, 5, 10, 15 and 60 minutes after induction of nitrogen starvation, tested in the strains SMR5 and MH1.
4.3.1.4 Analyses of protein-protein interactions and phosphorylation of GlnR
As deletion or disruption of genes encoding putative GlnR phosphorylating kinases did not
result in changes of growth or gene transcripts compared to the wild type, in vitro interaction
studies of purified proteins were carried out. For this purpose, GlnR was purified via Strep- or
MBP-tag as described in section 4.1.5. The sensor histidine kinases Msmeg_1918 and
Msmeg_5241 were purified using the same methods, resulting in MBP-1918 (97 kDa), MBP-
5241 (104 kDa), Strep-1918 (56 kDa) and Strep-5241 (64 kDa) shown in figure 39. The
phosphate metabolism-associated kinase SenX3* was purified via Strep-tag according to
Glover et al. (2007) without its pristine 131 amino acids N-terminal transmembrane domain
and was thus detected at 29 kDa (figure 39).
Results 106
100 kDa
85 kDa
70 kDa
60 kDa
50 kDa
40 kDa
30 kDa
- + 1918
Fig. 39: Purification of different kinases with Strep- or MBP-tag. All fusion proteins were overexpressed in E. coli Rosetta2 and purified as described in section 4.1.5. Specific bands were detected in SDS PAGE at 97 kDa (MBP-1918), 104 kDa (MBP-5241), 56 kDa (Strep-1918), 64 kDa (Strep-5241) and 29 kDa (Strep-SenX3*). In the last lane a mixture of Strep-SenX3* (29 kDa) and Strep-GlnR (31 kDa) is shown, indicating that these two proteins could be separated in SDS PAGE despite their similar size.
As a first test of interaction between Msmeg_1918 and GlnR, rising amounts of the purified
kinase were added to gel retardation samples including purified GlnR and the 220 bp
digoxigenin-labeled DNA fragment upstream of amtB. A putative interaction was supposed to
result in a large DNA-GlnR-kinase complex leading to an increased DNA shift. To exclude
interference of the 55 kDa maltose binding protein, only Strep-tagged GlnR and kinase were
used. Although elevation of the DNA seemed to vary a bit in the different samples, addition of
Strep-1918 did not result in an increased DNA shift, indicating that no protein-protein
interaction took place during this experiment (see figure 40).
Fig. 40: Gel retardation experiment. A 220 bp digoxigenin-labeled amtB promoter fragment was used as negative (-) control. 100 ng purified Strep-GlnR were added (+). To that, rising amounts of Strep-1918 were given (100, 200, 1000 and 2600 ng).
Results 107
To investigate putative phosphorylation of the response regulator GlnR by one of the chosen
sensor histidine kinases, phosphorylation assays with [γ-32P]-labeled ATP were carried out
as described in section 3.3.3.9. In a first experiment, autophosphorylation of the kinases was
tested. While this has already been proven for phosphate metabolism-associated kinase
SenX3 in different mycobacteria such as M. bovis (Himpens et al., 2000) and M. smegmatis
(Glover et al., 2007), nothing was known so far about (auto)phosphorylation qualities of
Msmeg_1918 and Msmeg_5241.
For this experiment, 1 µg kinase was mixed with 5 µM ATP and 0.05 µM [γ-32P] ATP and
incubated at 30°C. Autophosphorylation of Msmeg_1918, Msmeg_5241 and SenX3* already
started after one minute, while the strongest signals were detected after 15 minutes of
incubation (see figure 41A). In a second approach, purified GlnR protein was added in 10
fold surplus compared to the kinases, but no signal was detected at 31 (Strep-GlnR) or
71 (MBP-GlnR) kDa, respectively (figure 41B). This led to the conclusion that either these
kinases were not able to phosphorylate GlnR or that in this in vitro experiment a
phosphorylation stimulating factor was missing, which would be present in vivo in the cells.
For that reason, 5 mM Na-glutamate or 2-oxoglutarate were added to the samples. These
substances are known to function as indicators of nitrogen starvation in some bacteria (refer
to section 2.2) and might thus activate phosphorylation of the response regulator GlnR by its
corresponding kinase. However, in this experiment, Na-glutamate or 2-oxoglutarate did not
stimulate phosphorylation of GlnR by one of the tested kinases (data not shown).
Still proceeding on the assumption that a small metabolite was missing in this experiment to
activate GlnR phosphorylation, total cell extract of the M. smegmatis wild type SMR5,
previously incubated for one hour under nitrogen starvation, was added to the samples
described above. In these samples, a weak signal of radioactive labeled phosphate was
detected at a size of approximately 30 kDa, independently from presence or absence of
Msmeg_1918, Msmeg_5241, SenX3* or even purified GlnR (figure 41C). When total cell
extract was filtered and a fraction of proteins larger than 10 kDa was used for
phosphorylation assays, the 30 kDa band was still visible, but when the fraction smaller than
10 kDa was used, no signal could be detected (figure 41C). This indicated that some protein
at approximately 30 kDa size was phosphorylated during the experiment. To identify this
protein, different cell extracts were used. Addition of total cell extract of the C. glutamicum
wild type ATCC 13032, incubated for one hour under nitrogen starvation, resulted in loss of
phosphorylation of the 30 kDa protein, suggesting that it might be GlnR, as this does not
exist in C. glutamicum (figure 41D). An involvement of Msmeg_1918 and Msmeg_5241 in
phosphorylation of this protein was definitely excluded by using total cell extract of
M. smegmatis Δmsmeg_1918Δmsmeg_5241. A signal at 30 kDa was still detected (figure
41D). More evidence against the assumption that the phosphorylated 30 kDa protein was
Results 108
GlnR was given by using purified Strep-GlnR and total M. smegmatis cell extract smaller
than 10 kDa. This experiment showed that no additional metabolite in M. smegmatis
activated phosphorylation of purified GlnR (figure 41D). Furthermore, when purified MBP-
GlnR was added to total M. smegmatis cell extract in the experiment, only the 30 kDa band
was visible and no band at 71 kDa (figure 41D). The ultimate evidence against GlnR as the
phosphorylated 30 kDa protein was given by the use of total cell extract of the M. smegmatis
glnR deletion strain MH1, previously incubated for one hour under nitrogen starvation. Even
in this approach, the 30 kDa band was detected (figure 41D).
Summarizing these results, it can be said that sensor histidine kinases Msmeg_1918,
Msmeg_5241 and SenX3* were able to phosphorylate themselves in in vitro experiments
using [γ-32P]-labeled ATP, but no phosphorylation of purified GlnR protein was detected.
When total cell extract of M. smegmatis was used, phosphorylation of a 30 kDa protein was
monitored. This protein was not detected when the experiment was carried out with
C. glutamicum cell extract, pointing out that it might be GlnR. This was clearly disproved by
using total cell extract of M. smegmatis ΔglnR, where the phosphorylated 30 kDa protein still
appeared. The identity of the phosphorylated protein remained unclear.
Results 109
Fig. 41: In vitro phosphorylation experiments with [γ-
32P] ATP. Radioactive signals detected on a
phosphor imaging plate (right) and detection of protein bands in SDS PAGE (left) are shown. A. Autophosphorylation of kinases Msmeg_1918 (56 kDa with Strep-tag), Msmeg_5241 (64 kDa with Strep-tag) and SenX3* (29 kDa with Strep-tag). B. When 10 fold surplus of Strep-GlnR (31 kDa) or
A Autophosphorylation of kinases
56 kDa
64 kDa
29 kDa
1918 5241 SenX3*
B Addition of GlnR
C Addition of total cell extract SMR5
D Addition of different cell extracts
56 kDa
31 kDa
64 kDa
31 kDa
71 kDa
31 kDa
29 kDa
1918 + GlnR 5241 + GlnR SenX3* + GlnR
1918 + GlnR + ce 5241 + GlnR + ce SenX3* + GlnR + ce ce >10 <10
56 kDa
31 kDa
64 kDa
31 kDa
71 kDa
31 kDa
29 kDa
GlnR + ce Cgl ce Δ1918Δ5241 GlnR + ce SMR5<10 MBP-GlnR + ce SMR5 ce MH1 ΔglnR
71 kDa
31 kDa
Results 110
MBP-GlnR (71 kDa) was added to each sample (see A), only signals of the phosphorylated kinases were detected. C. Addition of total cell extract (ce) from M. smegmatis SMR5, previously incubated for one hour under nitrogen starvation. When ce was added to a sample including Strep-1918 and Strep-GlnR, two radioactive bands at 56 and approximately 30 kDa were detected. When ce was added to a sample including Strep-5241 and Strep-GlnR, two radioactive bands at 64 and approximately 30 kDa were detected. When ce was added to two samples including Strep-SenX3* and Strep-GlnR (left) or MBP-GlnR (right), respectively, one radioactive band at 29 kDa was detected probably hiding the weaker 30 kDa band. The 30 kDa band was also seen when only ce was used without addition of any purified protein. Cell extract was filtered; the 30 kDa band was also detected in ce bigger that 10 kDa, not in ce smaller than 10 kDa. D. When purified MBP-GlnR (left) or Strep-GlnR (right) were incubated with total cell extract of C. glutamicum (Cgl), no radioactive signal was detected. Usage of only cell extract from msmeg_1918msmeg_5241 double deletion strain resulted again in appearance of the 30 kDa phosphorylated band. This band disappeared in a sample where purified Strep-GlnR and M. smegmatis SMR5 cell extract (ce) smaller than 10 kDa were mixed. Again, the 30 kDa band was detected when total M. smegmatis SMR5 cell extract was added to purified MBP-GlnR. The 30 kDa phosphorylated protein was also seen when only total cell extract from the glnR deletion strain MH1, which has previously been incubated for one hour under nitrogen starvation, was used.
After all these experiments, it was still unclear if GlnR, which as a member of the OmpR-
family of transcriptional regulators (Amon et al., 2008) is supposed to be a response
regulator of a bacterial two-component system, is phosphorylated at all. Therefore, a new in
vitro phosphorylation assay was performed using acetyl [32P] phosphate. In this approach, no
additional kinase is required for phosphorylation. First, acetyl [32P] phosphate was produced
from [32P] phosphoric acid as described in section 3.3.3.9. Phosphorylation assays with GlnR
were carried out according to Hiratsu et al. (1995) and Bouché et al. (1998). For this
purpose, 10 µg purified Strep-GlnR protein were mixed with 50 mM acetyl [32P] phosphate
and incubated at 30°C, while samples were taken after 1, 5, 10, 15, 30 and 60 minutes
(figure 42A). In another approach, purified GlnR was mixed with rising concentrations of
acetyl [32P] phosphate (0, 1, 2, 5, 10, 50 and 100 mM) and incubated for 30 minutes at 30°C
(figure 42B). Samples were analyzed in SDS PAGE and on phosphor imaging plate as
described in section 3.3.3.9. As it can be seen in figure 42, no distinct signal at 31 kDa
(Strep-GlnR) was detected, indicating that GlnR was not phosphorylated in this approach.
Further modifications of this experiment, such as enlargement of reaction time, exchange of
protein against MBP-GlnR or the usage of different reaction buffers according to Hiratsu et
al. (1995), Bouché et al. (1998), Chamnongpol and Groisman (2000) and O’Hare et al.
(2008) did not improve the result (data not shown). So, phosphorylation of putative response
regulator protein GlnR has not yet been proven with this in vitro approach. As a
consequence, a new experiment was performed to analyze putative phosphorylation of
M. smegmatis GlnR in vivo.
Results 111
0 1 5 10 15 30 60 min 0 1 2 5 10 50 100 (50) mM ACP*
A B
Fig. 42: Phosphorylation assay. A. A mixture of 10 µg purified Strep-GlnR and 50 mM acetyl [32
P] phosphate (ACP*) was incubated at 30°C. Samples were taken after 0, 1, 5, 10, 15, 30 and 60 minutes and analyzed in SDS PAGE (above) and on phosphor imaging plate (below). B. 10 µg purified Strep-GlnR were mixed with 0, 1, 2, 5, 10, 50 and 100 mM acetyl [
32P] phosphate (ACP*) and
incubated for 30 minutes at 30°C. A sample without protein (50 mM ACP*) was carried along as control. Samples were analyzed in SDS PAGE (above) and on phosphor imaging plate (below).
For in vivo analyses of putative phosphorylation of M. smegmatis transcriptional regulator
GlnR, the wild type SMR5 and the glnR deletion strain MH1 were grown under nitrogen
surplus until exponential phase. After samples were taken, cells were transferred into
nitrogen-free medium and incubated for another hour, before new samples were taken. Total
cell extract of SMR5+N, SMR5-N, MH1+N and MH1-N was prepared and each analyzed in
SDS and native PAGE. Detection of GlnR was carried out in Western blot analyses using a
GlnR-specific antibody produced as described in section 4.1.6. As binding of PO43- increases
movement rates of proteins in a gel, a difference between phosphorylated and non-
phosphorylated proteins can be detected. This was not monitored in this experiment. Neither
in SDS (figure 43A) nor in native (figure 43B) PAGE an increased movement rate of GlnR in
the cell extract of the wild type SMR5 under nitrogen starvation (-N) was detected compared
to nitrogen surplus (+N). Total cell extract of the glnR deletion strain MH1 was carried along
as a control against putative unspecific binding of the antibody.
Results 112
30 kDa
A B
Fig. 43: Western blot analyses using a GlnR-specific antibody. A. Total cell extracts of the M. smegmatis wild type SMR5 and the glnR deletion strain MH1, incubated under nitrogen surplus (+N) and nitrogen starvation (-N), were analyzed in SDS PAGE. B. Total cell extracts (as described in A) were analyzed in native PAGE.
Summarizing these experiments, it can be said that putative phosphorylation of GlnR has not
yet been proven, neither in in vitro approaches using [32P]-labeled ATP or acetyl phosphate,
nor in in vivo studies with the M. smegmatis wild type SMR5 grown under nitrogen surplus
and starvation. Nevertheless, M. smegmatis GlnR is classified as OmpR-type transcriptional
regulator (Amon et al., 2008) and thus, most likely activated via phosphorylation by a
corresponding sensor histidine kinase.
4.3.2 Investigation of phosphorylation residues
Although phosphorylation of transcriptional regulator GlnR of M. smegmatis has not yet been
shown and a corresponding sensor histidine kinase could not yet be identified in this study
(see section 4.3.1), it is classified as OmpR-type regulator (Amon et al., 2008). These
proteins are response regulators of bacterial two-component systems, characterized by
interaction with corresponding kinases at specific amino acid residues (Itou and Tanaka,
2001; Yoshida et al., 2006). In an alignment of amino acid sequences of GlnR proteins from
different actinobacteria, three aspartic acid residues were identified as putative
phosphorylation sites (see figure 44 and Amon et al., 2008).
Results 113
43 48 52
Fig. 44: Alignment of GlnR homologs from different actinomycetes. MSMEG: M. smegmatis; MAP: Mycobacterium avium subsp. paratuberculosis; Mb: M. bovis; Rv: M. tuberculosis H37rv; SCO: S. coelicolor; SAV: S. avermitilis; nfa: N. farcinica; RHA1: Rhodococcus sp. strain RHA1; FRAAL: F. alni ACN14a; Francci3: Frankia sp. strain Cci3; Tfu: T. fusca; BL: B. longum; AAur: Arthrobacter aurescens; Lxx: Leifsonia xylii; ANA: A. naeslundii; AAN77733: A. mediterranei. Identical amino acids are indicated by black, similar amino acids by grey background. *: identical residues; :: conserved substitutions/residues; .: semi-conserved substitutions. Adapted from Amon et al. (2008). The N-terminal 67 amino acids are shown, including three highly conserved aspartic acid residues at position 43, 48 and 52 (highlighted in blue).
To investigate the role of these aspartic acid (Asp) residues in activation of GlnR, they were
each replaced by alanine (Ala) and by the structural more similar amino acids asparagine
(Asn) and glutamate (Glu). A triple exchange of Asp43, Asp48 and Asp52 to alanine was
also performed. Additionally, an exchange of Ala45 to serine was generated as a control.
Exchange of amino acids was attained by introducing specific point mutations into the glnR
gene. This was done by two-step PCR as described in section 3.3.1.5 and 3.3.1.6. The
obtained glnR* variants with specific base exchanges were cloned into the vector pMN016,
an E. coli/M.smegmatis shuttle vector (see table 2, section 3.1), and thus used for
transformation of the glnR deletion strain MH1. Growth and RNA hybridization experiments
were performed in order to investigate the ability of the constructed glnR* variants to
compensate the genomic glnR deletion. M. smegmatis MH1 transformed with the empty
vector pMN016control was carried along as negative control. MH1 transformed with the
construct pMN016glnR was used as a positive control, as complementation by this plasmid
encoded glnR gene has already been shown before (Amon et al., 2008; Bräu, 2008). First,
growth experiments were carried out. For all control and newly generated strains similar
growth with a generation time of approximately 4.5 hours and a maximum oD600 of
approximately 3.5 was monitored in 7H9 medium, whereas none of the strains grew in 7H9-N
medium (see figure 45). When 200 mM MSX, a glutamine synthetase binding and blocking
substrate (Berlicki, 2008), were added to the 7H9 medium, only the wild type SMR5 and the
MH1 strain transformed with pMN016glnR were able to grow, suggesting the existence of a
Results 114
oD
600
t [h]
oD
600
t [h]
oD
600
t [h]
oD
600
t [h]
oD
600
t [h]
oD
600
t [h]
oD
600
t [h]
oD
600
t [h]
oD
600
t [h]
oD
600
t [h]
oD
600
t [h]
oD
600
t [h]
oD
600
t [h]
oD
600
t [h]
oD
600
t [h]
functional GlnR protein in these strains. As expected, no growth under addition of MSX was
detected for the glnR deletion strain MH1 and the same transformed with empty vector
pMN016control (figure 45). Furthermore, no growth under MSX was detected when one of
the newly generated glnR* variants was used for complementation of the genomic glnR
deletion in MH1 (figure 45). This indicated that an exchange of either aspartic acid 43, 48 or
52 to either alanine, asparagine or glutamate resulted in a loss of functional GlnR protein. A
triple exchange of aspartic acid 43, 48 and 52 to alanine showed the same. Surprisingly, also
an exchange of adjacent alanine 45 to serine resulted in discontinuance of growth under
MSX (figure 45), suggesting that the loss of functional GlnR protein was not due to missing
phosphorylation sites, but rather due to loss of protein structure.
Fig. 45: Growth experiments with M. smegmatis wild type SMR5 and glnR deletion strain MH1, which was transformed with empty plasmid pMN016control, pMN016glnR and pMN016glnR*. glnR* are variants obtained from specific point mutations, leading to exchange of either aspartic acid (Asp) 43, 48 or 52 to either alanine (Ala), asparagine (Asn) or glutamate (Glu), to exchange of aspartic acid (Asp) 43, 48 and 52 to alanine (Ala) or to exchange of alanine (Ala) 45 to serine (Ser). Δ: growth in 7H9 minimal medium. ▲: growth under addition of 200 mM MSX. x: 7H9-N.
Results 115
SMR5
MH1
pMN016control
pMN016glnR
pMN016glnRAsp43Ala
pMN016glnRAsp48Ala
pMN016glnRAsp52Ala
pMN016glnRAsp43Asn
pMN016glnRAsp48Asn
pMN016glnRAsp52Asn
pMN016glnRAsp43Glu
pMN016glnRAsp48Glu
pMN016glnRAsp52Glu
pMN016glnR
Asp43/48/52Ala
pMN016glnRAla45Ser
+N -N0 15 30 60 +N -N0 15 30 60 +N -N0 15 30 60 min
amtB glnA glnR
The same results were obtained when RNA hybridization experiments were performed with
all strains mentioned above. Here, transcript levels of glnR and GlnR target genes amtB and
glnA were investigated under nitrogen surplus and after 0, 15, 30 and 60 minutes of nitrogen
starvation. As it had already been shown before (Amon et al., 2008), the M. smegmatis wild
type SMR5 was able to increase amtB and glnA mRNA levels under nitrogen starvation
(figure 46). In this experiment, this was only detected for MH1 transformed with
pMN016glnR, indicating a functional complementation of the genomic glnR deletion, whereas
any exchange of Asp43, 48 or 52 or even exchange of Ala45 led to a loss of GlnR function
(figure 46). On the contrary, a high amount of mRNA of the corresponding glnR* variants
encoded on vector pMN016 was detected (figure 46).
Fig. 46: RNA hybridization experiments. 1 µg total RNA of M. smegmatis wild type SMR5, glnR deletion strain MH1 and MH1 transformed with empty plasmid pMN016control, pMN016glnR and pMN016glnR* were used for hybridization with specific RNA probes against amtB, glnA and glnR. glnR* are variants with exchange of either aspartic acid (Asp) 43, 48 or 52 to either alanine (Ala), asparagine (Asn) or glutamate (Glu), with exchange of aspartic acids (Asp) 43, 48 and 52 to alanine (Ala) or with exchange of alanine (Ala) 45 to serine (Ser).
Results 116
30 kDa
To answer the question whether the observed loss of GlnR function was due to loss of
phosphorylation sites or rather due to loss of protein structure, Western blot analyses were
performed using the GlnR-specific antibody produced as described in section 4.1.6 in order
to detect GlnR protein in total cell extracts. For that purpose, total cell extract was prepared
from every strain used in growth and RNA hybridization experiments described above,
namely SMR5, MH1 and MH1 transformed with pMN016control, pMN016glnR and
pMN016glnRAsp43Ala, Asp43Asn, Asp43Glu, Asp48Ala, Asp48Asn, Asp48Glu, Asp52Ala,
Asp52Asn, Asp52Glu, Asp43/48/52Ala and Ala45Ser. As it is shown in figure 47, a protein
band at GlnR size of 28 kDa was only detected in total cell extract of the wild type SMR5 and
the glnR deletion strain MH1 transformed with pMN016glnR, which was the only construct
able to complement the genomic deletion (refer to figure 45 and 46). These results indicated
that the monitored loss of GlnR function by exchanging specific amino acids was rather due
to loss of protein structure and stability in M. smegmatis than to a phosphorylation problem.
Fig. 47: Western blot analysis. Total cell extract from M. smegmatis wild type SMR5, glnR deletion strain MH1 and MH1 transformed with pMN016control, pMN016glnR and pMN016glnRAsp43Ala, Asp43Asn, Asp43Glu, Asp48Ala, Asp48Asn, Asp48Glu, Asp52Ala, Asp52Asn, Asp52Glu, Asp43/48/52Ala and Ala45Ser was used for detection of GlnR at 28 kDa with a GlnR-specific antibody.
Although the generated GlnR* variants could not be detected in total cell extracts of
M. smegmatis, monitoring of the corresponding transcripts in E. coli Rosetta2 and purification
of the proteins via Strep-tag was possible. Figure 48A shows an RNA hybridization
experiment with a specific probe against glnR, indicating that high amounts of transcripts of
the glnR* variants were indeed present in E. coli. Furthermore, all GlnR* proteins were
detected in SDS PAGE (figure 48B) and Western blot analysis using the GlnR-specific
antibody (figure 48C). This indicated a successful purification of the single GlnR* variants
and thus the completeness of their structure in E. coli, even though single amino acids were
exchanged.
Results 117
B
31 kDa
C
31 kDa
A
Fig. 48: Analyses of purification of GlnR* variants in E. coli. A. Transcripts of the strep-glnR* variants were monitored by hybridization with a specific glnR probe. B. All purified GlnR* variants were detected in SDS PAGE at a size of 31 kDa. C. Detection of all purified GlnR* variants via Western blot analysis with a GlnR-specific antibody.
Purified GlnR* variants were supposed to be used in further experiments such as
phosphorylation assays. As phosphorylation of the wild type GlnR protein could not definitely
be shown (see section 4.3.1.4), they were only used for gel retardation studies to investigate
a putative effect of the N-terminal amino acid exchanges on DNA binding behavior of GlnR.
As it is shown in figure 49, every tested GlnR* variant was able to bind to a 220 bp
digoxigenin-labeled DNA fragment upstream of amtB in the same manner as wild type GlnR.
This demonstrated that the exchange of single amino acids in the N-terminal region of GlnR
had no influence on DNA binding of the protein, at least when it was purified from E. coli.
Fig. 49: Gel retardation experiment. Different purified GlnR* variants were used, as well as a 220 bp digoxigenin-labeled promoter fragment of amtB. Lane 1: free DNA, lane 2-6: addition of GlnR* variants (1 µg each) with exchange of aspartic acid 52 to alanine, asparagine and glutamate, of alanine 45 to serine and of aspartic acid 48 to asparagine.
Results 118
Summarizing the latest results, it can be stated that phosphorylation of M. smegmatis
transcriptional regulator GlnR at one or all of the predicted aspartic acid residues 43, 48 and
52 has not yet been proven. However, an exchange of one of these amino acids led to a
complete loss of GlnR function, which was shown in growth and RNA hybridization
experiments (see figure 45 and 46). Furthermore, GlnR function was also abolished when an
adjacent amino acid, alanine 45, was exchanged indicating that the loss of GlnR function
might rather be a problem of protein stability in M. smegmatis.
4.4 Nitrate and nitrite metabolism in M. smegmatis
Based on prior results obtained in this study, a closer investigation of nitrate and nitrite
metabolism in M. smegmatis was started. Extensive studies of nitrate and nitrite metabolism
in mycobacteria have just recently begun, mainly focusing on the importance for virulence of
M. bovis or M. tuberculosis, as these pathogens are often forced to survive under anaerobic
conditions after infiltrating host cells (see Weber et al., 2000; Sohaskey and Modesti, 2008).
A variety of different genes putatively involved in nitrate and nitrite transport or reduction
have been identified among the mycobacteria, while researchers disagree about their
assimilatory or dissimilatory function. While Malm et al. (2009) talk about the “mediation of
assimilatory nitrate and nitrite reduction” by NarGHJI and NirBD, others describe these
enzymes as involved in nitrate respiration under anaerobic conditions (Khan and Sarkar,
2006).
In M. smegmatis, a variety of genes and operons encoding enzymes putatively involved in
nitrate and nitrite metabolism exists. These were identified in a bioinformatic approach
(Amon et al., 2009) as assimilatory nitrite reductase (msmeg_0427/0428 nirBD), assimilatory
nitrate reductase (msmeg_5140-5137 narGHJI) and nitrate/nitrite transporters (msmeg_5141
narK and msmeg_0433 narK3). On the contrary, narGHJI has previously been described as
respiratory nitrate reductase in M. smegmatis (Khan and Sarkar, 2006; Khan et al., 2008).
Another, putative assimilatory nitrate reductase is encoded by msmeg_2837 (narB).
Interestingly, the homolog nasA in S. coelicolor is positively regulated by GlnR (Wang and
Zhao, 2009). Furthermore, it was shown in the related pathogen M. tuberculosis that a narG
deletion strain failed to grow on nitrate and a nirB deletion strain failed to grow on both,
nitrate and nitrite as single nitrogen source (Malm et al., 2009). The authors also showed
regulation of nirBD by GlnR. These results correlate with observation made earlier in this
study. Here, it was also seen that growth of M. smegmatis with nitrate or nitrite as single
nitrogen source was only possible in the presence of GlnR (refer to section 4.1.1).
Interestingly, nitrogen response was induced when nitrate or nitrite was used as single
Results 119
nitrogen source (refer to figure 11, section 4.1.2). Moreover, enhanced amounts of mRNA of
nirBD and narK3 were detected in total transcriptome analyses in the wild type under
nitrogen starvation, whereas this was not observed for narK, the narGHJI operon or narB
(section 4.2.1). When total transcript of the wild type SMR5 was compared to that of the glnR
deletion strain MH1, the same pattern was reported. Enhanced transcripts of nirBD and
narK3 were reported in the presence of GlnR, whereas this was not shown for narK, the
narGHJI operon or narB (section 4.2.1). GlnR-dependence was verified via RNA
hybridization experiments and/or real time RT PCR (see section 4.2.2). Subsequently
performed gel retardation experiment did not reveal binding of GlnR to promoter fragments of
nirBD or the nar operon (see figure 28, section 4.2.3).
Considering these results, the question arose if the genes encoding putative nitrate and
nitrite transporters and reductases are controlled by further regulatory proteins which are
indeed encoded by genes located nearby on the genome. The gene msmeg_0426, which is
located directly upstream of nirBD, encodes a GntR-family regulatory protein. A TetR-type
regulator is encoded by msmeg_2106, a gene whose homologs in Mycobacterium gilvum
and Mycobacterium vanbaalenii are located in close genomic neighborhood of nirBD (J.
Amon, personal communication). Furthermore, msmeg_5143 was identified as encoding
HTH-type transcriptional regulator DegA, a putative regulatory protein for the nar operon. To
investigate the role of these putative regulators and nitrate/nitrite reduction systems, insertion
mutagenesis was performed. The genes msmeg_0426 (regulator), msmeg_2106 (regulator),
msmeg_2837 (narB), msmeg_5140 (narG) and msmeg_5143 (regulator) were disrupted by
genomic insertion of the plasmid pML814 (see section 3.4.6 and 4.3.1.2) and insertion was
verified via Southern blot analyses (see figure 50).
Results 120
A
B
D
C
wt i
E
5143
SnaBI PacI
>13000 bp
pML814
SnaBI PacI
4809 bp
PacI
wt
i
wt i
wt i
2106
NruI NruI
3040 bp
pML814
NruI NruI
wt
i
wt i
0426
SphI SphI
9172 bp
pML814
SphI SphI
5402 bp
SspI
wt
i
wt i
6725 bp
2837 narB
SphI SphI
6885 bp
pML814
SphI SphI
wt
i
12814 bp
5140 narG
EcoRV NsiI
4996 bp
pML814
EcoRV NsiI
wt
i
10924 bp
Fig. 50: Southern blot analyses showing genomic situations in M. smegmatis wild type (wt) and insertion strains (i). A. Insertion of plasmid pML814 into msmeg_0426. B. Insertion of plasmid pML814 into msmeg_2106. C. Insertion of plasmid pML814 into msmeg_2837 (narB). D. Insertion of plasmid pML814 into msmeg_5140 (narG). E. Insertion of plasmid pML814 into msmeg_5143.
Results 121
To determine the importance of the tested genes, growth experiments were carried out. As
shown in figure 51A, no differences in growth in 7H9 minimal medium were observed for any
of the generated insertion strains compared to the wild type SMR5 or the glnR deletion strain
MH1, indicating that none of the disrupted genes was generally required for growth. When
10 mM potassium nitrate were used as single nitrogen source, the glnR deletion strain MH1
showed no growth at all and Imsmeg_5140 (narG) an intensely reduced growth. This effect
was abolished for Imsmeg_5140 (narG) when a higher concentration of nitrate (100 mM) was
used. Here, all insertion strains showed growth behavior very similar to the wild type SMR5
(figure 51A). Also when 10 mM sodium nitrite were used as single nitrogen source, none of
the newly generated insertion strains failed to grow (figure 51A). These observations were
elucidated by calculating generation times and showing the maximum oD600 reached by the
tested strains in this experiment. Generation times were lowest (approximately 4-5 hours) in
7H9 medium, independently from any genomic insertion, and comparatively high in media
with nitrate or nitrite as nitrogen source (approximately 8-15 hours, see figure 51B).
Generation times higher than 30 hours (open bars) indicated no growth. This was only the
case for MH1 in nitrate and nitrite and for Imsmeg_5140 (narG) in 10 mM nitrate. The highest
maximum oD600 of approximately 4 was again reached in 7H9 medium, whereas this was
lower in media with nitrate or nitrite (figure 51C). Only the glnR deletion strain MH1 did not
reach an oD600 of 1 in medium with nitrate and nitrite, indicating no growth in these media.
Summarizing these results, it can be said that a disruption of the genes msmeg_0426,
msmeg_2106, msmeg_2837 (narB), msmeg_5140 (narG) and msmeg_5143 did not lead to
differences in growth behavior compared to the wild type, neither in 7H9 minimal medium nor
with nitrate or nitrite as single nitrogen source. Only the disruption of narG seemed to reduce
growth with 10 mM nitrate, but this effect was abolished when higher nitrate concentrations
were used.
As it was assumed that regulatory proteins encoded by msmeg_0426, msmeg_2106 and
msmeg_5143 might control expression of genes involved in nitrate and nitrite reduction, RNA
hybridization experiments were performed to investigate transcription levels in the different
strains under varying nitrogen sources. For that, all insertion strains as well as SMR5 and
MH1 as controls were grown in 7H9 medium until exponential phase and then transferred
into nitrogen-free medium or medium with 10 mM potassium nitrate or sodium nitrite as
single nitrogen source. Samples were taken at different time points, from which total RNA
was prepared. Signals of the genes nirB (encoding nitrite reductase subunit), narG (encoding
nitrate reductase subunit) and amtB (encoding an ammonium transporter) were monitored
(figure 52).
Results 122
A
C
BGeneration times
Maximum oD600
oD
60
0t
[h]
7H9 10 mM nitrate 100 mM nitrate 10 mM nitrite
7H9 10 mM nitrate 100 mM nitrate 10 mM nitrite
Fig. 51: Growth of M. smegmatis wild type SMR5, glnR deletion strain MH1 and strains Imsmeg_0426, Imsmeg_2106, Imsmeg_2837 (narB), Imsmeg_5140 (narG) and Imsmeg_5143. A. Growth curves in 7H9 (Δ) and in 7H9-N medium with 10 mM potassium nitrate (○), 100 mM potassium nitrate (●) and 10 mM sodium nitrite (▲). B. Calculated generation times in hours. C. Maximum oD600.
Results 123
-N Sodium nitrite Potassium nitrate
SMR5
MH1
I0426
I2106
I2837 (narB)
I5140 (narG)
I5143
+N 5 15 30 60 5 15 30 60 5 15 30 60 min
nirB
-N Sodium nitrite Potassium nitrate
SMR5
MH1
I0426
I2106
I2837 (narB)
I5140 (narG)
I5143
amtB
+N 5 15 30 60 5 15 30 60 5 15 30 60 min
-N Sodium nitrite Potassium nitrate
SMR5
MH1
I0426
I2106
I2837 (narB)
I5140 (narG)
I5143
+N 5 15 30 60 5 15 30 60 5 15 30 60 min
narG
A
B
C
As shown in figure 52A, the transcript level of narG was weak and independent from the
nitrogen source used and also from the disruption of any of the genes encoding a putative
regulatory protein. It did also not depend on GlnR, which was observed before (see section
4.2.1). On the contrary, the transcript level of nirB was strictly depending on GlnR (see figure
52B and section 4.2.1 and 4.2.2). Furthermore, nirB transcripts were increased under
nitrogen starvation (-N) and when nitrate or nitrite were used as single nitrogen source. The
same pattern was monitored for amtB (see figure 52C), again independent from the
disruption of the tested genes.
Fig. 52: RNA hybridization experiments. mRNA levels were tested in the M. smegmatis strains SMR5, MH1, Imsmeg_0426, Imsmeg_2106, Imsmeg_2837 (narB), Imsmeg_5140 (narG) and Imsmeg_5143, incubated under nitrogen surplus (+N), nitrogen starvation (-N) and with 10 mM potassium nitrate or sodium nitrite as single nitrogen source. Samples were taken after 5, 15, 30 and 60 minutes. A. Transcripts of narG. B. Transcripts of nirB. C. Transcripts of amtB.
Results 124
As a summary of the latest results it can be said that the putative regulatory proteins
encoded by msmeg_0426, msmeg_2106 and msmeg_5143 were not involved in growth of
M. smegmatis on nitrate or nitrite. Transcript levels of narG or nirB, encoding nitrate/nitrite
reduction systems, as well as amtB did not change when one of these genes was disrupted.
A strain with disruption of msmeg_2837 (narB), putatively encoding a further nitrate
reductase, showed also no differences in growth or gene transcripts compared to the wild
type. Only when msmeg_5140 (narG) was disrupted, the resulting strain showed reduced
growth in medium with 10 mM nitrate as single nitrogen source. But this effect disappeared
when higher amounts of nitrate were used. mRNA levels of nirB or amtB were also not
changed in this strain compared to the wild type. All results obtained in this study so far
indicated that uptake, as well as assimilation of nitrate and nitrite in M. smegmatis is
mediated by nitrate/nitrite transporters NarK and NarK3, nitrate reductase NarGHJI and
nitrite reductase NirBD, whereas NarK3 and NirBD are controlled by GlnR.
4.5 Investigation of a conserved mode of action of GlnR in mycobacteria
Up to this point, this study revealed the global role of OmpR-type regulator GlnR for nitrogen
metabolism in M. smegmatis. Whereas the wild type SMR5 was able to use a variety of
different substrates as single nitrogen source, this ability was reduced in the absence of
GlnR (see section 4.1.1). Additionally, it was shown that GlnR has a great influence on
transcript levels of more than 30 target genes under nitrogen starvation (see section 4.2.1
and 4.2.2). Binding of GlnR to promoter sequences of about half of these genes was also
demonstrated (see section 4.2.3). These data indicated the great importance of GlnR for
survival of M. smegmatis under nitrogen limitation. A similar result was obtained in studies of
the related species S. coelicolor (Tiffert et al., 2008). Furthermore, the authors suggested a
highly conserved mode of action of GlnR among the actinomycetes, as binding of
S. coelicolor GlnR to glnA promoter fragments of different actinomycetes was reported.
Moreover, a genomic glnR deletion in S. coelicolor could be complemented by
A. mediterranei glnR (Yu et al., 2006; Tiffert et al., 2008).
The glnR genes of M. smegmatis and M. tuberculosis and their corresponding proteins show
very high sequence homology. Not only the putative binding motif upstream of target genes
such as amtB or glnA is almost identical (refer to figure 29, section 4.2.4), also the putative
phosphorylation site at the N-terminal end and the DNA binding motif at the C-terminal end of
the proteins are very similar (figure 53). This led to the question if a genomic glnR deletion in
M. smegmatis could also be complemented by M. tuberculosis glnR and if purified
M. tuberculosis GlnR was able to bind M. smegmatis target genes.
Results 125
10 20 30 40 50 60....|....|....|....|....|....|....|....|....|....|....|....|
MSMEG_5784 -MDLLLLTVDPHPESVLPSLSLLAHTVRTAPTEVSSLLETGSADVAIVDARTDLAAARGL
Rv0818 MLELLLLTSELYPDPVLPALSLLPHTVRTAPAEASSLLEAGNADAVLVDARNDLSSGRGL
Clustal Consensus ::***** : :*:.***:****.*******:*.*****:*.**..:****.**::.***
70 80 90 100 110 120....|....|....|....|....|....|....|....|....|....|....|....|
MSMEG_5784 CRLLGTTGTSVPVVAVINEGGLVAVNHEWGLDEILLPSTGPAEIDARLRLLVGRRGGNAN
Rv0818 CRLLSSTGRSIPVLAVVSEGGLVAVSADWGLDEILLLSTGPAEIDARLRLVVGRRGDLAD
Clustal Consensus ****.:** *:**:**:.*******. :******** *************:*****. *:
130 140 150 160 170 180....|....|....|....|....|....|....|....|....|....|....|....|
MSMEG_5784 QENVGKITLGELVIDEGTYTARLRGKPLDLTYKEFELLKYLAQHAGRVFTRAQLLQEVWG
Rv0818 QESLGKVSLGELVIDEGTYTARLRGRPLDLTYKEFELLKYLAQHAGRVFTRAQLLHEVWG
Clustal Consensus **.:**::*****************:*****************************:****
190 200 210 220 230 240....|....|....|....|....|....|....|....|....|....|....|....|
MSMEG_5784 YDFFGGTRTVDVHVRRLRAKLGPEYEALIGTVRNVGYKAVRPSRGKPPAADASGEDVPDG
Rv0818 YDFFGGTRTVDVHVRRLRAKLGPEHEALIGTVRNVGYKAVRPARGRPPAADPDDEDADPG
Clustal Consensus ************************:*****************:**:*****...**. *
250 260....|....|....|....|..
MSMEG_5784 PDEGFGDDVDVDGPLAGRLTSQ
Rv0818 RD-------GMQEPLVDPLRSQ
Clustal Consensus * .:: **.. * **
Fig. 53: Sequence alignment of M. smegmatis (msmeg_5784) and M. tuberculosis (Rv0818) GlnR. The conserved putative phosphorylation site is highlighted blue, the conserved DNA binding motif dark blue. *: identical residues. :: similar amino acids. .: related amino acids.
First, growth and RNA hybridization experiments were performed to investigate the ability of
M. tuberculosis glnR to complement a genomic glnR deletion in M. smegmatis. The construct
pMN016glnR M. tub. was used for transformation of the glnR deletion strain MH1. Growth of
the resulting strain was tested in 7H9, 7H9-N and 7H9 medium with 200 mM MSX, a
glutamate analog that blocks GS activity (Berlicki, 2008). MH1 strains transformed with
pMN016control and pMN016glnR were carried along as controls. As it has already been
shown before (see figure 45, section 4.3.2), the glnR deletion strain transformed with the
empty vector was not able to grow under addition of MSX, whereas the strain carrying
pMN016glnR was, indicating a successful homologous complementation. However, figure
54A shows that a heterologous complementation of the genomic glnR deletion in
M. smegmatis with M. tuberculosis glnR was not successful, as this strain failed to grow
under the addition of MSX. Nevertheless, a slight increase of oD600 was detected after
approximately 28 hours, indicating that MSX might be inactivated faster as in the
pMN016control sample. On the basis of that, RNA hybridization experiments were
performed. First, a glnR probe was used to ensure that M. tuberculosis glnR transcripts were
obtained from plasmid pMN016. Whereas a strong signal for glnR was detected, transcripts
of amtB or glnA were not monitored leading to the conclusion that M. tuberculosis GlnR was
not able to activate nitrogen response in M. smegmatis (see figure 54B).
Results 126
B
t [h]
oD
600
t [h]
oD
60
0
t [h]t [h]
oD
600
oD
600
A
Fig. 54: Investigation of heterologous complementation of M. smegmatis glnR deletion with M. tuberculosis glnR in vector pMN016. A. Growth experiments with M. smegmatis MH1 transformed with empty vector pMN016control, pMN016glnR and pMN016glnR M. tub. in 7H9 (Δ), 7H9-N (x) and 7H9 medium with 200 mM MSX (▲). B. Total RNA of the three strains was used for RNA hybridization experiments with probes against glnR, amtB and glnA. Samples were taken under nitrogen surplus (+N) and directly (-N0), 15, 30 and 60 minutes after induction of nitrogen starvation.
These first experiments already indicated that a genomic glnR deletion in M. smegmatis
could not be complemented with M. tuberculosis glnR. In another approach, M. tuberculosis
GlnR was purified via affinity chromatography with an MBP-tag (refer to section 3.3.3.2 and
4.1.5) by cloning the corresponding gene into the vector pMal-c2. Purification of the 70.5 kDa
MBP-GlnR M. tub. fusion protein is documented in figure 55A. Figure 55B shows a gel
retardation experiment, which was performed using the 220 bp promoter fragment of amtB.
Rising amounts of MBP-GlnR and MBP-GlnR M. tub. were added, respectively.
Results 127
70 kDa
Purification protocol SDS PAGE
- MBP MBP-GlnR - MBP MBP-GlnR M. tub.
A
B
Fig. 55: Studies on M. tuberculosis GlnR. A. Purification of the 70.5 kDa MBP-GlnR M. tub. fusion protein, verified in SDS PAGE. B. Gel retardation experiments with digoxigenin-labeled 220 bp promoter fragment of amtB. Free DNA was used as negative control (-). 800 ng pure maltose binding protein were added as control (MBP). Rising amounts of MBP-GlnR from M. smegmatis (left) and MBP-GlnR M. tub. (right) were added. These were 50, 100, 200, 400 and 800 ng and 1, 1.5, 2, 3, 5, 10, 20 and 30 (only M. tub.) µg. A shift of DNA was visible with 400 ng M. smegmatis MBP-GlnR and 10 µg M. tuberculosis MBP-GlnR.
Whereas addition of 400 ng MBP-GlnR from M. smegmatis led to a shift of DNA, which was
even increased with higher amounts, binding of MBP-GlnR from M. tuberculosis was only
monitored at amounts higher than 10 µg, which was about 25 fold. This led to the conclusion
that M. tuberculosis GlnR was indeed able to bind M. smegmatis DNA, but only in high
excess of protein, which is contradictory to the almost identical DNA binding motif of the two
GlnR proteins (refer to figure 53).
Discussion 128
5 Discussion
5.1 GlnR as the global regulator of nitrogen metabolism in M. smegmatis
5.1.1 GlnR-dependent utilization of different nitrogen sources
The main objective of this study was to discover the mechanisms of nitrogen metabolism and
especially response to nitrogen starvation in M. smegmatis. To converge to this topic from a
general point, the ability of the bacterium to utilize different substrates as single nitrogen
source was tested. First hints of that were given by a bioinformatic analysis of various uptake
and assimilation systems (Amon et al., 2009). Indeed, Iwainsky and Sehrt (1967) monitored
growth of M. smegmatis with the amides urea, acetamide, nicotinamide and isonicotinamide
as well as the amino acids asparagine, glutamate and glutamine and the inorganic
substrates nitrate and nitrite. Addition of asparagine to other nitrogen sources even
increased growth. While these authors were the only ones to focus on growth behavior of
M. smegmatis, different other nitrogen sources were investigated incidentally in studies
focusing on mycobacteriophages (Gadagkar and Gopinathan, 1980) or on the identification
of mycobacterial drug targets to inhibit cell wall biosynthesis (Milligan et al., 2007).
In this study, it was shown that the M. smegmatis wild type strain SMR5 was able to utilize
the amino acids alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid,
glutamine, histidine, proline, serine, threonine and valine as well as the bases guanine and
uracil and the inorganic forms ammonium, ethanolamine, nitrate, nitrite and uric acid (see
section 4.1.1). Poor growth was detected in media with isoleucine, leucine, lysine,
methionine, tryptophan, tyrosine or methylamine. Cells did not grow when glycine,
phenylalanine, adenine, thymine, creatinine, glucosamine, N-acetylglucosamine or urea were
used as nitrogen sources. The glnR deletion strain MH1 showed no or extremely reduced
growth compared to the wild type in media with alanine, histidine, proline, serine, guanine,
uracil, ethanolamine, potassium nitrate, sodium nitrite and uric acid. Reduced growth was
also detected with aspartic acid, isoleucine, leucine, lysine and methionine, even though the
wild type showed only poor growth in these media (refer to section 4.1.1). Consequently,
M. smegmatis was no longer able to use these 15 substrates as single nitrogen source in the
absence of GlnR. Thus, the regulator must be involved in the expression of genes encoding
enzymes for uptake and/or assimilation of these substrates. Surprisingly, there was no
correlation between growth ability and initiation of nitrogen response (refer to figure 11,
section 4.1.2). Transcript of amtB was increased in media with phenylalanine, adenine,
thymine, N-acetylglucosamine, tyrosine, methylamine, arginine, glutamic acid, histidine,
Discussion 129
proline, threonine, ethanolamine, potassium nitrate and sodium nitrite, but not in media with
the remaining 21 substrates, independently from growth of M. smegmatis within these media.
Thus, the metabolites indicating the cells’ nitrogen status were not distinctly identified.
A closer look at the corresponding assimilation pathways suggests how the tested substrates
might be degraded in M. smegmatis and how GlnR might be involved in these processes. In
table 6 all growth analyses are summarized. Furthermore, the enzymes of the different
assimilation pathways are shown according to Kanehisa et al. (2010). The msmeg_ numbers
indicate genes encoding the corresponding enzymes in M. smegmatis if present, whereas
most of them are not experimentally verified.
Tab. 6: Summary of growth analyses. Displayed are the tested nitrogen sources, growth ability of the M. smegmatis wild type SMR5 and the glnR deletion strain MH1, induction of nitrogen response, the assimilating enzymes and the corresponding genes in M. smegmatis, as far as available, according to Kanehisa et al. (2010). Verified GlnR target genes (refer to section 4.2 and 5.1.2) are highlighted blue. Purple: enhanced transcript level under nitrogen starvation though no GlnR target (refer to table 10, section 7.2).
Nitrogen source
Growth SMR5
Growth MH1
Nitrogen response
Assimilation pathway Genes involved
Alanine
√
no
no
aminotransferase alanine dehydrogenase
msmeg_0688 (alaT) msmeg_2659 ald
Arginine
√
√
√
various NAD
+-GDH
msmeg_4699, msmeg_ 6272
Asparagine
√
√
no
asparagine synthase aspartate oxidase
msmeg_2594 (asnB),
msmeg_4269 msmeg_3200 (nadB)
Aspartic acid
√
poor
no
aspartate-ammonia lyase aspartate oxidase
msmeg_1677 (aspA) msmeg_3200 (nadB)
Cysteine
√
√
no
cystathionine-gamma-lyase
msmeg_2394
Glutamic acid
√
√
√
glutamate dehydrogenase NAD
+-GDH
msmeg_4699, msmeg_6272
Glutamine
√
√
no
glutaminase glutamate synthase NAD
+-GDH
msmeg_3818 msmeg_3225/3226 (gltBD),
msmeg_5594, msmeg_6458 msmeg_4699, msmeg_6272
Glycine
no
no
no
glycine/serine hydroxymethyltransferase serine dehydratase serine-ammonia lyase
msmeg_5249 (glyA)
msmeg_3183, msmeg_3532 msmeg_3440 (sdaA)
Histidine
√
no
√
histidine-ammonia lyase
msmeg_1183 (hutH)
Isoleucine
poor
no
no
aminotransferase
msmeg_4276 (ilvE)
Leucine
poor
no
no
aminotransferase
msmeg_4276 (ilvE)
Lysine
poor
no
no
aminotransferase
msmeg_4276 (ilvE)?
Methionine
poor
no
no
S-adenosylmethionine synthetase
msmeg_3055 (metK)?
Phenylalanine
no
no
√
various
not detected
Proline
√
no
√
various NAD
+-GDH
msmeg_4699, msmeg_6272
Serine
√
no
no
serine dehydratase serine-ammonia lyase
msmeg_3183, msmeg_3532 msmeg_3440 (sdaA)
Discussion 130
Threonine
√
√
√
threonine aldolase threonine dehydratase
msmeg_4454 (ltaE) msmeg_3183 (ilvA), msmeg_3532
Tryptophan
poor
poor
no
various
not detected
Tyrosine
poor
poor
√
various
not detected
Valine
√
√
no
aminotransferase
msmeg_4276 (ilvE)
Adenine
no
no
√
various
msmeg_1701, msmeg_2964, no nitrogen assimilation!
Guanine
√
no
no
guanine deaminase
msmeg_1298
Thymine
no
no
√
thymine phosphorylase msmeg_1675 (deoA),
no nitrogen assimilation!
Uracil
√
no
no
uracil phosphoribosyl transferase
msmeg_1694, msmeg_3042, msmeg_3473, no nitrogen assimilation?
Ammonium chloride
√
√
no
NADP+-GDH
glutamate synthase glutamine synthetase
msmeg_5442 msmeg_3225/3226 (gltBD), msmeg_5594, msmeg_6458 msmeg_4290 (glnA1)
Ammonium sulfate
√
√
no
NADP+-GDH
glutamate synthase glutamine synthetase
msmeg_5442 msmeg_3225/3226 (gltBD), msmeg_5594, msmeg_6458 msmeg_4290 (glnA1)
Creatinine
no
no
no
creatinine amidohydrolase
msmeg_1425, msmeg_6870?
Ethanolamine
√
no
√
ethanolamine-ammonium lyase
msmeg_1553/1554
Ferric ammonium citrate
√
√
no
NADP+-GDH
glutamate synthase glutamine synthetase
msmeg_5442 msmeg_3225/3226 (gltBD), msmeg_5594, msmeg_6458 msmeg_4290 (glnA1)
Glucosamine
no
no
no
various
not detected
Methylamine
poor
poor
√
various
not detected
N-acetyl glucosamine
no
no
√
PTS-system
msmeg_2116/2117?
Potassium nitrate
√
no
√
nitrate reductase nitrite reductase
msmeg_5140-5137 (narGHJI) msmeg_2837 (narB)?
msmeg_0427/0428 nirBD) Sodium nitrite
√
no
√
nitrite reductase ferredoxin-nitrite reductase
msmeg_0427/0428 nirBD) msmeg_4527
Urea
no
no
no
urease
msmeg_1093/1094, msmeg_3625/3626/3627
Uric acid
√
no
no
urate oxidase hydroxyisourate hydrolase allantoinase allantoicase urease
msmeg_1296 msmeg_1295 not detected msmeg_5727 (alc) msmeg_1093/1094, msmeg_3625/3626/3627
Formamide
not tested
not tested
not tested
formamidase
msmeg_0484, 3403 (amiF),
msmeg_4367, msmeg_5335
Discussion 131
Special attention was paid to urea and uric acid as single nitrogen sources. Uric acid or
urate, as a product of purine degradation, is assimilated by urate oxidase (msmeg_1296) and
5-hydroxyisourate hydrolase (msmeg_1295) to allantoine and in a following step by
allantoinase (not identified in M. smegmatis so far) to allantoate, which is further degraded by
allantoicase (msmeg_5727 alc) to urea. Urea is again degraded by urease (msmeg_1093,
msmeg_1094, msmeg_3625, msmeg_3626, msmeg_3627) to NH4+ and CO2. Surprisingly,
growth of M. smegmatis was detected in this study with uric acid, suggesting that a complete
degradation pathway must exist. Another surprising observation was that no growth was
obtained with urea as single nitrogen source, although a variety of degrading enzymes
(ureases) is present in M. smegmatis. Therefore, urease activity was determined (see
section 4.1.3). The tested M. smegmatis wild type strains SMR5 and DSM 43756 showed
similar urease activities of 1 µmol produced ammonium per minute per mg protein, which can
be compared to C. glutamicum, for which a urease activity of 0.9 µmol produced ammonium
per minute per mg protein was detected in complex medium (Nolden et al., 2000). Whereas
urease activity in C. glutamicum was enhanced to 7.8 µmol produced ammonium per minute
per mg protein under nitrogen starvation (Nolden et al., 2000), it was not increased in
M. smegmatis under the same conditions. This measurement and the fact that uric acid could
be used as nitrogen source indicated that a functional urea degrading system exists in
M. smegmatis. Thus, it remains unclear why the cells were not able to grow with urea as
single nitrogen source. A transport problem can also be excluded, as urea, especially as it
was used in a concentration of 100 mM in this study, passes the cell membrane by diffusion.
A possible explanation is that an intracellular shift of pH might have prevented the cells from
utilizing urea.
5.1.2 Characterization of the GlnR regulon
Total transcriptome analyses were carried out in search for different GlnR target genes.
Comparing mRNA levels of the M. smegmatis wild type SMR5 under nitrogen surplus and
starvation, 231 genes with decreased mRNA level under -N were found (see figure 20,
section 4.2.1 and table 9, section 7.2). This indicates that components which were not
necessary for survival under nitrogen limitation were reduced. Based on transcript levels it
was indicated that transport and metabolism of several lipids, carbohydrates, inorganic ions,
secondary metabolites, amino acids, coenzymes and nucleotides were decreased.
Furthermore, mRNA levels of genes associated with energy metabolism (acetyl-CoA
metabolism, as well as some ATPases) were extremely reduced. Decreased transcript levels
of many genes encoding ribosomal proteins and chaperones as well as sugar transport
Discussion 132
systems pointed to a reduction of growth to a minimum in order to survive nitrogen
starvation. Surprisingly, transcripts of genes encoding glutamate synthase (msmeg_6458),
ferredoxin-dependent glutamate synthase I (msmeg_6459) and a putative glutamine
transport system (msmeg_6307) were also reduced.
In contrast, 284 genes showed increased transcript levels under nitrogen starvation (see
figure 21, section 4.2.1 and table 10, section 7.2). Many of these genes were associated with
amino acid or inorganic ion transport and metabolism. These data indicated that uptake and
assimilation of alternative nitrogen sources was very important. Genes encoding amino acid
and ammonium transporters or permeases showed intensely high mRNA levels, as well as
genes encoding nitrogen assimilating enzymes such as amidases, dehydrogenases,
hydrolases, lyases and oxidoreductases. Furthermore, transcripts of various glutamine
synthetase, glutamate synthase and signal transduction genes were enhanced. As the
corresponding enzymes work under high energy demand, transcripts of some genes
encoding ATPases were again monitored. mRNA levels of genes encoding nitrate, nitrite and
urea uptake and assimilation systems were also intensely increased. Interestingly, a
comparison of table 10 (increased transcript level in the wild type under nitrogen starvation)
and table 12 (putative GlnR target genes, see section 7.2) revealed that some genes
involved in nitrogen metabolism showed apparently increased transcript levels under
nitrogen starvation in a GlnR-independent manner. These genes were e.g. msmeg_3561
(glutamine synthetase) and msmeg_5374 (glutamate-ammonia ligase).
Similar results of genes with enhanced mRNA levels under nitrogen (ammonium) limitation
were obtained for C. glutamicum in an earlier study performed by Silberbach et al. (2005a,
b). In that study, transcriptome analyses in response to ammonium starvation were carried
out. As in M. smegmatis, transcript levels of genes encoding enzymes involved in cell
division and growth as well as enzymes involved in biosynthesis of some amino acids were
decreased as a result of general starvation response. Genes with enhanced transcript levels
under nitrogen starvation encoded different transporters such as AmtA and AmtB, creatinine
permease, a urea uptake system and some amino acid transporters. Transcripts of genes for
metabolism of these alternative nitrogen sources were also increased. These were mainly
gltBD encoding GOGAT, glnA encoding GSI, creatinine deaminase and a urease operon. In
contrast to C. glutamicum, an enhanced mRNA concentration of glutamate synthase-
encoding genes was not observed in M. smegmatis. Moreover, genes for uptake and
complete assimilation of creatinine are not described in M. smegmatis. High amounts of
transcript of genes encoding signal transduction proteins GlnK and GlnD were found in both
organisms under nitrogen starvation. While the role of these proteins is well investigated in
C. glutamicum (see section 2.2.3), little is known about their function in M. smegmatis so far
(refer to section 5.3). Even some genes involved in energy production showed enhanced
Discussion 133
transcript levels due to the high energy demand of nitrogen-assimilating enzymes such as
GS. In C. glutamicum, genes encoding chaperones such as GroEL and GroES were also
found under nitrogen limitation. Due to this fact, Silberbach et al. (2005b) suggested a “trend
towards protein stabilization” under ammonium limitation. Interestingly, mRNA levels of
genes encoding these chaperones in M. smegmatis were reduced under nitrogen starvation
compared to nitrogen surplus (refer to table 9, section 7.2, this study).
Apart from that, most interesting for this study was the identification of GlnR target genes,
which were determined in a comparative transcriptome analysis of the M. smegmatis wild
type SMR5 and the glnR deletion strain MH1 under nitrogen starvation. Only two described
genes showed enhanced transcript levels in the absence of GlnR (see figure 22, section
4.2.1). These were msmeg_2274 (hypC encoding hydrogenase assembly chaperone HypC-
HupF) and msmeg_2275 (hypD encoding hydrogenase expression-formation protein HypD),
which are probably not involved in nitrogen metabolism.
In contrast to that, the amount of mRNA of 125 genes was decreased in the absence of GlnR
compared to the wild type (see figure 23, section 4.2.1). As more than 33 % of these genes
are putatively involved in nitrogen metabolism, the conclusion was drawn that these might be
target genes of GlnR. This demonstrated that M. smegmatis GlnR mainly works as
transcriptional activator, whereas different other transcriptional regulators work in a
bifunctional manner. NtrC, the global regulator of nitrogen metabolism in E. coli, regulates
transcription of glnA and ntrBC by activating or repressing gene expression from different
promoters (refer to section 2.2.2). On the contrary, AmtR in C. glutamicum functions
exclusively as repressor of its target genes under nitrogen surplus (see section 2.2.3).
Interestingly, a bifunctional manner is described for S. coelicolor GlnR. While it activates e.g.
glnA and nirB transcription under nitrogen starvation, gdh and ureA transcription are
repressed at the same time (Tiffert et al., 2008). For M. smegmatis GlnR a bifunctional mode
of action was not observed in experiments carried out in this study.
By performing further experiments such as RNA hybridization and real time RT PCR, 32
genes were indeed confirmed as GlnR-controlled (see figure 24 and 27, section 4.2.2).
Differences in transcript levels between nitrogen surplus and starvation varied significantly in
the individual experiments, which can be explained by considering the different experimental
procedures. In the microarray experiments cDNA was labeled with two different fluorescence
markers and bound to 60 bp oligonucleotides on a microarray chip, each representing one
gene or intergenic region in the M. smegmatis genome. The transcript of only one single
gene was monitored in one real time RT PCR sample, depending on a multitude of variables
such as primer design, reaction temperature, RNA purity, pipetting etc. Additionally, the
sample was normalized against a reference gene with comparable transcript levels under
changing nitrogen conditions. In this study, msmeg_3084 was chosen, encoding G3PDH.
Discussion 134
Further genes described as suitable references such as msmeg_4936 (atpD), msmeg_5489
(ribosomal protein L32), msmeg_5695 (glutathione-S-transferase) and msmeg_4931
encoding 16S rRNA (Mannhalter et al., 2000; Andersen et al., 2004; Cronin et al., 2004) did
not fulfill the criteria necessary for this study.
RNA hybridization experiments did not show quantitative results, but transcripts of the
M. smegmatis wild type and the glnR deletion strain under nitrogen surplus or starvation as a
function of time instead (see figure 24, section 4.2.2). As described in section 4.2.2,
maximum signals of different target genes were reached at different time points, from 15 to
60 minutes of nitrogen starvation. Due to different signal strengths and time it can be
assumed that not all GlnR target genes are transcribed in the same manner, which might
result from different promoter structures of the target genes leading to different binding
properties of the transcriptional activator GlnR (see also section 5.2). Binding of GlnR to 13
promoter fragments was verified in gel retardation experiments, whereas no binding was
detected for at least the same amount of genes, although GlnR-control was shown in
transcriptome analyses (see figure 28, section 4.2.3). This indicated that either the
corresponding promoter sequences were not correctly identified due to the unexplored state
of the genes or that these must be regulated by a yet unknown GlnR-dependent secondary
effect. Indirect regulation is described for vanABK encoding vanillate demethylase and
protokatechuate transporter by AmtR, the global regulator of nitrogen metabolism in
C. glutamicum (Merkens et al., 2005). Besides that, subordinated transcriptional regulators
might also be involved mediating gene transcription in M. smegmatis in association with
GlnR. This is the case e.g. for msmeg_2184-2187, for which additional regulation by AmtR
has been identified (see section 5.6 for a detailed description).
Organization of all GlnR target genes identified in this study, as well as the change of their
mRNA level due to presence or absence of GlnR, and binding of GlnR to the corresponding
promoter regions is summarized in figure 56.
Discussion 135
52x 49x ( 7x) ( 34x) 55x
A
0426 0427 0428 0429 0430 0431 0432 0433
nirB nirD narK3
no binding
B
( 35x) ( 33x) 48x ( 18x)
0569 0570 0571 0572
binding
C
( 10x) 35x ( 9x) ( 36x
0778 0779 0780 0781
binding
D
12x
1052 1054 1053
no binding
F
( 4x) 15x ( 7x) ( 9x)
1292 1293 1294 1295 1296
no binding
56x 52x 18x
H
2425 2426 2427
binding
amtB glnK glnD
24x ( 5x) ( 24x) ( 14x) 66x
I
2521 2522 2523 2524 2525 2526
binding
tynA
( 16x) ( 19x) ( 23x) 19x 136x
K
2978 2979 2980 2981 2982
binding
urtE urtD urtC urtB urtA
no binding
3400 3401 3402 3403
18x ( 19x) ( 8x) ( 9x)
L binding
34x 26x
M
4290 4291 4292 4293 4294
binding
glnA dtd glnE glnA2
binding
5x ( 3x)
N
binding not tested
4380 4381 4382
23x ( 32x) ( 18x) 30x
O
4635 4636 4637 4638
binding
amtA
no binding
( 6x) 45x
Q
5729 5730 5731 5732 5733 5734
no binding
12x 16x 10x ( 7x) ( 7x) ( 5x)
S
6259 6260 6261 6262 6263 6264
binding
amt1 glnT
T
11x
6660
binding
( 6x) 63x ( 19x)
U
6733 6734 6735
bindingno binding
6816 6817
33x ( 11x)
V no binding
( 48x) ( 54x) ( 6x) ( 10x) ( 19x) ( 4x) 5x
E
1082 1083 1084 1085 1086 1087 1088 1089 1090
no/unspecific binding no binding
gatA
48x ( 13x) ( 32x) ( 3x) ( 4x)
G
2184 2185 2186 2187 2188 2189
binding
atzF
J
6x
2748
unspecific/no binding
sthA
amiF
25x ( 21x) ( 22x)
P
5358 5359 5360
binding not testedcynS
R
30x
5765
no binding
glbN
Fig. 56: All GlnR target genes identified in this study. Genes are listed according to their msmeg_ numbers. Location as single genes or in operons in the genome is shown according to www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=246196. Arrow number x indicate fold change of transcript levels in the presence of GlnR according to microarray data, while ( ) represents data not verified in further experiments. Binding of GlnR protein to promoter sequences is shown in dark red, while light red ovals show predicted binding sites where no binding could be detected.
Discussion 136
Many genes involved in uptake and assimilation of various nitrogen sources were activated
by GlnR under nitrogen starvation. The most interesting GlnR targets, according to figure 56,
are described below.
GlnR controls nitrite reduction and transport systems (figure 56A), a flavoprotein involved in
K+ transport and a carbon-nitrogen family hydrolase (figure 56B), a putative transcriptional
regulator, short-chain dehydrogenase-reductase SDR, a phosphotransferase and an amino
acid permease (figure 56C). Additionally, an amino acid carrier protein depends on GlnR
(figure 56D). This is also the case for another putative response regulator, a peptide-opine-
nickel uptake family ABC transporter, dipeptide transport system permease DppB, an ABC
transporter permease, an oligopeptide ABC transporter, a glutamyl-tRNA(Gln)-aspartyl-
tRNA(Asn) amidotransferase and an amidase (figure 56E). Moreover, a FAD binding domain
in molybdopterin dehydrogenase was identified, as well as a xanthine-uracil permease,
transthyretin and a uricase (figure 56F). Very interesting targets were an amino acid
permease, two conserved hypothetical proteins and a urea amidolyase (figure 56G), which
were further controlled by transcriptional regulator AmtR (see section 5.6). Also an
allophanate hydrolase was spotted (figure 56G).
The best investigated GlnR target is the operon msmeg_2425-2427 (amtB-glnK-glnD)
encoding ammonium transporter, PII regulatory protein and uridylyltransferase (figure 56H;
see also Amon et al., 2008).
Further GlnR-controlled were different ABC transporters and permeases, another amino acid
permease and copper methylamine oxidase TynA (figure 56I). This was also monitored for
soluble pyridine nucleotide transhydrogenase SthA (figure 56J). Different further ABC
transporters as well as a periplasmic binding protein involved in urea uptake are part of the
GlnR regulon (figure 56K). This is also the case for glutamyl-tRNA(Gln) amidotransferase
subunit A, a LamB-YcsF-family protein, a cytosine permease and formamidase AmiF (figure
56L).
Additionally, two glutamine synthetases type I were identified (figure 56M; see also Amon et
al., 2008). Another amidase and a dehydrogenase-reductase SDR family protein were
spotted (figure 56N), as well as ammonium transporter AmtA and a vanillate O-demethylase
oxidoreductase (figure 56O). Moreover, a formate-nitrate transporter, cyanate hydratase
CynS and an acetamidase-formamidase family protein were found (figure 56P). GlnR also
controls a permease for cytosine-purines, uracil, thiamine and allantoine as well as a
hydantion racemase (figure 56Q). This was also observed for the globin GlbN (figure 56R)
and ammonium transporter Amt1, a glutamine synthetase type III, a glutamine
amidotransferase class II, a FwdC-FmdC-family protein, a glutamate synthase family protein
and a putative oxidoreductase (figure 56S). Moreover, another permease for cytosine-
Discussion 137
purines, uracil, thiamine, and allantoine was found (figure 56T). Additionally, another amino
acid permease, dibenzothiophene desulfurization enzyme A and a carbon-nitrogen family
hydrolase were identified (figure 56U), as well as a molybdopterin oxidoreductase and RNA
polymerase sigma factor, sigma-70 family (figure 56V).
During this study, it became obvious that GlnR is the global regulator of nitrogen metabolism
in M. smegmatis and that many genes involved in transport of amino acids, peptides and
inorganic nitrogen sources as well as nitrogen assimilating enzymes such as amidases,
amidotransferases and glutamine synthetases are GlnR-controlled.
Surprisingly, also genes not directly associated with nitrogen assimilation were identified as
GlnR targets. One example is msmeg_5765 (glbN) encoding a truncated globin (refer to
figure 56R). This globin has become very interesting for recent research, as it is able to bind
oxygen and is thus involved in “defense against NO toxicity and nitrosative stress” in
mycobacteria (Lama et al., 2006). Involvement of GlnR in these processes has not been
reported so far. Another interesting putative target gene, although not yet further
experimentally verified, is msmeg_6817 encoding a sigma factor, sigma-70 family protein
(figure 56V). Sigma 70 is described as standard sigma factor responsible for transcription of
housekeeping genes. A variety of different genes encoding sigma factors exists in
M. smegmatis, including sigA, sigB, sigD, sigE, sigF, sigG, sigH, sigJ and others (Manganelli
et al., 2004). While extensive research on sigma factors in mycobacteria has been practiced
(Gomez et al., 1998; Manganelli et al., 2004; Mukherjee and Chatterji, 2005), they were not
associated with GlnR so far. Considering these data, it can be assumed that the regulatory
function of GlnR might not be restricted to nitrogen metabolism. This has also been
suggested in a similar study on S. coelicolor GlnR (Tiffert et al., 2011), where also genes
involved in carbon metabolism, stress response and antibiotic biosynthesis were found to be
GlnR-controlled confirming the regulatory function of GlnR beyond nitrogen metabolism.
Discussion 138
5.2 GlnR as OmpR-type transcriptional regulator
According to sequence homologies, M. smegmatis GlnR is associated with the OmpR-family
of transcriptional regulators (Amon et al., 2008). The OmpR/EnvZ-system in E. coli is
thoroughly investigated and regulates specific response to changing osmolarity conditions.
Key elements for that are the two outer membrane porins OmpC and OmpF. While OmpF,
possessing a larger pore and a higher flow rate than OmpC, is mainly present at low
osmolarity, the level of OmpC porin dominates at high osmolarity (Huang et al., 1997). The
expression of the corresponding genes ompC and ompF is regulated by the transcriptional
regulator OmpR depending on osmolarity.
OmpR itself is part of a two-component system including EnvZ, its corresponding sensor
histidine kinase. EnvZ is located at the inner membrane and autophosphorylated at histidine
243 residue depending on changing osmolarity (Mattison et al., 2002). Subsequently, it is
able to (de)phosphorylate OmpR at aspartate 55 residue. Mattison et al. (2002) give an
overview on the extensive studies that were carried out on structure and function of OmpR:
with a size of 27 kDa, this regulatory protein consists of an N-terminal phosphorylation
domain including aspartate 55 and a C-terminal DNA binding domain carrying a
characteristic winged helix-turn-helix DNA binding motif. The two domains are connected by
a 15 amino acid flexible linker. Two additional aspartate 11 and 12 residues as well as lysine
105 and other important conserved amino acids are required to stabilize phosphorylation.
The protein attaches to binding sites upstream of its two target genes. Each of these sites,
namely F1, F2, F3, F4, C1, C2 and C3, consists of two 10 bp tandem subunits, an “a site”, to
which the protein has a lower affinity, and a “b site”, to which the affinity is higher (Yoshida et
al., 2006). At low osmolarity, few phosphorylated OmpR molecules bind cooperatively to F1,
F2 and F3 and thus activate ompF transcription, whereas only C1 is bound and ompC is not
expressed. However, high osmolarity leads to a higher amount of OmpR-P in the cells. Now
the protein can also bind C2 and C3, resulting in expression of ompC. Furthermore, OmpR-P
also occupies F4, supporting the formation of a DNA loop upstream of ompF, which can no
longer be transcribed (Yoshida et al., 2006). The authors suggest a hierarchic model of DNA
binding in a “discontinuous, galloping manner” (see figure 57), i.e. that OmpR-P first binds
with high affinity to F1b or C1b, respectively. Phosphorylation is responsible for protein-
protein interaction and therefore for recruiting new OmpR-P molecules to the F1a or C1a
site, and subsequently to the other F or C sites. Only OmpR dimers are able to accomplish
stable DNA binding.
Discussion 139
Fig. 57: Model of activation and functionality of E. coli transcriptional regulator OmpR. A. Activation by phosphorylation via sensor histidine kinase EnvZ. Phosphorylation leads to dimer formation. Only dimers are able to completely bind DNA. B. “Galloping” system of recruiting new OmpR-P molecules to its binding sites, leading to activation or repression of ompF and ompC expression. Adapted from Yoshida et al. (2006).
In the sequence of M. smegmatis GlnR, an N-terminal phosphorylation domain carrying
highly conserved aspartate residues and a C-terminal DNA binding domain were identified
(see figure 44, section 4.3.2 and Amon et al., 2008). Binding of GlnR to corresponding
promoter fragments of its target genes was proven in this study, indicating that additional
activation of the regulator such as phosphorylation might not be necessary for binding (see
figure 28, section 4.2.3). Moreover, the shift of the DNA became more intense with
increasing amounts of used purified GlnR (see figure 19, section 4.1.7). This might be a first
indication of a “galloping” DNA binding of GlnR. The varying expression strengths and times
of GlnR target genes also support the idea that GlnR binds with distinctive affinity to their
promoter regions (refer to figure 24, section 4.2.2), which might be a result of deviating
binding sites. This phenomenon is also well investigated in C. glutamicum, where binding
strength of the global nitrogen regulator AmtR to its target DNA depends on variations of the
consensus DNA sequence (Jakoby et al., 2000; Beckers et al., 2005; Hasselt et al., 2010).
According to sequence analyses, a consensus sequence for DNA binding of M. smegmatis
GlnR has also been identified (see figure 29, section 4.2.4 and Amon et al., 2009),
suggesting putative “a” and “b” binding sites following the OmpR-model described above.
Indeed, gel retardation experiments performed in this study revealed the existence of more
than one GlnR binding sites in the promoter region of amtB (refer to figure 30 and 31, section
Discussion 140
amtB glnA
GlnR GlnR
4.2.4). These are located 75-100 bp (1), 100-150 bp (2), 50-75 bp (3, putatively) and
150-200 bp (4) upstream of the gene’s start codon, supporting the “galloping” model for
GlnR. These data were confirmed in electrophoretic mobility shift assays, where at least two
distinct shifts of amtB and glnA promoter fragments were spotted (figure 58), leading to the
conclusion that initially a first binding site is attached by GlnR resulting in a low shift of DNA.
When this site is completely occupied, addition of higher amounts of GlnR leads to protein-
protein interaction and recruitment of new GlnR molecules to the DNA. Thus, the second
binding site is occupied, which can be seen in the experiment as a second, higher shift.
Fig. 58: Electrophoretic mobility shift assay (EMSA). A 220 bp amtB promoter fragment and a 250 bp glnA promoter fragment were incubated with rising amounts of GlnR (0, 0.1, 0.5, 1, 2, 4, 6 and 8 µg Strep-GlnR).
DNAse protection assays are required to characterize these binding sites in detail. These are
in progress in cooperation with Y. Lu, Chinese Academy of Sciences, Shanghai, People’s
Republic of China, and J. Milse, Center of Biotechnology, Bielefeld.
Although three aspartic acid residues have been identified as phosphorylation sites of
M. smegmatis GlnR, phosphorylation of the regulator could not be proven in this study (see
figure 41, 42 and 43, section 4.3.1.4). Exchange of one of the three aspartic acids led to loss
of GlnR function. The glnR* variants showed high amounts of transcripts in M. smegmatis
and E. coli. Furthermore, purification of intact GlnR* variants with a functional DNA binding
domain was possible in E. coli. These observations suggested rather a problem of protein
stability than phosphorylation in M. smegmatis (refer to section 4.3.2). Moreover, the search
for a corresponding, GlnR phosphorylating sensor histidine kinase was difficult, as its
encoding gene is not situated close to glnR in the genome, which is usually the case for
bacterial two-component systems such as NtrB/NtrC (genes located in operon glnAntrBC,
refer to section 2.2.2) and OmpR/EnvZ (genes located in operon ompRenvZ, see above) in
E. coli.
A closer look on the genomic region surrounding glnR provides no indication of a sensor
kinase encoding gene. Upstream of msmeg_5784 (glnR), msmeg_5785 encodes a
Discussion 141
( 4.1x)
5779 5780 5781 5782 5783 5784 5785 5786
pstB pstA pstC pstS glnR
hypothetical protein and msmeg_5786 thiredoxin (figure 59). Further upstream, various
hypothetical proteins are encoded. Downstream of glnR, several genes involved in
phosphate transport and metabolism are located (msmeg_5782-5779, see figure 59).
Directly downstream of glnR, the gene msmeg_5783 is located, encoding a GNAT-family
acetyltransferase (figure 59). Interestingly, a decreased mRNA level of this gene by a factor
of 4.1 was detected in a glnR deletion strain compared to the wild type under nitrogen
starvation (refer to table 12, section 7.2), suggesting that it might be GlnR-controlled in some
way. As msmeg_5783 did not appear in transcriptome analyses comparing total transcript of
the M. smegmatis wild type under nitrogen surplus and starvation, it is assumed that its
expression does not depend on nitrogen availability. The two genes msmeg_5784 (glnR) and
msmeg_5783 are putatively organized as operon, although glnR transcripts could not be
experimentally verified in this study.
Fig. 59: Genomic organization of the GlnR encoding region in M. smegmatis. The gene msmeg_5783, encoding an acetyltransferase showed an enhanced transcript level in the presence of GlnR.
Several sensor hisidine kinases identified in sequence or transcriptome analyses were
tested, but none of those was able to phosphorylate GlnR in vitro (refer to section 4.3.1.4).
Furthermore, a deletion or disruption of the corresponding genes did not result in loss of
GlnR function (see section 4.3.1.2). Investigation of other sensor histidine kinases (refer to
table 14, section 7.3 and Amon, 2010) is in progress.
All results obtained in this study led to the conclusion that the OmpR-model might be correct
for DNA binding manners of M. smegmatis GlnR, but not necessarily for activation of the
transcriptional regulator. Various two-component systems were identified as OmpR-family
members (see table 7 and Egger et al., 1997; Itou and Tanaka, 2001). For all of these
systems, activation of the transcriptional regulator is exclusively described as mediated by a
corresponding sensor histidine kinase via phosphorylation. Aspartic acid residues as
phosphorylation sites are highly conserved, as well as further amino acids stabilizing the
phosphorylation (Itou and Tanaka, 2001). The authors suggest a “conservative variety”
among the OmpR-family members, as large homologies of N-terminal receiver and
C-terminal DNA binding domains exist, but also differences in the remaining sequence and
thus protein structure and interaction with RNA polymerase.
Discussion 142
Tab. 7: OmpR/EnvZ two-component system family members. Response regulator and corresponding sensor histidine kinase are shown, as well as the adaptive system, effector genes and signal as far as available. Partly adapted from Egger et al. (1997), expanded according to Itou and Tanaka (2001) and Ansaldi et al. (2004).
Adaptive system Signal Sensor (kinase) Response regulator Effector(s)
Osmolarity changes ? EnvZ OmpR ompC, ompF
Multiple systems ? CpxA CpxR traJ, degP, etc.
Phosphate regulation phosphate PhoR PhoB phoA, phoE, pst
Stress situations ? PhoQ PhoP psiG,H,I,J,L,O
? ? BaeS BaeR ?
? ? BasS BasR ?
Catabolite repression ? CreC CreB pho regulon
Potassium transport K+, turgor KdpD KdpE kdpA,B,C,F
Respiratory control ? ArcB ArcA aceF, pps, cyoA-E
Chemotaxis chemotaxins CheA CheB, CheY flagellar motor
Nitrogen fixation ? FixL FixJ fix, nif
? Mg2+
RstB RstA ?
Anaerobic respiration TMAO TorS TorR torCAC
In summary, it can be concluded that every transcriptional regulator so far identified as a
member of the OmpR-family is controlled via phosphorylation by its corresponding sensor
histidine kinase and that, in the case of M. smegmatis GlnR, the correct kinase has not yet
been found. Consequently, conditions of further experiments might be varied to show GlnR
phosphorylation in vitro.
5.3 Activation of nitrogen response
It has been clearly demonstrated in this study that nitrogen response in M. smegmatis
depends on OmpR-type regulator GlnR. This is performed either by direct binding of the
regulator to promoter sequences of its target genes or by a so far unknown, indirect
mechanism (section 4.2.1, 4.2.2 and 4.2.3; see figure 56, section 5.1.2 for overview). In a gel
retardation experiment with GlnR protein purified via His-tag from M. smegmatis SMR5,
grown under nitrogen surplus and starvation, the high affinity of the regulator to its target
DNA was demonstrated (see figure 32, section 4.2.4). Furthermore, as binding of GlnR was
independent from the nitrogen status of the cells, the assumption that nitrogen starvation
induces binding of GlnR to its target DNA was disproved, at least in vitro.
These observations led to the conclusion that gene transcription by RNA polymerase in vivo
in M. smegmatis is not only activated due to binding of GlnR to the promoter sequence, but
rather due to involvement of a so far unknown cofactor or OmpR-like phosphorylation and
Discussion 143
dimerization of the regulator. Thus, the identification of the signal inducing GlnR binding and
gene transcription in the cells is a major objective of current research. It was detected in this
study, that the glnR transcript level is not autoregulated and also not enhanced due to
nitrogen limitation (see figure 33, section 4.2.5). In consequence, it is still assumed that GlnR
is activated by phosphorylation, which, however, could not be proven in this study (refer to
figure 41, 42 and 43, section 4.3.1.4 and section 5.2).
Moreover, the indicator signalizing nitrogen starvation to the cells and thus activating putative
sensor histidine kinase still needs to be identified. In E. coli, the best investigated model
organism for nitrogen metabolism, the ratio of intracellular concentrations of glutamine and
2-oxoglutarate indicates nitrogen availability and determines (de)uridylylation of signal
transduction protein PII, which is then responsible for (de)activation of nitrogen response via
NtrB and NtrC (refer to section 2.2.2). Furthermore, a model for detection of extracellular
ammonium concentrations by ammonium transporter AmtB exists (Javelle et al., 2004).
Indication of nitrogen response in the actinomycete C. glutamicum is much discussed. While
growth of the organism with glutamine and glutamate as single nitrogen source resulted in
activation of nitrogen response, this was not monitored in the presence of ammonium (Rehm,
2010). It was supposed that glutamine and glutamate do not indicate the cells’ nitrogen
status, as their intracellular concentrations did not vary under the tested experimental
conditions (Rehm, 2010; Rehm et al., 2010). It is rather assumed that in C. glutamium the
intracellular concentration of 2-oxoglutarate is responsible for indication of nitrogen limitation,
whereas binding of the molecule to the PII signal transduction protein GlnK still needs to be
investigated (Müller et al., 2006; Rehm et al., 2010). Next to 2-oxoglutarate, the intracellular
ammonium concentration is supposed to be the positive indicator of nitrogen status of the
cells (Nolden et al., 2001b; Müller et al., 2006; Rehm et al., 2010).
Evidence for putative indicators of the nitrogen status of M. smegmatis was given in
experiments performed in this study. While nitrogen response was induced when glutamate
was used as single nitrogen source, this was not observed in the presence of glutamine or
ammonium (see figure 11, section 4.1.2). Furthermore, glutamate-dependent nitrogen
response was completely suppressed after 5-10 minutes when glutamine or ammonium was
added, respectively (see figure 12, section 4.1.2). This led to the conclusion that glutamate is
probably not the indicator of nitrogen status in M. smegmatis, as nitrogen response was
induced under high concentrations of this product of GS/GOGAT-pathway (see figure 60).
On the contrary, the intracellular and/or extracellular ammonium concentration might function
as a nitrogen indicator, as its effect was superior to that of glutamate. The same conclusion
was drawn concerning glutamine as nitrogen indicator.
Discussion 144
NH3
glutamine glutamate
ATPADP + Pi + H2O
glutamate
GOGAT
NH3/NH4+
glutamate
2-oxogutarate
GS
GOGAT
GDH
NADPH + H +
NADP +
NADP+ + H2O NADPH + H+
NH4+
NH4+
Moreover, nitrogen response was detected in the presence of phenylalanine, adenine,
thymine, N-acetylglucosamine, tyrosine, methylamine, arginine, histidine, proline, threonine,
ethanolamine, nitrate and nitrite (figure 11, section 4.1.2), but there is no information about
the function of these substances as indicators of nitrogen metabolism in M. smegmatis.
Fig. 60: Occurrence of ammonium, glutamate and glutamine in central nitrogen metabolism. Ammonium is assimilated under nitrogen surplus by glutamate dehydrogenase (GDH) and under nitrogen limitation by glutamine synthetase (GS) and glutamate synthase (GOGAT). Figure modeled after Merrick and Edwards (1995) and Leigh and Dodsworth (2007); see also section 2.2.1.
Searching for indication of nitrogen response and activation of the global nitrogen regulator
GlnR, genes encoding several signal transduction proteins have been identified in
M. smegmatis (Amon et al., 2009). The glnE gene encoding adenylyltransferase GlnE,
known to be responsible for (de)activation of GSI via (de)adenylylation (see section 2.2.1), is
located in the genome between the GSI encoding genes glnA and glnA2 (see figure 56,
section 5.1.2 for overview). This is a situation similar to M. tuberculosis, a related
mycobacterium, in which GlnE function has already been intensely investigated. glnE was
described as an essential gene for M. tuberculosis, as it could not be deleted without another
functional copy in the cell (Parish and Stoker, 2000). Additionally, upregulation of glnE was
detected depending on the presence of ammonium or glutamine in the medium (Pashley et
al., 2006). The authors also detected co-transcription of glnA2 and glnE. In further studies,
the essential role of GlnE was attributed to the adenylylation domain, indicating that GlnE
indeed controls fine regulation of GSI activity in M. tuberculosis in response to varying
nitrogen conditions (Carroll et al., 2008). Interestingly, GlnE is not essential in other
actinomycetes such as S. coelicolor (Fink et al., 1999) leading to the conclusion that GlnE is
important for M. tuberculosis to maintain a balance of glutamate and glutamine levels, as
these are essential for survival of the organism in the host as major components of the cell
wall (Pashley et al., 2006).
Discussion 145
Up to now, no studies have been performed on M. smegmatis GlnE. As the organism is
closely related to M. tuberculosis, but considered non- or facultative pathogenic, it would be
interesting to investigate the putative necessity of GlnE in M. smegmatis. A (de)adenylylating
and thus GSI-controlling function of M. smegmatis GlnE is expected, as this is widely
conserved among bacteria (Fink et al., 1999; Nolden et al., 2001a; Ninfa and Jiang, 2005;
Carroll et al., 2008; see Amon et al., 2010 for overview).
Next to glnE, the genes glnK and glnD, encoding PII and uridylyl/adenylyltransferase were
also identified in M. smegmatis (Amon et al., 2009). The situation of these genes in the
operon amtB-glnK-glnD was monitored and co-transcription of these genes was proven
(Bräu, 2008). While the glnK and glnD mRNA levels were increased in the wild type under
nitrogen starvation by factors of 31.84 and 16.95, respectively, they were decreased in the
glnR deletion strain by factors of 52.56 and 18.22 (table 10 and 12, section 7.2, this study).
It is known that GlnD and PII mediate nitrogen response in E. coli via (de)uridylylation (Ninfa
and Atkinson, 2000; Javelle et al., 2004) and in C. glutamicum via (de)adenylylation
(Strösser et al., 2004; Beckers et al., 2005). (De)adenylylation of PII by GlnD is also
described for S. coelicolor (Hesketh et al., 2002), but further signal transduction by modified
PII protein could not be proven yet (Reuther and Wohlleben, 2007). Even less information is
provided concerning M. tuberculosis. In this organism, no evidence for a central role of GlnD
in nitrogen regulation has been found, although the authors monitored a slight effect of a
glnD deletion on GS activity (Read et al., 2007). For M. smegmatis, no data are published
about the role of GlnK and GlnD in signal transduction. First investigations of a glnK and a
glnD deletion strain revealed no differences in growth or transcript levels of GlnR and AmtR
target genes compared to the wild type under nitrogen surplus and starvation. Furthermore,
interaction studies with purified GlnK and GlnD proteins did not show any result (W. Zhou,
personal communication). Increased GS activity was measured in the wild type under
nitrogen starvation, which was reduced after addition of ammonium. Interestingly, the
increase of activity was slightly lower in the glnD deletion strain and clearly reduced in the
glnK deletion strain (W. Zhou, personal communication). Thus, an influence of at least GlnK
on (de)activation of adenylyltransferase GlnE, which controls GSI activity, is suggested. It
can be concluded that GlnK and GlnD are not essential for activation of nitrogen response in
M. smegmatis, but that they are probably involved in fine regulation of GSI via GlnE. GlnK-
GlnE interaction studies are in progress as well as the generation of a glnE deletion strain
(W. Zhou, personal communication). Finally it can be stated that the nitrogen regulatory
system in M. smegmatis differs significantly from the NtrB/NtrC-system described in E. coli.
Changing nitrogen conditions are probably sensed by the so far unknown sensor histidine
kinase that is predicted to activate GlnR under nitrogen limitation by phosphorylation.
Discussion 146
5.4 Ammonium assimilation in M. smegmatis
Concerning nitrogen metabolism, synthesis and processing of glutamine and glutamate plays
a very important role. While glutamine provides nitrogen for the synthesis of e.g. purines,
pyrimidines and some amino acids, glutamate is the main nitrogen donor for 85 % of nitrogen
containing cell compounds (Harper et al., 2010).
As described earlier in this study (see section 2.2.1), ammonium assimilation is mediated
under nitrogen surplus by NADPH-dependent aminating GDH resulting in L-glutamate. This
enzyme works with low ammonium affinity and under low energy demand. It is encoded in
M. smegmatis by msmeg_5442 (gdhA), which was first identified by Sarada et al. (1980).
It was shown in this study that gdhA transcript was altered neither in response to nitrogen
starvation nor the presence or absence of GlnR (refer to figure 25, section 4.2.2 and table 9-
12, section 7.2). These data correlated with the recent observation that aminating GDH
activity did not change in response to varying ammonium supply or nitrogen limitation
(Harper et al., 2010). Thus, it can be concluded that gdhA is not subject to nitrogen control in
M. smegmatis, a phenomenon which is different in the related actinomycete C. glutamicum.
There, the transcript level of gdh is regulated by AmtR, the global regulator of nitrogen
metabolism in this species (Beckers et al., 2005; Hänßler et al., 2009).
In addition to gdhA, the genes msmeg_4699 and msmeg_6272 encoding NAD+-dependent
deaminating GDH enzymes were identified in M. smegmatis (O’Hare et al., 2008; Harper et
al., 2010). These enzymes are described as involved in glutamine/glutamate catabolism, but
only very low and ammonium- or nitrogen-independent deaminating GDH activity was
detected (Harper et al., 2010). Surprisingly, further NAD+-dependent aminating activity was
monitored. As a consequence, the authors suggested an unusual aminating role for at least
one of the NAD+-dependent GDH enzymes, which has not been described before.
Furthermore, it was suspected that at least one of the corresponding genes is regulated
depending on nitrogen availability. Indeed, an enhanced transcript level of msmeg_4699 was
observed after two hours of nitrogen starvation (Harper et al., 2010). On the contrary,
changes in transcript levels of msmeg_4699 and msmeg_6272 were detected neither due to
nitrogen limitation nor due to presence or absence of GlnR in transcriptome analyses
performed in this study (see table 9-12, section 7.2).
Under low ammonium concentrations, the GS/GOGAT-pathway is used because of the low
ammonium affinity of GDH (refer to section 2.2.1). First, ammonium is assimilated via
glutamine synthetase GS to glutamine in an ATP-consuming way. Various genes encoding
different types of glutamine synthetases were identified in M. smegmatis (table 8).
Discussion 147
Tab. 8: List of all putative GS encoding genes in M. smegmatis. Gene name, occurrence in M. smegmatis and M. tuberculosis, predicted function and references or homologs are given as far as available. According to Amon et al. (2009) and www.ncbi.nlm.nih.gov/sites/entrez?db=genome&cmd= Retrieve&dopt=Protein%20Table&list_uids=20087. * indicates glnA homologs of M. smegmatis that are missing in other mycobacterial genomes.
Function, GS type Gene name M. smegmatis M. tuberculosis Reference/nearest homologs
Unknown glnA* msmeg_1116 n/a -
Unknown glnA4 msmeg_2595 Rv2860c Harth et al., 2005
Unknown glnA3 msmeg_3561 Rv1878 Harth et al., 2005
Unknown glnA* msmeg_3827 n/a E. coli K12 putative GS
Unknown glnA* msmeg_3828 n/a -
NH4+ assimilation, GSI glnA1 msmeg_4290 Rv2220 Harth et al., 2005
Unknown, GSI glnA2 msmeg_4294 Rv2222c Harth et al., 2005
Unknown glnA* msmeg_5374 n/a Rhodopseudomonas palustris glnA
Unknown, GSII/III ? glnT, glxA msmeg_6260 n/a -
Unknown, GSII/III ? glnA* msmeg_6693 n/a Agrobacterium tumefaciens glnA
According to Merrick and Edwards (1995), four different types of glutamine synthetases exist
in bacteria: the universal form GSI consists of 12 identical 55 kDa subunits and is encoded
by glnA. GSI of most bacterial species is posttranslationally modified by adenylyltransferase
GlnE, with the exception of Bacillus and Clostridium strains. GSII is composed of eight
identical 36 kDa subunits. Its encoding gene, glnII, has been identified in Agrobacterium,
Rhizobium and Streptomyces strains. A eukaryotic origin of this GS type is suspected. GSIII
contains six 75 kDa subunits and has been found in Bacteroides, Butyrivibrio and
Synechocystis species. The fourth GS form is named GlnT and consists of eight 47 kDa
subunits. It has been identified in some Rhizobium strains. The GS encoding genes in
M. smegmatis cannot easily be allocated to the different groups.
Best investigated in mycobacteria is GSI, encoded by glnA. Especially glutamine
synthetases I of M. bovis and M. tuberculosis are very interesting targets of research, as they
are probably involved in virulence and pathogenicity of these organisms (Tullius et al., 2003;
Harth et al., 2005; Chandra et al., 2010). The authors believe that GSI is necessary for the
synthesis of a poly-L-glutamate-glutamine layer at the cell wall of these pathogens.
Interestingly, this specific layer is absent in saprophytic or non-pathogenic mycobacteria
(Chandra et al., 2010). Indeed, different tested GS inhibitors blocked the formation of the
poly-L-glutamate-glutamine layer, but no evidence for a direct involvement of GSI has been
shown so far (Harth et al., 2000; Odell et al., 2009).
Four glnA genes exist in M. tuberculosis: glnA1 which encodes the pathogenicity-associated
GSI, and glnA2-4 which show strong sequence similarity to glnA1. All of the corresponding
proteins showed GS activity and were inhibited by MSX (Harth et al., 2005). GlnA1, 3 and 4
Discussion 148
catalyze the synthesis of L-glutamine, while GlnA2 catalyzes the synthesis of D-glutamine
and isoglutamine. Furthermore, it is assumed that GlnA1 is essential for growth and
pathogenicity of M. tuberculosis, while GlnA2-4 are described as glutamine synthetases of
subordinate function (Harth et al., 2005).
Homologs of glnA1-4 were also identified in M. smegmatis (see table 8). As in
M. tuberculosis, glnA1 (msmeg_4290) encodes the main GSI protein. An enhanced transcript
level of glnA1 due to nitrogen limitation was reported (see Amon et al., 2008; this study,
figure 24 and 27, section 4.2.2 and table 10, section 7.2). Moreover, Harper et al. (2010)
revealed that less glnA1 transcript was present compared to M. tuberculosis. The authors
monitored glnA1 transcript level and GSI activity in response to changing nitrogen supply. It
was found that GSI activity started increasing after 30 minutes of nitrogen starvation, which
was at its maximum after four hours. When an ammonium pulse was given, GSI activity was
rapidly decreased. The transcript level of glnA1 was also increased after 30 minutes of
nitrogen starvation (as reported in this study) and highest after two hours. Interestingly, a
decrease of transcript after an ammonium pulse was barely detected leading to the
conclusion that a rapid response of glutamine synthetase activity to changing nitrogen
conditions is mediated by posttranslational modification of GSI by GlnE, rather than by gene
expression (Harper et al., 2010). This phenomenon was demonstrated for several related
actinomycetes before, and first hints for M. smegmatis were found (refer to section 5.3).
No data about M. smegmatis glnA2-4 are published so far. In this study, enhanced mRNA
levels of msmeg_4294 (glnA2, 3.75 fold) and msmeg_3561 (glnA3, 3.04 fold) were detected
in the wild type under nitrogen starvation (see figure 24 and 27, section 4.2.2 and table 10,
section 7.2). Furthermore, it was proven that glnA1 and glnA2 are controlled by GlnR, the
main regulator of nitrogen metabolism in M. smegmatis. The transcript of glnA1 was reduced
34.13 fold in a glnR deletion strain compared to the wild type under nitrogen starvation, the
transcript of glnA2 26.01 fold (figure 24 and 27, section 4.2.2 and table 12, section 7.2). It
was also shown that GlnR binds directly upstream of these two genes (see figure 28, section
4.2.3).
Additionally, several glnA-like genes were identified in M. smegmatis which do not appear in
related species such as M. tuberculosis (see table 8). The genes msmeg_1116 and
msmeg_3828 are described as glnA4 homologs with less homology than msmeg_2595,
while msmeg_3827 showed closest relation to an E. coli glutamine synthetase. The gene
msmeg_5374 is related to glnA of Rhodopseudomonas palustris, and msmeg_6693 to
Agrobacterium tumefaciens glnA (Amon et al., 2009). Interestingly, in transcriptome analyses
performed in this study, transcript of msmeg_5374 was increased by a factor of 4.66 in the
M. smegmatis wild type under nitrogen starvation (refer to table 10, section 7.2). The gene
Discussion 149
msmeg_6260 is described as glnT encoding GSII (www.ncbi.nlm.nih.gov/sites/entrez
?db=genome&cmd=Retrieve&dopt=Protein%20Table &list_uids=20087) and also as glxA
encoding GSIII as part of a glx operon which is of Pseudomonas origin (Amon et al., 2009).
However, a 30.44 fold increased mRNA level of this gene was detected in the wild type
under nitrogen starvation and a 16.11 fold decreased mRNA level in the absence of GlnR
(table 10 and 12, section 7.2).
Summarizing recent insights, it can be said that M. smegmatis possesses at least 10 genes
that encode glutamine synthetases typical for various, not even closely related bacterial
species. The results of this study suggest that GS activity is not restricted to one of these
genes. Especially under nitrogen starvation genes encoding several glutamine synthetases
(msmeg_4290, msmeg_4294, msmeg_ 3561, msmeg_5374 and msmeg_6260) are activated
and the corresponding enzymes are probably used to maintain a glutamine level sufficient for
survival.
In the GS/GOGAT-system glutamine is assimilated together with 2-oxoglutarate to two
molecules glutamate by glutamate synthase GOGAT. The encoding genes for this enzyme
are msmeg_6458/6459 (gltBD), showing closest relation to C. glutamicum glutamate
synthase (Amon et al., 2009). The authors also identified further genes that resemble gltB
(msmeg_5594 and msmeg_6263) and gltD (msmeg_6262). Interestingly, transcriptome
analyses of this study revealed decreased transcript levels of msmeg_6458/6459 by a factor
of 3.23/4.53 in response to nitrogen starvation (table 9, section 7.2). On the contrary, the
transcripts of msmeg_6262 and msmeg_6263 were enhanced under nitrogen starvation by
factors of 7.6 and 10.48 (table 10, section 7.2). Furthermore, the amounts of their mRNA
were decreased in the absence of GlnR by a factor of 7.4 and 7.01, respectively (table 12,
section 7.2). Thus it can be concluded that nitrogen- and GlnR-dependent GOGAT activity is
proceeded from msmeg_6262 and msmeg_6263, which are located in the operon
msmeg_6259-6264 (see figure 56, section 5.1.2) and described as glxC and glxD (Amon et
al., 2009).
5.5 Nitrate and nitrite metabolism in M. smegmatis
A variety of different studies on assimilation and catabolism of nitrate and nitrite in bacteria
can be found, whereas concerning mycobacteria, such studies have only recently begun.
The first step of nitrate assimilation is the reduction to nitrite by nitrate reductase encoded by
narGHJI. NarJ assembles the subunits NarG, NarH and NarI to the functional nitrate
reductase (Malm et al., 2009). The corresponding genes msmeg_5140-5137 were identified
Discussion 150
52x 49x ( 7x) ( 34x) 55x
A
0426 0427 0428 0429 0430 0431 0432 0433
nirB nirD narK3
no binding
B
2107 2106 2108
C
hypothetical proteins and tRNAs 2837 2838
narB
D
5137 5138 5139 5140 5141 5142 5143
no binding
narI narJ narH narG narK degA
in M. smegmatis (Amon et al., 2009). In a second step, nitrite is reduced to ammonium by
nitrite reductase. This sirohaem-dependent enzyme is present in a variety of bacteria and
fungi (Malm et al., 2009) and is encoded in M. smegmatis by msmeg_0427/0428 (nirBD).
Additionally, nitrate/nitrite transporters (msmeg_5141 narK and msmeg_0433 narK3) were
identified, as well as another putative assimilatory nitrate reductase (msmeg_2837 narB). All
genes putatively involved in nitrate and nitrite metabolism that were investigated in this study
are shown in figure 61.
Fig. 61: Genomic situation of genes putatively involved in nitrate and nitrite metabolism in M. smegmatis. According to http://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=246196. Arrow number x indicates fold change of transcript levels in the presence of GlnR according to transcriptome analyses, while ( ) represents data not verified in further experiments. Light red ovals show predicted binding sites where no binding could be detected.
Nitrogen- and GlnR-dependent increase of nirBD and narK3 transcript levels was monitored
in this study, whereas this was not shown for narK or the narGHJI orperon (see section 4.2.1
and 4.2.2 and figure 61 for overview). In addition to that, a glnR deletion strain was not able
to grow with nitrate or nitrite as single nitrogen source (refer to section 4.1.1). Interestingly,
nitrogen response was activated in the wild type with nitrate or nitrite as single nitrogen
source (figure 11, section 4.1.2). Binding of GlnR to promoter fragments of nirBD or the nar
operon was not detected (see figure 28, section 4.2.3 and figure 61 for overview). These
data correlated with earlier observations made in M. tuberculosis, where an influence of GlnR
to nirBD expression was also reported (Malm et al., 2009). The authors proved furthermore
that narG was essential for growth of M. tuberculosis on nitrate and that nirB was essential
Discussion 151
for growth on both, nitrate and nitrite, pointing to an assimilatory function of these enzymes.
In contrast, disruption of narG in M. smegmatis did not lead to a significant change of growth
or gene transcript levels compared to the wild type (see figure 51 and 52, section 4.4),
leading to the conclusion that this gene is not essential for survival of M. smegmatis with
nitrate as single nitrogen source and that its malfunction may be complemented by another
nitrate reduction system. Within the time frame of this study, it was not possible to generate a
nirB mutant in M. smegmatis.
The mRNA level of narB, which encodes another putative nitrate reductase, was not
regulated due to nitrogen availability in M. smegmatis. Thus, it can be concluded that it fulfills
a different task than in the related actinomycete S. coelicolor, where the transcript level of the
narB homolog nasA was reported to be GlnR-controlled (Wang and Zhao, 2009). The
authors demonstrated the importance of nasA for growth of the organism in nitrate-containing
medium and moreover, specific binding of GlnR to a cis-element in the promoter region of
the gene. Experiments performed in this study with an M. smegmatis strain lacking a
functional copy of narB did not reveal differences in growth or gene transcript levels with
nitrate or nitrite compared to the wild type (see figure 51 and 52, section 4.4).
In addition to GlnR, the involvement of three transcriptional regulators in expression of nirBD
or narGHJI was investigated. These were msmeg_0426, encoding a GntR-family regulator
located directly upstream of nirBD, msmeg_2106, encoding a TetR-type regulatory protein
which is associated with nirBD, and msmeg_5143, encoding HTH-type transcriptional
regulator DegA, a putative regulator of the nar operon (for overview see also figure 61).
Contrary to expectations, these regulatory proteins seem not to be involved in nitrate or
nitrite metabolism in M. smegmatis (see figure 51 and 52, section 4.4). All results pointed
towards a mediation of uptake and assimilation of nitrate and nitrite in M. smegmatis by
nitrate/nitrite transporters NarK and NarK3, nitrate reductase NarGHJI and nitrite reductase
NirBD, whereas NarK3 and NirBD are activated by GlnR.
Assimilatory or dissimilatory function of NirBD and NarGHJI has been intensely discussed.
First, nitrate and nitrite metabolism was investigated in the pathogenic species M. bovis and
M. tuberculosis, focusing on the pathogenicity aspect. Although mycobacteria are considered
obligate aerobes, in particular the pathogenic ones must be able to adapt to limiting oxygen
conditions in granulomas or abscesses that are formed due to infection (Weber et al., 2000).
In this environment, M. tuberculosis switches to a state of persistence, in which it is not
replicating and increases several enzyme activities such as nitrate reductase activity
(Sohaskey and Modesti, 2008). Thus, NarGHJI and NirBD were classified as respiratory
enzymes, even in the non-pathogenic species M. smegmatis (Khan and Sarkar, 2006).
Discussion 152
On the contrary, Malm et al. (2009) stated that NarGHJI mediates nitrate reduction under
both aerobic and anaerobic conditions. Only in E. coli and related enterobacteria NirBD
would have no assimilatory function. By investigating nirB and narG deletion mutants of
M. tuberculosis, the assimilatory function of the corresponding enzymes was proven (Malm
et al., 2009). Thus, it can be concluded that nitrate reductase NarGHJI and nitrite reductase
NirBD fulfill both, assimilatory and respiratory functions in mycobacteria, depending on the
environmental conditions.
Interestingly, M. smegmatis is able to survive anaerobic conditions in a dormancy state
similar to its pathogenic relatives (Khan and Sarkar, 2006). This was first investigated by
Dick et al. (1998). Although the organism died when suddenly exposed to oxygen limitation, it
was able to adapt to slowly decreasing oxygen concentrations by entering a persistent state.
In this state, the bacteria did not synthesize DNA or replicate. They were even resistant
against different antimycobacterial drugs. Effective growth of M. smegmatis under anaerobic
conditions has not been reported so far.
A variety of further genes putatively involved in nitrate and nitrite metabolism were identified
in M. smegmatis (according to www.ncbi.nlm.nih.gov/sites/entrez?db=genome&cmd=
Retrieve&dopt=Protein%20Table&list_uids=20087). These are nitrate/sulfonate/bicarbonate
ABC transporters (msmeg_0551, msmeg_1160, msmeg_2501, msmeg_4586, msmeg_4588,
msmeg_6494, msmeg_6495 and msmeg_6496), nitrate/sulfonate ABC transporter
(msmeg_2099), nitrate transporter NrtD (msmeg_2102), a formate/nitrate transporter
(msmeg_5360), a nitrate/nitrite response regulator protein (msmeg_2251) and a ferredoxin-
sulfit/nitrit-reductase also described as ammonia:ferredoxin oxidoreductase (msmeg_4527).
Only formate/nitrate transporter (msmeg_5360) was identified in transcriptome analyses
performed in this study as a putative GlnR target (see table 12, section 7.2 and figure 56,
section 5.1.2 for overview). Msmeg_2099 and msmeg_2102 were also tested as they are
located close to the putative TetR-type transcriptional regulator encoding gene
msmeg_2106, but nitrogen- or GlnR-dependent changes of their transcript levels were not
detected (data not shown).
5.6 Role of AmtR in M. smegmatis
Within the order Actinomycetales two major regulatory proteins of nitrogen metabolism exist,
namely GlnR and AmtR. While AmtR mediates nitrogen-dependent gene expression in
corynebacteria, the majority of the actinomycetes uses GlnR as global nitrogen regulator.
Interestingly, M. smegmatis is part of a small group of actinomycetes that possesses genes
encoding both of these regulatory proteins. Further species are C. michiganensis, N. farcinia
Discussion 153
4x 2x
48x ( 13x) ( 32x) ( 3x)
2184 2185 2186 2187 2188
AmtRGlnR
+ -
amino acid hyp. hyp. urea integral membrane
permease amidolyase protein
or S. avermitilis (refer to figure 5, section 2.2.3 and Amon, 2010). It is experimentally proven
that GlnR is the global regulator of nitrogen metabolism in M. smegmatis (see Amon et al.,
2008 and section 5.1, this study).
Following this study, total transcriptome analysis of an amtR deletion strain compared to the
wild type was carried out, in which two putative AmtR target genes were identified. These
were msmeg_2187 encoding urea amidolyase and msmeg_2188 encoding an integral
membrane protein (see also table 13, section 7.2). An AmtR-dependent change of transcripts
of the operon msmeg_2184-2188, as well as binding of purified AmtR protein to a promoter
sequence upstream of msmeg_2184 was indeed verified in further experiments.
Furthermore, negative autoregulation of amtR and binding of AmtR to a promoter fragment of
msmeg_4301, a gene which is co-transcribed with amtR, were detected (Y. Lu, Chinese
Academy of Sciences, Shanghai, People’s Republic of China, personal communication). A
decreased mRNA level of msmeg_4301 in the wild type under nitrogen starvation was also
monitored in transcriptome analyses carried out in this study (4.37 fold, refer to table 9,
section 7.2). A similar pattern was monitored by Y. Lu in the related actinomycete
S. avermitilis.
Interestingly, the genes msmeg_2184-2188 are also described as GlnR targets in
M. smegmatis (refer to table 12, section 7.2 and section 5.1.2), suggesting a dual regulation
by GlnR and AmtR (see figure 62). Studies on a glnR amtR double deletion strain revealed
GlnR as the superior regulator (Y. Lu, personal communication).
Fig. 62: Model for dual regulation of the operon msmeg_2184-2187 by GlnR and AmtR. While transcript levels are enhanced by GlnR under nitrogen starvation (red arrows), they are decreased by AmtR under nitrogen surplus (orange arrows). Numbers indicate fold change of mRNA levels obtained from transcriptome analyses.
It is supposed that AmtR is bound to its corresponding target sequence and thus represses
expression of the operon under nitrogen surplus. Meanwhile, GlnR is not able to activate
transcription due to its own non-activated (non-phosphorylated) state. When nitrogen
becomes limited, AmtR is released, whereas at the same time activated GlnR binds to its
corresponding DNA sequence and induces gene expression by RNA polymerase. So far, no
Discussion 154
data are available about (de)activation of AmtR. In C. glutamicum, AmtR binding is released
after protein-protein interaction with adenylylated PII protein GlnK, a process which is
mediated by adenylyltransferase GlnD (see section 2.2.3 for overview). Until now, interaction
of AmtR, GlnK and GlnD has not been analyzed in M. smegmatis.
The subordinate function of AmtR in M. smegmatis was also shown in growth experiments
performed similar to those described in section 4.1.1. Here, an amtR deletion strain showed
no differences in growth compared to the wild type when various substances were tested as
single nitrogen source, in which the absence of GlnR led to reduced or no growth (data not
shown). Considering these results, it can be concluded that AmtR in M. smegmatis is not
important for general nitrogen response. Thus, the function of GlnR as global nitrogen
regulator is once more confirmed.
5.7 Nitrogen response in M. smegmatis as a possible model for M. tuberculosis
The aim of this study was to investigate the mechanisms of nitrogen response in
M. smegmatis, while the main focus was set on the global nitrogen regulatory protein GlnR.
M. smegmatis is able to utilize a variety of different organic and inorganic nitrogen sources,
while some of them induce nitrogen response (see section 5.1.1). Various transport and
assimilation systems for amino acids and inorganic nitrogen sources were identified.
Investigating indication and sensing of nitrogen limitation was more difficult. It is believed that
the extracellular nitrogen concentration is mediated by a yet unknown indicator, probably
ammonium, and sensed by a membrane-bound sensor histidine kinase (see section 5.3 and
5.2). The kinase is predicted to activate nitrogen response by phoshorylating GlnR. Although
phosphorylation of GlnR has not yet been proven, typical aspartic acid residues were
identified as phosphorylation sites (see section 5.2). Furthermore, the corresponding sensor
histidine kinase has not yet been found (section 5.2). Nevertheless, GlnR has a positive
influence on transcript levels of at least 32 target genes under nitrogen starvation. These
genes are involved in uptake and assimilation of ammonium, nitrate, nitrite, amino acids,
peptides and others. Different amidases, aminotransferases, hydrolases, as well as signal
transduction proteins are controlled by GlnR (see section 5.1.2 for overview). Moreover,
involvement of transcriptional regulator AmtR in changing the transcript level of the operon
msmeg_2184-2188 was proven (see section 5.6), whereas interaction of signal transduction
proteins GlnK and GlnD with either GlnR or AmtR has not yet been shown (see section 5.3).
Ammonium assimilation is mediated via GDH or the GS/GOGAT-system. While influence of
GlnR on glnA transcript was proven, this was not shown for gdhA or gltBD (see section
Discussion 155
NH3/NH4+ supply
NH3
GlnK
GlnD
NH3
glutamine glutamate
ATPADP + Pi + H2O
glutamate
GOGAT
NH3/NH4+
glutamate
2-oxogutarate
GS
GOGAT
GDH
Nitrogen sources
Amino acids, nitrate,
nitrite, ethanolamine, uric
acid, guanine, uracil…
Ammonium assimilation
Signal transduction
Sensing
Sensor hisitidine
kinase
Transport
systems
Assimilation
Ammonium
transporter
Phosphorylation
GlnR
Gene expression
>32 target genes:
glnA, amtB…
AmtR
Gene expression
indicators?
GlnE
?
?
?
?
?
??
regulation
5.1.2). Further regulation of GSI activity by adenylyltransferase GlnE has not yet been
investigated in M. smegmatis. Figure 63 gives an overview about the current model of
nitrogen sensing and assimilation in M. smegmatis.
Fig. 63: Model of nitrogen assimilation and response in M. smegmatis according to results obtained in this study (refer to text).
Beyond this model, other enzymes also seem to be involved in nitrogen/ammonium
assimilation in M. smegmatis. These are further ammonium transporters amtA and amt1,
further glnA genes encoding GSI enzymes, a type III GS, two additional GDH enzymes and
others (refer to section 5.4).
A highly conserved mode of action of GlnR among the actinomycetes was suggested by
Tiffert et al. (2008). In that study, binding of S. coelicolor GlnR to glnA promoter fragments of
different actinomycetes was observed. Additionally, a glnR deletion in S. coelicolor was
complemented by A. mediterranei glnR (Yu et al., 2006; Tiffert et al., 2008). After
investigating the relation of M. tuberculosis and M. smegmatis GlnR in this study, it was
obvious that these two proteins cannot be replaced by each other. First experiments
indicated that a genomic glnR deletion in M. smegmatis could not be complemented with
M. tuberculosis glnR (refer to figure 54, section 4.5). Furthermore, binding of purified
M. tuberculosis GlnR to M. smegmatis target genes was detected, but only under very high
Discussion 156
protein surplus (figure 55, section 4.5). This result was not expected based on earlier studies
of the amino acid sequence of the two proteins, which was shown to be almost identical
(refer to figure 53, section 4.5 and Amon et al., 2008). Nevertheless, a conserved function of
GlnR as global regulator of nitrogen response in actinomycetes is obvious.
Interestingly, in a recent study dual regulation such as GlnR-AmtR-regulation of the operon
msmeg_2184-2188 in M. smegmatis was also predicted for some genes of nitrogen
metabolism in M. tuberculosis. In silico analyses revealed the existence of a putative
C. glutamicum AmtR-related protein encoded by Rv3160c, which might influence expression
of ureABCG, glnA1, glnD, glnB and further genes (Krawczyk et al., 2009). However, no
experimental data are available so far to support this thesis.
Considering recent insights it can be concluded that the model of nitrogen control in
M. smegmatis resulting from observations made in this study can indeed be used as a
pattern for similar investigations in M. tuberculosis, provided that differences between the
saprophyte M. smegmatis and the human pathogen M. tuberculosis are considered.
References 157
6 References
Abe, S., Takayama, K. & Kinoshita, S. (1967). Taxonomical studies on glutamic acid producing bacteria. J. Gen. Microbiol. 13, 279-301.
Ahmad, S., Bhatnagar, R. K. & Venkitasubramanian, T. A. (1986). Changes in the enzyme activities involved in nitrogen assimilation in Mycobacterium smegmatis under various growth conditions. Annales de l'Institut Pasteur. Microbiol. 137, 231-237.
Amon, J., Bräu, T., Grimrath, A., Hasselt, K., Hänßler, E., Höller, M., Jeßberger, N., Ott, L., Szököl, J., Titgemeyer, F. & Burkovski, A. (2008). Nitrogen control in Mycobacterium smegmatis: nitrogen-dependent expression of ammonium transport and assimilation proteins depends on OmpR-type regulator GlnR. J. Bacteriol. 21, 7108-7116.
Amon, J., Titgemeyer, F. & Burkovski, A. (2009). A genomic view on nitrogen metabolism and nitrogen control in mycobacteria. J. Mol. Microbiol. Biotechnol. 17, 20-29.
Amon, J. (2010). Mining the genomes of actinomycetes: identification of metabolic pathways and regulatory networks. PhD thesis, Friedrich-Alexander University Erlangen-Nuremberg.
Amon, J., Titgemeyer, F. & Burkovski, A. (2010). Common patterns - unique features: nitrogen metabolism and regulation in Gram-positive bacteria. FEMS Microbiol. Rev. 34, 588-605.
Andersen, C. L., Jensen, J. L. & Ørntoft, T. F. (2004). Normalization of real-time quantitative reverse transcription-PCR data: a model-based variance estimation approach to identify genes suited for normalization, applied to bladder and colon cancer data sets. Cancer Res. 64, 5245-5250.
Ansaldi, M., Théraulaz, L. & Méjean, V. (2004). TorI, a response regulator inhibitor of phage origin in Escherichia coli. Proc. Natl. Acad. Sci. USA 101, 9423-9428.
Aronson, J. D. (1926). Spontaneous tuberculosis in salt water fish. J. Infect. Dis. 39, 314-320.
Barksdale, L. & Kim, K. S. (1977). Mycobacterium. Bacteriol. Rev. 41, 217-372.
Barry III, C. E., Lee, R. E., Mdluli, K., Sampson, A. E., Schroeder, B. G., Slayden, R. A. & Yuan, Y. (1998). Mycolic acids: structure, biosynthesis and physiological functions. Prog. Lipid Res. 37, 143-179.
References 158
Beckers, G., Nolden, L. & Burkovski, A. (2001). Glutamate synthase of Corynebacterium glutamicum is not essential for glutamate synthesis and is regulated by the nitrogen status. Microbiology 147, 2961-2970.
Beckers, G., Bendt, A. K., Krämer, R. & Burkovski, A. (2004). Molecular identification of the urea uptake system and transcriptional analysis of urea transporter- and urease-encoding genes in Corynebacterium glutamicum. J. Bacteriol. 186, 7645-7652.
Beckers, G., Stösser, J., Hildebrandt, U., Kalinowski, J., Farwick, M., Krämer, R. & Burkovski, A. (2005). Regulation of AmtR-controlled gene expression in Corynebacterium glutamicum: mechanism and characterization of the AmtR regulon. Mol. Microbiol. 58, 580-595.
Belitsky, B. R. & Sonenshein, A. L. (1998). Role and regulation of Bacillus subtilis glutamate dehydrogenase genes. J. Bacteriol. 180, 6298-6305.
Bendt, A. K., Beckers, G., Silberbach, M., Wittmann, A. & Burkovski, A. (2004). Utilization of creatinine as an alternative nitrogen source in Corynebacterium glutamicum. Arch. Microbiol. 181, 443-450.
Bérdy, J. (2005). Bioactive microbial metabolites. J. Antibiot. 58, 1-26.
Bergey, D. H., Harrison, F. C., Breed, R. S., Hammer, B. W. & Huntoon, F. M. (1923). Bergey's Manual of Determinative Bacteriology, 1st edition, The Williams & Wilkins Co, Baltimore, 1-442.
Berlicki, L. (2008). Inhibitors of glutamine synthetase and their potential application in medicine. Mini Rev. Med. Chem. 8, 869-878.
Bouché, S., Klauck, E., Fischer, D., Lucassen, M., Jung, K. & Hengge-Aronis, R. (1998). Regulation of RssB-dependent proteolysis in Escherichia coli: a role for acetyl phosphate in a response regulator-controlled process. Mol. Microbiol. 27, 787-795.
Bradford, M. M. (1976). A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding. Anal. Biochem. 72, 248-254.
Bräu, T. (2008). Transkriptionskontrolle in Mycobakterien. Diploma thesis, Friedrich-Alexander University Erlangen-Nuremberg.
References 159
Burkovski, A. (2003). Ammonium assimilation and nitrogen control in Corynebacterium glutamicum and its relatives: an example for new regulatory mechanisms in actinomycetes. FEMS Microbiol. Rev. 27, 617-628.
Burkovski, A. (2005). Nitrogen metabolism and its regulation. In: Bott, M. & Eggeling, L. (eds.) Handbook of Corynebacterium glutamicum. CRC Press LLC, Boca Raton, FL, 333-349.
Burkovski, A. (2007). Nitrogen control in Corynebacterium glutamicum: proteins, mechanisms, signals. J. Microbiol. Biotechnol. 17, 187-194.
Carroll, P., Pashley, C. A. & Parish, T. (2008). Functional analysis of GlnE, an essential adenylyl transferase in Mycobacterium tuberculosis. J. Bacteriol. 190, 4894-4902.
Castets, M., Rist, N. & Boisvert, H. (1969). La variété africaine du bacille tuberculeux humain. Médecine d'Afrique Noire. 16, 321-322.
Chamnongpol, S. & Groisman, E. A. (2000). Acetyl phosphate-dependent activation of a mutant PhoP response regulator that functions independently of its cognate sensor kinase. J. Mol. Biol. 300, 291-305.
Chandra, H., Basir, S. F., Gupta, M. & Banerjee, N. (2010). Glutamine synthetase encoded by glnA-1 is necessary for cell wall resistance and pathogenicity of Mycobacterium bovis. Microbiology 156, 3669-3677.
Chaoui, I., Sabouni, R., Kourout, M., Jordaan, A. M., Lahlou, O., Elouad, R., Akrim, M., Victor, T. C. & El Mzibri, M. (2009). Analysis of isoniazid, streptomycin and ethambutol resistance in Mycobacterium tuberculosis isolates from Morocco. J. Infect. Dev. Ctries. 3, 278-284.
Chater, K. F. (2001). Regulation of sporulation in Streptomyces coelicolor A3(2): a checkpoint multiplex? Curr. Opinion Microbiol. 4, 667-673.
Chung, C. T., Niemela, S. L. & Miller, R. H. (1989). One-step preparation of competent Escherichia coli: transformation and storage of bacterial cells in the same solution. Proc. Natl. Acad. Sci. USA 86, 2172-2175.
Coyle, M. B. & Lipsky, B. A. (1990). Coryneform bacteria in infectious diseases: clinical and laboratory aspects. Clin. Microbiol. Rev. 3, 227-246.
References 160
Cronin, M., Ghosh, K., Sistare, F., Quackenbush, J., Vilker, V. & O’Connell, C. (2004). Universal RNA reference materials for gene expression. Clin. Chem. 50, 1464-1471.
da Costa Cruz, J. (1938). Mycobacterium fortuitum um novo bacilo acido-resistente patogenico para o homen. Acta Med. (Rio de Janeiro) 1, 298-301.
Dick, T., Lee, B. H. & Murugasu-Oei, B. (1998). Oxygen depletion induced dormancy in Mycobacterium smegmatis. FEMS Microbiol. Lett. 163, 159-164.
Dye, C., Scheele, S., Dolin, P., Pathania, V. & Raviglione, M. C. (1999). Consensus statement. Global burden of tuberculosis: estimated incidence, prevalence, and mortality by country. WHO global surveillance and monitoring project. JAMA 282, 677-686.
Egger, L. A., Park, H. & Inouye, M. (1997). Signal transduction via the histidyl-aspartyl phosphorelay. Genes Cells 2, 167-184.
Embley, T. M. & Stackebrandt, E. (1994). The molecular phylogeny and systematics of the actinomycetes. Annu. Rev. Microbiol. 48, 257-289.
Engbaek, H. C., Larsen, S. O., Rasmussen, K. N., & Vergmann, B. (1973). Initial treatment of tuberculosis with streptomycin and isoniazid combined with either aminosalyl or rifampicin. Scand. J. Respir. Dis. 54, 83-91.
Engleman, E. G. & Francis, S. H. (1978). Cascade control of E. coli glutamine synthetase: II. Metabolite regulation of the enzymes in the cascade. Arch. Biochem. Biophys. 191, 602-612.
Faller, M., Niederweis, M. & Schulz, G. E. (2004). The structure of a mycobacterial outer-membrane channel. Science 303, 1189-1192.
Fink, D., Falke, D., Wohlleben, W. & Engels, A. (1999). Nitrogen metabolism in Streptomyces coelicolor A3(2): modification of glutamine synthetase I by an adenylyltransferase. Microbiology 145, 2313-2322.
Fink, D., Weisschuh, N., Reuther, J., Wohlleben, W. & Engels, A. (2002). Two transcriptional regulators GlnR and GlnRII are involved in regulation of nitrogen metabolism in Streptomyces coelicolor A3(2). Mol. Microbiol. 46, 331-347.
Flannagan, R. S., Cosío, G. & Grinstein, S. (2009). Antimicrobial mechanisms of phagocytes and bacterial evasion strategies. Nat. Rev. Microbiol. 7, 355-366.
References 161
Forchhammer, K. (2008). P(II) signal transducers: novel functional and structural insights. Trends Microbiol. 16, 65-72.
Gadagkar, R. & Gopinathan, K. P. (1980). Growth of Mycobacterium smegmatis in minimal and complete media. J. Biosci. 2, 337-348.
Gebhard, S., Tran, S. L. & Cook, G. M. (2006). The Phn system of Mycobacterium smegmatis: a second high-affinity ABC-transporter for phosphate. Microbiology 152, 3453-3465.
Gebhard, S. & Cook, G. M. (2008). Differential regulation of high-affinity phosphate transport systems of Mycobacterium smegmatis: identification of PhnF, a repressor of the phnDCE operon. J. Bacteriol. 190, 1335-1343.
Glover, R. T., Kriakov, J., Garforth, S. J., Baughn, A. D. & Jacobs, W. R. (2007). The two-component regulatory system senX3-regX3 regulates phosphate-dependent gene expression in Mycobacterium smegmatis. J. Bacteriol. 189, 5495-5503.
Gomez, M., Doukhan, L., Nair, G. & Smith, I. (1998). sigA is an essential gene in Mycobacterium smegmatis. Mol. Microbiol. 29, 617-628.
Goux, W. J., Strong, A. D. A., Schneider, B. L., Lee, W. N. P. & Reitzer, L. J. (1995). Utilization of aspartate as a nitrogen source for Escherichia coli. J. Biol. Chem. 270, 638-646.
Grant, S. G. N., Jessee, J., Bloom, F. R. & Hanahan, D. (1990). Differential plasmid rescue from transgenic mouse DNAs into Escherichia coli methylation-restriction mutants. Proc. Natl. Acad. Sci. USA 87, 4645-4649.
Grooters, A. M., Couto, C. G., Andrews, J. M., Johnson, S. E., Kowalski, J. J. & Esplin, R. B. (1995). Systemic Mycobacterium smegmatis infection in a dog. J. Am. Vet. Med. Assoc. 206, 200-202.
Guan, C., Li, P., Riggs, P. D. & Inouye, H. (1987). Vectors that facilitate the expression and purification of foreign peptides in Escherichia coli by fusion to maltose-binding protein. Gene 67, 21-30.
Hadfield, T. L., McEvoy, P., Polotsky, Y., Tzinserling, V. A. & Yakovlev, A. A. (2000). The pathology of diphtheria. J. Infect. Dis. 181, 116-120.
References 162
Hänßler, E. & Burkovski, A. (2008). Molecular mechanisms of nitrogen control in corynebacteria. In: Burkovski, A. (ed.) Corynebacteria: genomics and molecular biology. Caister Academic Press, Norfolk, UK, 183-201.
Hänßler, E., Müller, T., Palumbo, K., Patek, M., Brocker, M., Krämer, R. & Burkovski, A. (2009). A game with many players: control of gdh transcription in Corynebacterium glutamicum. J. Biotechnol. 142, 114-122.
Harper, C. J., Hayward, D., Kidd, M., Wiid, I. & van Helden, P. (2010). Glutamate dehydrogenase and glutamine synthetase are regulated in response to nitrogen availability in Myocbacterium smegmatis. BMC Microbiol. 10, 138.
Harth, G., Clemens, D. L. & Horwitz, M. A. (1994). Glutamine synthetase of Mycobacterium tuberculosis: extracellular release and characterization of its enzymatic activity. Proc. Natl. Acad. Sci. USA 91, 9342-9346.
Harth, G., Zamecnik, P. C., Tang, J. Y., Tabatadze, D. & Horwitz, M. A. (2000). Treatment of Mycobacterium tuberculosis with antisense oligonucleotides to glutamine synthetase mRNA inhibits glutamine synthetase activity, formation of the poly-L-glutamate/glutamine cell wall structure, and bacterial replication. Proc. Natl. Acad. Sci. USA 97, 418-423.
Harth, G., Maslesa-Galic, S., Tullius, M. V. & Horwitz, A. A. (2005). All four Mycobacterium tuberculosis glnA genes encode glutamine synthetase activities but only GlnA1 is abundantly expressed and essential for bacterial homeostasis. Mol. Microbiol. 58, 1157-1172.
Hartmans, S., De Bont, J. A. M. & Stackebrandt, E. (2006). The Genus Mycobacterium-nonmedical. The Prokaryotes 3, 889-918.
Hasselt, K., Rankl, S., Worsch, S. & Burkovski, A. (2010). Adaptation of AmtR-controlled gene expression by modulation of AmtR binding activity in Corynebacterium glutamicum. J. Biotechnol. doi:10.1016/j.jbiotec.201009.930.
Hauduroy, P. (1955). Derniers aspects du monde des mycobactéries. Masson et Cie, Paris.
Hesketh, A. R., Chandra, G., Shaw, A. D., Rowland, J. J., Kell, D. B., Bibb, M. J. & Chater, K. F. (2002). Primary and secondary metabolism, and post-translational protein modifications, as portrayed by proteomic analysis of Streptomyces coelicolor. Mol. Microbiol. 46, 917-932.
Hiery, E. (2009). Charakterisierung eines Stickstoffregulators aus Mycobacterium smegmatis. Diploma thesis, Friedrich-Alexander University Erlangen-Nuremberg.
References 163
Himpens, S., Locht, C. & Supply, P. (2000). Molecular characterization of the mycobacterial SenX3–RegX3 two-component system: evidence for autoregulation. Microbiology 146, 3091-3098.
Hiratsu, K., Nakata, A., Shinagawa, H. & Makino, K. (1995). Autophosphorylation and activation of transcriptional activator PhoB of Escherichia coli by acetyl phosphate in vitro. Gene 161, 7-10.
Huang, K.-J., Lan, C.-Y. & Igo, M. M. (1997). Phosphorylation stimulates the cooperative DNA-binding properties of the transcriptional factor OmpR. Proc. Natl. Acad. Sci. USA 94, 2828-2832.
Itou, H. & Tanaka, I. (2001). The OmpR-family of proteins: insight into the tertiary structure and functions of two-component regulator proteins. J. Biochem. 129, 343-350.
Iwainsky, H. & Sehrt, I. (1967). Über die Anpassungsfähigkeit von Mycobacterium smegmatis an verschieden Stickstoffquellen. In: Sehrt, Mikro- und biochemische Untersuchungen über den Einfluss stickstoffhaltiger Substanzen auf den Stoffwechsel von Mycobakterien. PhD thesis, Humboldt-University Berlin.
Jahns, T., Zobel, A., Kleiner, D. & Kaltwasser, H. (1998). Evidence for carrier-mediated, energy dependent uptake of urea in some bacteria. Arch. Microbiol. 149, 377-383.
Jakoby, M., Nolden, L., Meier-Wagner, J., Krämer, R. & Burkovski, A. (2000). AmtR, a global repressor in the nitrogen regulation system of Corynebacterium glutamicum. Mol. Microbiol. 37, 964-977.
Javelle, A., Severi, E., Thornton, J. & Merrick, M. (2004). Ammonium sensing in Escherichia coli. Role of the ammonium transporter AmtB and AmtB-GlnK complex formation. J. Biol. Chem. 279, 8530-8538.
Jeßberger, N. (2008). Corynebacterium glutamicum AmtR - Regulation der Repressionsstringenz. Diploma thesis, Friedrich-Alexander University Erlangen-Nuremberg.
Jiang, P., Peliska, J. A. & Ninfa, A. J. (1998). Reconstitution of the signal-transduction bicyclic cascade responsible for the regulation of Ntr gene transcription in Escherichia coli. Biochemistry 37, 12795-12801.
Kamala, T., Paramasivan, C. N., Herbert, D., Venkatesan, P. & Prabhakar, R. (1994). Evaluation of procedures for isolation of nontuberculous mycobacteria from soil and water. Appl. Environ. Microbiol. 60, 1021-1024.
References 164
Kamberov, E. S., Atkinson, M. R. & Ninfa, A. J. (1995). The Escherichia coli PII signal transduction protein is activated upon binding 2-ketoglutarate and ATP. J. Biol. Chem. 270, 17797-17807.
Kanehisa, M., Goto, S., Furumichi, M., Tanabe, M. & Hirakawa, M. (2010). KEGG for representation and analysis of molecular networks involving diseases and drugs. Nucleic Acids Res. 38, 355-360.
Karlsen, A. G. & Lessel, E. F. (1970). Mycobacterium bovis nom. nov. Int. J. Syst. Bacteriol. 20, 273-282.
Keener, J. & Kustu, S. (1988). Protein kinase and phosphoprotein phosphatase activities of nitrogen regulatory proteins NtrB and NtrC of enteric bacteria: roles of the conserved amino-terminal domain of NtrC. Biochemistry 85, 4976-4980.
Keilhauer, C., Eggeling, L. & Sahm, H. (1993). Isoleucine synthesis in Corynebacterium glutamicum: molecular analysis of the ilvB-ilvN-ilvC operon. J. Bacteriol. 175, 5595-5603.
Khan, A. & Sarkar, D. (2006). Identification of a respiratory-type nitrate reductase and its role for survival of Mycobacterium smegmatis in Wayne model. Microb. Pathog. 41, 90-95.
Khan, A., Akhtar, S., Ahmad, J. & Sarkar, D. (2008). Presence of a functional nitrate pathway in Mycobacterium smegmatis. Microb. Pathog. 44, 71-77.
Kim, A. I., Ghosh, P., Aaron, M. A., Bibb, L. A., Jain, S. & Hatfull, G. H. (2003). Mycobacteriophage Bxb1 integrates into the Mycobacterium smegmatis groEL1 gene. Mol. Microbiol. 50, 463-473.
Kirschner, P., Teske, A., Schröder, K. H., Kroppenstedt, R. M., Wolters, J. & Böttger, E. C. (1992). Mycobacterium confluentis sp. nov. Int. J. Syst. Bacteriol. 42, 257-262.
Krawczyk, J., Kohl, T. A., Goesmann, A., Kalinowski, J. & Baumbach, J. (2009). From Corynebacterium glutamicum to Mycobacterium tuberculosis - towards transfers of gene regulatory networks and integrated data analyses with MycoRegNet. Nucleic Acids Res. 37, e97.
Kronemeyer, W., Peekhaus, N., Krämer, R., Sahm, H. & Eggeling, L. (1995). Structure of the gluABCD cluster encoding the glutamate uptake system of Corynebacterium glutamicum. J. Bacteriol. 177, 1152-1158.
References 165
Lama, A., Pawaria, S. & Dikshit, K. L. (2006). Oxygen binding and NO scavenging properties of truncated hemoglobin, HbN, of Mycobacterium smegmatis. FEBS Lett. 580, 4031-4041.
Lehmann, K. B. & Neumann, R. O. (1896). Atlas und Grundriss der Bakteriologie und Lehrbuch der speciellen bacteriologischen Diagnostik. Teil II. J. F. Lehmanns Verlag, München.
Lehmann, K. B. & Neumann, R. O. (1899). Bakteriologische Diagnostik. L. F. Lehmanns Verlag, München, 2. Aufl., II. Band, 408-413.
Leigh, J. A. & Dodsworth, J. A. (2007). Nitrogen regulation in bacteria and archaea. Annu. Rev. Microbiol. 61, 349-377.
Leuchtenberger, W., Huthmacher, K. & Drauz, K. (2005). Biotechnological production of amino acids and derivates: current status and prospects. Appl. Microbiol. Biotechnol. 69, 1-8.
Malm, S., Tiffert, Y., Micklinghoff, J., Schultze, S., Joost, I., Weber, I., Horst, S., Ackermann, B., Schmidt, M., Wohlleben, W., Ehlers, S., Geffers, R., Reuther, J. & Bange, F.-C. (2009). The roles of the nitrate reductase NarGHJI, the nitrite reductase NirBD and the response regulator GlnR in nitrate assimilation of Mycobacterium tuberculosis. Microbiology 155, 1332-1339.
Manganelli, R., Proveddi, R., Rodrigue, S., Beaucher, J., Gaudreau, L. & Smith, I. (2004). Sigma factors and global gene regulation in Mycobacterium tuberculosis. J. Bacteriol. 186, 859-902.
Mannhalter, C., Koizar, D. & Mitterbauer, G. (2000). Evaluation of RNA isolation methods and reference genes for RT-PCR analyses of rare target RNA. Clin. Chem. Lab. Med. 38, 171-177.
Mattison, K., Oropeza, R., Byers, N. & Kenney, L. J. (2002). A phosphorylation site mutant of OmpR reveals different binding conformations at ompF and ompC. J. Mol. Biol. 315, 497-511.
Meier-Wagner, J., Nolden, L., Jakoby, M., Siewe, R., Krämer, R. & Burkovski, A. (2001). Multiplicity of ammonium uptake systems in Corynebacterium glutamicum: role of Amt and AmtB. Microbiology 147, 135-143.
Merkens, H., Beckers, G., Wirtz, A. & Burkovski, A. (2005). Vanillate metabolism in Corynebacterium glutamicum. Curr. Microbiol. 51, 59-65.
References 166
Merrick, M. J. & Edwards, R. A. (1995). Nitrogen control in bacteria. Microbiol. Rev. 59, 604-622.
Milligan, D. L., Tran, S. L., Strych, U., Cook, G. M. &. Krause, K. L. (2007). The alanine racemase of Mycobacterium smegmatis is essential for growth in the absence of D-alanine. J. Bacteriol. 189, 8381-8386.
Mukherjee, R. & Chatterji, D. (2005). Evaluation of the role of sigma B in Mycobacterium smegmatis. Biochem. Biophys. Res. Commun. 338, 964-972.
Müller, T., Strösser, J., Buchinger, S., Nolden, L., Wirtz, A., Krämer, R. & Burkovski, A. (2006). Mutation-induced metabolite pool alterations in Corynebacterium glutamicum: towards the identification of nitrogen control signals. J. Biotechnol. 126, 440-453.
Mullis, K. B., Farone, F. A., Schar, S., Saiki, R., Horn, G. & Ehrlich, H. (1986). Specific amplification of DNA in vitro: the polymerase chain reaction. Cold Spring Harbor Symp. Quant. Biol. 51, 263-273.
Newman, E. B., Batist, G., Fraser, J., Isenberg, S., Weyman, P. & Kapoor, V. (2003a). The use of glycine as nitrogen source by Escherichia coli K12. Biochim. Biophys. Acta 421, 97-105.
Newman, D. J., Cragg, G. M. & Snader, K. M. (2003b). Natural products as sources of new drugs over the period 1981-2002. J. Nat. Prod. 66, 1022-1037.
Niederweis, M., Danilchanka, O., Huff, J., Hoffmann, C. & Engelhardt, H. (2010). Mycobacterial outer membranes: in search of proteins. Trends Microbiol. 18, 109-116.
Ninfa, A. J. & Atkinson, M. R. (2000). PII signal transduction proteins. Trends Microbiol. 8, 172-179.
Ninfa, A. J. & Jiang, P. (2005). PII signal transduction proteins: sensors of α-ketoglutarate that regulate nitrogen metabolism. Curr. Opin. Microbiol. 8, 168-173.
Nolden, L., Beckers, G., Möckel, B., Pfefferle, W., Nampoothiri, K. M., Krämer, R. & Burkovski, A. (2000). Urease of Corynebacterium glutamicum: organization of corresponding genes and investigation of activity. FEMS Microbiol. Lett. 189, 305-310.
Nolden, L., Farwick, M., Krämer, R. & Burkovski, A. (2001a). Glutamine synthetases in Corynebacterium glutamicum: transcriptional control and regulation of activity. FEMS Microbiol. Lett. 201, 91-98.
References 167
Nolden, L., Ngouoto-Nkili, C.-E., Bendt, A. K., Krämer, R. & Burkovski, A. (2001b). Sensing nitrogen limitation in Corynebacterium glutamicum: the role of glnK and glnD. Mol. Microbiol. 42, 1281-1295.
Nolden, L., Beckers, G. & Burkovski, A. (2002). Nitrogen assimilation in Corynebacterium diphtheriae: pathways and regulatory cascades. FEMS Microbiol. Lett. 208, 287-293.
O'Hare, H. M., Durán, R., Cerveñansky, C., Bellinzoni, M., Wehenkel, A. M., Pritsch, O., Obal, G., Baumgartner, J., Vialaret, J., Johnsson, K. & Alzari, P. M. (2008). Regulation of glutamate metabolism by protein kinases in mycobacteria. Mol. Microbiol. 70, 1408-1423.
Odell, L. R., Nilsson, M. T., Gising, J., Lagerlund, O., Muthas, D., Nordqvist, A., Karlén, A. & Larhed, M. (2009). Functionalized 3-amino-imidazo[1,2-a]pyridines: a novel class of drug-like Mycobacterium tuberculosis glutamine synthetase inhibitors. Bioorg. Med. Chem. Lett. 19, 4790-4793.
Ojha, A. K., Mukherjee, T. K. & Chatterji, D. (2000). High intracellular level of guanosine tetraphosphate in Mycobacterium smegmatis changes the morphology of the bacterium. Infect. Immun. 68, 4084-4091.
Ortalo-Magne, A., Lemassu, A., Laneelle, M. A., Bardou, F., Silve, G., Gounon, P., Marchal, G. & Daffé, M. (1996). Identification of the surface-exposed lipids on the cell envelopes of Mycobacterium tuberculosis and other mycobacterial species. J. Bacteriol. 178, 456-461.
Ozturk, C. E., Sanic, A., Kaya, D. & Ceyhan, I. (2005). Molecular analysis of isoniazid, rifampin and streptomycin resistance in Mycobacterium tuberculosis isolates from patients with tuberculosis in Düzce, Turkey. Jpn. J. Infect. Dis. 58, 309-312.
Parish, T. & Stoker, N. G. (2000). glnE is an essential gene in Mycobacterium tuberculosis. J. Bacteriol. 182, 5715-5720.
Pashley, C. A., Brown, A. C., Robertson, D. & Parish, T. (2006). Identification of the Mycobacterium tuberculosis GlnE promoter and its response to nitrogen availability.
Pfaffl, M. W. (2001). A new mathematical model for relative quantification in real-time RT-PCR. Nucleic Acids Res. 29, 2002-2007.
Philip, R. (1932). Robert Koch’s discovery of the tubercle bacillus. Am. Ref. Tuberc. 26, 637-652.
References 168
Pimentel-Schmitt, E. F., Thomae, A. W., Amon, J., Klieber, M. A., Roth, H. M., Muller, Y. A., Jahreis, K., Burkovski, A. & Titgemeyer, F. (2007). A glucose kinase from Mycobacterium smegmatis. J. Mol. Microbiol. Biotechnol. 12, 75-81.
Pitulle, C., Dorsch, M., Kazda, J., Wolters, J. & Stackebrandt, E. (1992). Phylogeny of rapidly growing members of the genus Mycobacterium. Int. J. Syst. Bacteriol. 42, 337-343.
Rastogi, N., Legrand, E. & Sola, C. (2001). The mycobacteria: an introduction to nomenclature and pathogenesis. Rev. Sci. Tech. 20, 21-54.
Read, R., Pashley, C. A., Smith, D. & Parish, T. (2007). The role of GlnD in ammonium assimilation in Mycobacterium tuberculosis. Tuberculosis 87, 384-390.
Reed, G. B. (1957). Family I mycobacteriaceae Chester 1897. In: Bergey's Manual of Determinative Bacteriology, 7th edition (ed. by Breed, Murray & Smith), 695.
Rehm, N., Georgi, T., Hiery, E., Degner, U., Schmiedl, A., Burkovski, A. & Bott, M. (2010). L-glutamine as a nitrogen source for Corynebacterium glutamicum: derepression of the AmtR regulon and implications for nitrogen sensing. Microbiology 156, 3180-3193.
Rehm, N. (2010). Biochemische und molekularbiologische Untersuchungen zur Verstoffwechselung von Ammonium und Glutamin in Corynebacterium glutamicum. PhD thesis, Friedrich-Alexander University Erlangen-Nuremberg.
Reuther, J. & Wohlleben, W. (2007). Nitrogen metabolism in Streptomyces coelicolor: transcriptional and post-translational regulation. J. Mol. Microbiol. Biotechnol. 12, 139-146.
Rexer, H. U., Schäberle, T., Wohlleben, W. & Engels, A. (2006). Investigation of the functional properties and regulation of three glutamine synthetase-like genes in Streptomyces coelicolor A3(2). Arch. Microbiol. 186, 447-458.
Reyrat, J. M. & Kahn, D. (2001). Mycobacterium smegmatis: an absurd model for tuberculosis? Trends Microbiol. 9, 472-473.
Richardson, A. (1971). The experimental production of mastitis in sheep by Mycobacterium smegmatis and Mycobacterium fortuitum. Cornell. Veterinarian. 61, 640-646.
References 169
Rodríguez-García, A., Sola-Landa, A., Apel, K., Santos-Beneit, F. & and Martín, J. F. (2009). Phosphate control over nitrogen metabolism in Streptomyces coelicolor: direct and indirect negative control of glnR, glnA, glnII and amtB expression by the response regulator PhoP. Nucleic Acids Res. 37, 3230-3242.
Rogall, T., Wolters, J., Flohr, T. & Bottger, E. C. (1990). Towards a phylogeny and definition of species at the molecular level within the genus Mycobacterium. Int. J. Syst. Bacteriol. 40, 323-330.
Runyon, E. H. (1959). Anonymous mycobacteria in pulmonary disease. Med. Clin. North. Am. 43, 273-290.
Sambrook, J., Fritsch, E. F. & Maniatis, T. (1989). Molecular cloning: a laboratory manual, 2nd edition, Cold Spring Habor Laboratory Press, Cold Spring Harbor, N. Y.
Sander, P., Meier, A. & Böttger, E. C. (1995). rpsL+: a dominant selectable marker for gene replacement in mycobacteria. Mol. Microbiol. 16, 991-1000.
Sanger, F., Nicklen, S. & Coulson, A. R. (1977). DNA sequencing with chain-terminating inhibitors. Proc. Natl. Acad. Sci. USA 74, 5463-5467.
Sarada, K. V., Appaji Rao, N. & Venkitasubramanian, T. A. (1980). Isolation and characterization of glutamate dehydrogenase from Mycobacterium smegmatis CDC 46. Biochim. Biophys. Acta 615, 299-308.
Schägger, H. & von Jagow, G. (1987). Tricine-sodium dodecyl sulfate-polyacrylamide gel electrophoresis for the separation of proteins in the range from 1 to 100 kDa. Anal. Biochem. 166, 368-379.
Schreiber, J., Burkhardt, U., Rüsch-Gerdes, S., Amthor, M., Richter, E., Zugehör, M., Rosahl, W. & Ernst, M. (2001). Nichttuberkulöse Mykobakteriose der Lungen durch Mycobacterium smegmatis. Pneumologie 55, 238-243.
Silberbach, M., Hüser, A., Kalinowski, J., Pühler, A., Walter, B., Krämer, R. & Burkovski, A. (2005a). DNA microarray analysis of the nitrogen starvation response of Corynebacterium glutamicum. J. Biotechnol. 119, 357-367.
Silberbach, M., Schäfer, M., Hüser, A. T., Kalinowski, J., Pühler, A., Krämer, R. & Burkovski, A. (2005b). Adaptation of Corynebacterium glutamicum to ammonium limitation: a global analysis using transcriptome and proteome techniques. Appl. Environ. Microbiol. 71, 2391-2402.
References 170
Snapper, S. B., Melton, R. E., Mustafa, S., Kieser, T. & Jacobs Jr., W. R. (1990). Isolation and characterization of efficient plasmid transformation mutants of Mycobacterium smegmatis. Mol. Microbiol. 4, 1911-1919.
Sohaskey, C. D. & Modesti, L. (2008). Differences in nitrate reduction between Mycobacterium tuberculosis and Mycobacterium bovis are due to differential expression of both narGHJI and narK2. FEMS Microbiol. Lett. 290, 129-134.
Son, H. S. & Rhee, S. G. (1987). Cascade control of Escherichia coli glutamine synthetase. Purification and properties of PII protein and nucleotide sequence of its structural gene. J. Biol. Chem. 262, 8690-8695.
Springer, B., Böttger, E. C., Kirschner, P. & Wallace, R. J. (1995). Phylogeny of the Mycobacterium chelonae-like organism based on partial sequencing of the 16S rRNA gene and proposal of Mycobacterium mucogenicum sp. nov. Int. J. Syst. Bacteriol. 45, 262-267.
Sritharan, V., Ratledge, C. & Wheeler, P. R. (1987). Effect of homoserine on growth of Mycobacterium smegmatis: inhibition of glutamate transport by homoserine. J. Gen. Microbiol. 133, 2781-2785.
Stahl, D. A. & Urbance, J. W. (1990). The division between fast- and slow-growing species corresponds to natural relationships among the mycobacteria. J. Bacteriol. 172, 116-124.
Strösser, J., Lüdke, A., Schaffer, S., Krämer, R. & Burkovski, A. (2004). Regulation of GlnK activity: modification, membrane sequestration and proteolysis as regulatory principles in the network of nitrogen control in Corynebacterium glutamicum. Mol. Microbiol. 54, 132-147.
Studier, F. W., Rosenberg, A. H., Dunn, J. J. & Dubendorff, J. W. (1990). Use of T7 polymerase to direct expression of cloned genes. Methods Enzymol. 185, 60-89.
Talaata, A. M., Trucksisa, M., Kaneb, A. S. & Reimschuessel, R. (1999). Pathogenicity of Mycobacterium fortuitum and Mycobacterium smegmatis to goldfish, Carassius auratus. Veterin. Microbiol. 66, 151-164.
Tatusov, R. L., Fedorova, N. D., Jackson, J. D., Jacobs, A. R., Kiryutin, B., Koonin, E. V., Krylov, D. M., Mazumder, R., Mekhedov, S. L., Nikolskaya, A. N., Rao, B. S., Smirnov, S., Sverdlov, A. V., Vasudevan, S., Wolf, Y. I., Yin, J. J. & Natale, D. A. (2003). The COG database: an updated version includes eukaryotes. BMC Bioinformatics 4. doi:10.1186/1471-2105-4-41.
References 171
Tiffert, Y., Supra, P., Wurm, R., Wohlleben, W., Wagner, R. & Reuther, J. (2008). The Streptomyces coelicolor GlnR regulon: identification of new GlnR targets and evidence for a central role of GlnR in nitrogen metabolism in actinomycetes. Mol. Microbiol. 67, 861-880.
Tiffert, Y., Franz-Wachtel, M., Fladerer, C., Nordheim, A., Reuther, J., Wohlleben, W. & Mast, Y. (2011). Proteomic analysis of the GlnR-mediated response to nitrogen limitation in Streptomyces coelicolor M145. Appl. Microbiol. Biotechnol. 89, 1149-1159.
Traag, B. A., Driks, A., Stragier, P., Bitter, W., Broussard, G., Hatfull, G., Chu, F., Adams, K. N., Ramakrishnan, L. & Losick, R. (2010). Do mycobacteria produce endospores? Proc. Natl. Sci. USA 107, 878-881.
Tsukamura, M. (1966). Adansonian classification of mycobacteria. J. Gen. Microbiol. 45, 253-273.
Tsukamura, M. (1981). Numerical analysis of rapidly growing, nonphotochromogenic mycobacteria, including Mycobacterium agri (Tsukamura 1972) Tsukamura sp. nov., nom. rev. Int. J. Syst. Bacteriol. 31, 247-258.
Tullius, M. V., Harth, G. & Horwitz, A. A. (2003). Glutamine synthetase GlnA1 is essential for growth of Mycobacterium tuberculosis in human THP-1 macrophages and guinea pigs. Infect. Immun. 71, 3927-3936.
van Crevel, R., Ottenhoff, T. H. M. & van der Meer, J. W. M. (2002). Innate immunity to Mycobacterium tuberculosis. Clin. Microbiol. Rev. 15, 294-309.
van Heeswijk, W. C., Rabenberg, M., Westerhoff, H. V. & Kahn, D. (1993). The genes of the glutamine synthetase adenylylation cascade are not regulated by nitrogen in Escherichia coli. Mol. Microbiol. 9, 443-457.
Wallace Jr., R. J., Nash, D. R., Tsukamura, M., Blacklock, Z. M. & Silcox, V. A. (1988). Human disease due to Mycobacterium smegmatis. J. Infect. Dis. 158, 52-59.
Walter, B. (2007). Funktion der Ammoniumtransporter AmtA und AmtB in Corynebacterium glutamicum. PhD thesis, Friedrich-Alexander University Erlangen-Nuremberg.
Walter, B., Küspert, M., Ansorge, D., Krämer, R. & Burkovski, A. (2008). Dissection of ammonium uptake systems in Corynebacterium glutamicum: mechanism of action and energetics of AmtA and AmtB. J. Bacteriol. 190, 2611-2614.
References 172
Wang, R. & Marcotte, E. M. (2007). The proteomic response of Mycobacterium smegmatis to anti-tuberculosis drugs suggests targeted pathways. J. Proteome Res. 7, 855-865.
Wang, J. & Zhao, G.-P. (2009). GlnR positively regulates nasA transcription in Streptomyces coelicolor. Biochem. Biophys. Res. Commun. 386, 77-81.
Wayne, L. G. (1966). Classification and identification of mycobacteria. III. Species within Group III. Amer. Rev. Resp. Dis. 93, 919-928.
Weber, I., Fritz, C., Ruttkowski, S., Kreft, A. & Bange, F.-C. (2000). Anaerobic nitrate reductase (narGHJI) activity of Mycobacterium bovis BCG in vitro and its contribution to virulence in immunodeficient mice. Mol. Microbiol. 35, 1017-1025.
Weinand, M. (2004). Expressionsregulation von Transportern kompatibler Solute in Corynebacterium glutamicum. PhD thesis, University of Cologne.
Wray, L. V. & Fisher, S. H. (1993). The Streptomyces coelicolor glnR gene encodes a protein similar to other bacterial response regulators. Gene 130, 145-150.
Yoshida, T., Qin, L., Egger, L. A. & Inouye, M. (2006). Transcription regulation of ompF and ompC by a single transcription factor, OmpR. J. Biol. Chem. 281, 17114-17123.
Yu, H., Peng, W., Liu, Y., Wu, T., Yao, Y., Cui, M., Jiang, W. & Zhao, G. P. (2006). Identification and characterization of glnA promoter and its corresponding trans-regulating protein GlnR in the rifamycin SV producing actinomycete, Amycolatopsis mediterranei U32. Acta. Biochim. Biophys. Sin. 38, 831-843.
Appendix 173
7 Appendix
7.1 Plasmid constructions
Constructions of the plasmids listed in table 2, section 3.1, are described below. Restriction
sites or exchanged bases in the primer sequences are highlighted bold.
pASK-IBA5+glnR*
glnR* variants (generated as described below: pMN016glnR*) were each amplified via PCR
using each pMN016glnR* as template and the primers 5’-G CGC CTC GAG GGA TCT ACT
GCT ACT GAC C-3’ and 5’-G CGC AAG CTT TCA CTG ACT GGT CAA C-3’. The resulting
fragments were restricted with XhoI and HindIII and cloned to the XhoI-HindIII-restricted
vector pASK-IBA5plus (IBA BioTAGnology, Göttingen). After sequencing of the constructs,
the GlnR* proteins could be purified via N-terminal Strep-tag.
pASK-IBA5+senX3*
For purification of SenX3 without its 131 amino acids N-terminal transmembrane domain via
N-terminal Strep-tag, a truncated version of the corresponding gene msmeg_0936 (senX3)
was amplified using chromosomal DNA of M. smegmatis as template and the primers 5’-G
CGC GGC GCC GTC TAC ATC GAC GAC C-3’ and 5’-G CGC CCC GGG TCA TCG TTC
TCG TTG GTC CTC-3’. The resulting fragment was restricted with KasI and XmaI and
cloned to the KasI-XmaI-restricted vector pASK-IBA5plus (IBA BioTAGnology, Göttingen).
pMal-c2-1918
For purification of Msmeg_1918 via MBP-tag the corresponding gene msmeg_1918 (1497 bp
without start codon) was amplified via PCR using chromosomal DNA of M. smegmatis as
template and the primers 5’-G CGC GAA TTC TCG ACC CTC GGT GAT CTG-3’ and 5’-G
CGC AAG CTT CTA CTG CGC GCC CCG GCT GC-3’. It was subsequently restricted with
EcoRI and HindIII and cloned to the EcoRI-HindIII-restricted vector pMal-c2 (Guan et al.,
1987). The resulting construct was sequenced.
Appendix 174
pMal-c2-5241
For purification of Msmeg_5241 via MBP-tag the corresponding gene msmeg_5241 (1713 bp
without start codon) was amplified via PCR using chromosomal DNA of M. smegmatis as
template and the primers 5’-G CGC GAA TTC GGG GGC GTG AAC GGC CA-3’ and 5’-G
CGC AAG CTT TCA GTC GGG GAG CGG CGC GG-3’. It was subsequently restricted with
EcoRI and HindIII and cloned to the EcoRI-HindIII-restricted vector pMal-c2 (Guan et al.,
1987). The resulting construct was sequenced.
pMal-c2-glnR
For purification of M. smegmatis GlnR via MBP-tag the corresponding glnR gene (783 bp
without start codon) was amplified via PCR using chromosomal DNA of M. smegmatis as
template and the primers 5’-G CGC GGA TCC GAT CTA CTG CTA CTG ACC-3’ and 5’-G
CGC AAG CTT TCA CTG ACT GGT CAA C-3’. It was subsequently restricted with BamHI
and HindIII and cloned to the BamHI-HindIII-restricted vector pMal-c2 (Guan et al., 1987).
The resulting construct was sequenced.
pMal-c2glnR M.tub.
For purification of M. tuberculosis GlnR via MBP-tag the corresponding glnR gene (765 bp
without start codon) was amplified via PCR using chromosomal DNA of M. tuberculosis as
template and the primers 5’-G CGC GAA TTC TTG GAG TTA TTA CTG CTG ACC T-3’ and
5’-G CGC AAG CTT TCA CTG ACT GCG CAA CGG GT-3’. It was subsequently restricted
with EcoRI and HindIII and cloned to the EcoRI-HindIII-restricted vector pMal-c2 (Guan et al.,
1987). The resulting construct was sequenced.
pML814-D1918kin
A 1000 bp fragment upstream of the kinase domain encoding region of msmeg_1918 was
amplified via PCR using chromosomal DNA of M. smegmatis as template and the primers 5’-
GCG CAT TTA AAT GCA GCG GTG AAA AAG CCC CG-3’ and 5’-GCG CTT AAT TAA
GGG GCT GGT CAG CCG CCG CT-3’, restricted with SwaI and PacI and cloned to SwaI-
PacI-restricted vector pML814 (M. Niederweis, personal communication). A 1000 bp
fragment downstream of the kinase domain encoding region of msmeg_1918 was amplified
via PCR using chromosomal DNA of M. smegmatis as template and the primers 5’-G CGC
ACT AGT CTG CCG CTG GTC GCC GG-3’ and 5’-GCG CGT TTA AAC GCT GGG CTT
TGG AGT CGG G-3’, restricted with SpeI and PmeI and cloned to SpeI-PmeI-restricted
Appendix 175
vector pML814 (M. Niederweis, personal communication). Subsequently, the construct was
sequenced.
pML814-D5241
A 1000 bp fragment upstream of msmeg_5241 was amplified via PCR using chromosomal
DNA of M. smegmatis as template and the primers 5’-GCG CAT TTA AAT AGT CCG GAG
CCT TCC GTG CC-3’ and 5’-GCG CTT AAT TAA GCT GGC ATT TCC GGC GGC G-3’,
restricted with SwaI and PacI and cloned to SwaI-PacI-restricted vector pML814
(M. Niederweis, personal communication). A 1000 bp fragment downstream of msmeg_5241
was amplified via PCR using chromosomal DNA of M. smegmatis as template and the
primers 5’-G CGC ACT AGT AGT CGC GAG AGG AAG GTG ACC C-3’ and 5’-GCG CGT
TTA AAC GCG ACC CAC ATC GCG G-3’, restricted with SpeI and PmeI and cloned to
SpeI-PmeI-restricted vector pML814 (M. Niederweis, personal communication).
Subsequently, the construct was sequenced.
pML814-I0426
A 500 bp fragment of msmeg_0426 was amplified via PCR using chromosomal DNA of
M. smegmatis as template and the primers 5’-GCG CGT TTA AAC TCG AAA CAC GGC
CCG GTG TG-3’ and 5’-G CGC ACT AGT CAC CCC AGT AGG TGG GTG ACT C-3’. The
resulting fragment was restricted with PmeI and SpeI and cloned to the PmeI-SpeI-restricted
vector pML814 (M. Niederweis, personal communication).
pML814-I2106
A 500 bp fragment of msmeg_2106 was amplified via PCR using chromosomal DNA of
M. smegmatis as template and the primers 5’-GCG CGT TTA AAC GGC CTC CGC GCG
CAT CGT-3’ and 5’-G CGC ACT AGT GGT TCC GAC AGC ACG ATG CCG-3’. The resulting
fragment was restricted with PmeI and SpeI and cloned to the PmeI-SpeI-restricted vector
pML814 (M. Niederweis, personal communication).
pML814-I2837 (narB)
A 500 bp fragment of msmeg_2837 (narB) was amplified via PCR using chromosomal DNA
of M. smegmatis as template and the primers 5’-GCG CGT TTA AAC GCC TCA CCG ACG
ACG ACG T-3’ and 5’-G CGC ACT AGT ATG GTC GAC GTC GGT GTA CGA G-3’. The
Appendix 176
resulting fragment was restricted with PmeI and SpeI and cloned to the PmeI-SpeI-restricted
vector pML814 (M. Niederweis, personal communication).
pML814-I4989
A 500 bp fragment of msmeg_4989 was amplified via PCR using chromosomal DNA of
M. smegmatis as template and the primers 5’-GCG CGT TTA AAC CCC AGG TCG CGC
TGC TCG CCG TG-3’ and 5’-G CGC ACT AGT CAC CGA GTT GGG CAG TCC GGT GAC
GA-3’. The resulting fragment was restricted with PmeI and SpeI and cloned to the PmeI-
SpeI-restricted vector pML814 (M. Niederweis, personal communication).
pML814-I5140 (narG)
A 500 bp fragment of msmeg_5140 (narG) was amplified via PCR using chromosomal DNA
of M. smegmatis as template and the primers 5’-GCG CGT TTA AAC GAC CGA CTA CCC
GTC CGT G-3’ and 5’-G CGC ACT AGT CGA CTC CGG GAC ATC GGT C-3’. The resulting
fragment was restricted with PmeI and SpeI and cloned to the PmeI-SpeI-restricted vector
pML814 (M. Niederweis, personal communication).
pML814-I5143
A 500 bp fragment of msmeg_5143 was amplified via PCR using chromosomal DNA of
M. smegmatis as template and the primers 5’-GCG CGT TTA AAC CGA CGT GGC GCC
GGC CAC-3’ and 5’-G CGC ACT AGT GCC AGT CCA CCG GAG AAG TTG GTG-3’. The
resulting fragment was restricted with PmeI and SpeI and cloned to the PmeI-SpeI-restricted
vector pML814 (M. Niederweis, personal communication).
pMN016glnR*
Point mutations were induced into the M. smegmatis glnR gene via two-step PCR. In a first
reaction, truncated glnR fragments were amplified using pMN016glnR (Bräu, 2008) as
template. As reverse primer 5’-G CGC AAG CTT TCA CTG ACT GGT CAA C-3’ was used.
Forward primers inducing specific point mutations were: 5’-GGT AGT GCC GCC GTC GCG
ATC-3’ (Asp43Ala), 5’-GGT AGT GCC AAC GTC GCG ATC G-3’ (Asp43Asn), 5’-GGT AGT
GCC GAG GTC GCG ATC G-3’ (Asp43Glu), 5’-G ATC GTC GCC GCT CGC ACA-3’
(Asp48Ala), 5’-GCG ATC GTC AAC GCT CGC ACA G-3’ (Asp48Asn), 5’-CG ATC GTC GAG
GCT CGC ACA G-3’ (Asp48Glu), 5’-GCT CGC ACA GCT CTG GCC GC-3’ (Asp52Ala), 5’-
GCT CGC ACA AAT CTG GCC GC-3’ (Asp52Asn), 5’-C GCT CGC ACA GAG CTG GCC
Appendix 177
GC-3’ (Asp52Glu), 5’-GGT AGT GCC GCC GTC GCG ATC GTC GCC GCT CGC ACA GCT
CTG GCC GCC-3’ (Asp43/48/52Ala) and 5’-CGA TCG TCG ACG CTC GCA CAG-3’ (no
mutation, but resulting in Ala45Ser). In a second reaction, the full-length glnR* genes (786
bp) were amplified using pMN016glnR (Bräu, 2008) as template, 5’-G CGC GCA TGC TTG
GAT CTA CTG CTA CT-3’ as forward primer and the products of PCR 1 as reverse primers.
The resulting fragments were restricted with SpeI and HindIII and cloned to the SpeI-HindIII-
restricted vector pMN016 (M. Niederweis, personal communication). Subsequently, the
constructs were sequenced.
pMN016glnR-his
His-tagged glnR of M. smegmatis was expressed from non-inducible, strong promoter psmyc
in this vector. The plasmid pQE70-glnR was restricted with HindIII and SphI, resulting in a
817 bp insert consisting of glnR and the sequence of a C-terminal His-tag. The insert was
ligated to the HindIII-SphI-restricted vector pMN016 (M. Niederweis, personal
communication).
pMN016his-glnR
From the plasmid pUC19-his-glnR (M. Höller, personal communication), a 817 bp fragment
consisting of the sequence of an N-terminal His-tag and M. smegmatis glnR was amplified
via PCR using the primers 5’-CGC GCG GCA TGC ATG CAC CAC CAC CAC CAC CA-3’
and 5’-GCG CGC AAG CTT TCA CTG ACT GGT CAA CCG CC-3’. The fragment was
restricted with HindIII and SphI and cloned to HindIII-SphI-restricted vector pMN016
(M. Niederweis, personal communication). The construct was subsequently sequenced.
pMN-amt1p-gfpuv
To measure nitrogen- and GlnR-dependent promoter activity via fluorescence, a 500 bp
promoter fragment of msmeg_6259 (amt1) was amplified via PCR using chromosomal DNA
of M. smegmatis as template and the primers 5’-G CGC TCT AGA CAC CAC ACT GGC
CGG G-3’ and 5’-G CGC GCA TGC CAA ACA TCT CCT CAC GG-3’. The resulting insert
was restricted with XbaI and SphI and cloned to the XbaI-SphI-restricted vector pMN016-
gfpuv (Y. Lu, personal communication). The construct was subsequently sequenced.
Appendix 178
pMN-amtAp-gfpuv
To measure nitrogen- and GlnR-dependent promoter activity via fluorescence, a 500 bp
promoter fragment of msmeg_4635 (amtA) was amplified via PCR using chromosomal DNA
of M. smegmatis as template and the primers 5’-G CGC TCT AGA GCA GGC TCA GCA
TCT CGT GG-3’ and 5’-G CGC GCA TGC AAA AAC CTC CGC AGG GGG-3’. The resulting
insert was restricted with XbaI and SphI and cloned to the XbaI-SphI-restricted vector
pMN016-gfpuv (Y. Lu, personal communication). The construct was subsequently
sequenced.
pMN-amtBp-gfpuv
To measure nitrogen- and GlnR-dependent promoter activity via fluorescence, a 500 bp
promoter fragment of msmeg_2425 (amtB) was amplified via PCR using chromosomal DNA
of M. smegmatis as template and the primers 5’-G CGC TCT AGA CGC GCC GCG GTC
GA-3’ and 5’-G CGC GCA TGC TTT GTG TGA ACC TCC TTG-3’. The resulting insert was
restricted with XbaI and SphI and cloned to the XbaI-SphI-restricted vector pMN016-gfpuv
(Y. Lu, personal communication). The construct was subsequently sequenced.
pMN-gdhp-gfpuv
To measure nitrogen- and GlnR-dependent promoter activity via fluorescence, a 500 bp
promoter fragment of msmeg_5442 (gdhA) was amplified via PCR using chromosomal DNA
of M. smegmatis as template and the primers 5’-G CGC TCT AGA CGC CGA CCT CGC
CAA C-3’ and 5’-G CGC GCA TGC CTC AAT CGT TCT GAT AGC-3’. The resulting insert
was restricted with XbaI and SphI and cloned to the XbaI-SphI-restricted vector pMN016-
gfpuv (Y. Lu, personal communication). The construct was subsequently sequenced.
pMN-glnAp-gfpuv
To measure nitrogen- and GlnR-dependent promoter activity via fluorescence, a 500 bp
promoter fragment of msmeg_4290 (glnA) was amplified via PCR using chromosomal DNA
of M. smegmatis as template and the primers 5’-G CGC TCT AGA GCT CTC CAG CCA
CTC ACC CG-3’ and 5’-G CGC GCA TGC TGA AGC TCC TAA ATG GAC TA-3’. The
resulting insert was restricted with XbaI and SphI and cloned to the XbaI-SphI-restricted
vector pMN016-gfpuv (Y. Lu, personal communication). The construct was subsequently
sequenced.
Appendix 179
pMN-glnRp-gfpuv
To measure nitrogen- and GlnR-dependent promoter activity via fluorescence, a 500 bp
promoter fragment of msmeg_5784 (glnR) was amplified via PCR using chromosomal DNA
of M. smegmatis as template and the primers 5’-G CGC TCT AGA GCG TCC TCG CGG
ATC AGC CAC G-3’ and 5’-G CGC GCA TGC CAA GTC CTC CCG GCT CGT ACG-3’. The
resulting insert was restricted with XbaI and SphI and cloned to the XbaI-SphI-restricted
vector pMN016-gfpuv (Y. Lu, personal communication). The construct was subsequently
sequenced.
pMN-lacZ
To measure nitrogen- and GlnR-dependent promoter activity via β-galactosidase activity, the
gfp gene was exchanged by lacZ. For that purpose, the lacZ gene (3069 bp) was amplified
via PCR using the plasmid pWH948 (J. Bürger) as template and the primers 5’-G CGC ACT
AGT ATG AAA GGG AAT TCA CTG GCC GTC G-3’ and 5’-G CGC AAG CTT TTA TTT TTG
ACA CCA GAC CAA CTG G-3’. The resulting insert was restricted with SpeI and HindIII,
cloned to the SpeI-HindIII-restricted vector pMN-gfpuv (Y. Lu, personal communication) and
subsequently sequenced.
pMN016-lacZ
To measure nitrogen- and GlnR-dependent promoter activity via β-galactosidase activity, the
gfp gene was exchanged by lacZ. For that purpose, the lacZ gene (3069 bp) was amplified
via PCR using the plasmid pWH948 (J. Bürger) as template and the primers 5’- GCG CTT
AAT TAA ATG AAA GGG AAT TCA CTG GCC GTC G-3’ and 5’-G CGC AAG CTT TTA TTT
TTG ACA CCA GAC CAA CTG G-3’. The resulting insert was restricted with PacI and HindIII
and cloned to the PacI-HindIII-restricted vector pMN016-gfpuv (Y. Lu, personal
communication). The plasmid was subsequently sequenced.
The same method was used generating the constructs pMN-amtAp-lacZ, pMN-amtBp-lacZ,
pMN-amtRp-lacZ, pMN-gdhp-lacZ, pMN-glnAp-lacZ and pMN-glnRp-lacZ. Here, the lacZ
gene was cloned to PacI-HindIII-restricted vectors pMN-amtAp-gfpuv, pMN-amtBp-gfpuv,
pMN-amtRp-gfpuv, pMN-gdhp-gfpuv, pMN-glnAp-gfpuv and pMN-glnRp-gfpuv.
Appendix 180
pQE70-glnR
The glnR gene from M. smegmatis (786 bp) was amplified via PCR using chromosomal DNA
as template and the primers 5’-G CGC GCA TGC TTG GAT CTA CTG CTA CT-3’ and 5’-G
GCG CGC GGA TCC CTG ACT GGT CAA CCG CC-3’. The insert was restricted with NlaIII
and BamHI, cloned to the SphI-BamHI-restricted vector pQE70 (Qiagen, Hilden) and
subsequently sequenced. This resulted in a glnR-his construct for purification of GlnR from
E. coli via a C-terminal His-tag.
7.2 Complete data obtained from DNA microarray analyses
As described in section 4.2.1, a global approach to identify genes involved in nitrogen
metabolism of M. smegmatis was carried out. Additionally, genes putatively regulated by
GlnR were found in this analysis. In a first experiment, total transcript of the M. smegmatis
wild type strain SMR5, incubated under nitrogen surplus and starvation, was compared. After
analysis of the data, 231 genes with decreased transcript levels under nitrogen starvation
were found (minimum factor 3). These genes are listed in table 9. Furthermore, 284 genes
were identified showing enhanced mRNA levels in the wild type under nitrogen starvation
(minimum factor 3; shown in table 10). When total transcript of the wild type and the glnR
deletion strain was compared under nitrogen starvation, transcripts of only 6 genes were
increased by a minimum factor of 3 in the absence of GlnR. These can be seen in table 11.
In fact, the amount of mRNA of 125 genes was decreased in the glnR deletion strain
compared to the wild type under nitrogen starvation (minimum factor 3; listed in table 12).
Additionally, total transcriptome analysis was also performed with an amtR deletion strain
resulting in two putative AmtR target genes (see table 13).
Tab. 9: List of all 231 genes with decreased transcript levels in the M. smegmatis wild type strain SMR5 under nitrogen starvation. The msmeg_ gene numbers as well as the fold change of transcripts, an annotational description and the corresponding COG numbers are given. Data are sorted by the strength of fold change in an ascending manner.
Locus tag Fold change
Description COG number
msmeg_2536 3.01 3-oxoacyl-[acyl-carrier-protein] reductase COG1028IQR
msmeg_3509 3.01 conserved hypothetical protein COG0491R
msmeg_0016 3.01 conserved domain protein COG3251S
msmeg_3792 3.01 ribosomal protein L35 (rpmI) COG0291J
msmeg_0985 3.02 sugar transporter family protein COG2814G
msmeg_6238 3.02 putative two-component system sensor kinase COG4585T
msmeg_0531 3.03 putative acyl-CoA dehydrogenase COG1960I
msmeg_3363 3.03 regulatory protein, TetR COG1309K
msmeg_6313 3.04 queuine tRNA-ribosyltransferase (tgt) COG0343J
Appendix 181
msmeg_0401 3.04 putative non-ribosomal peptide synthase COG1020Q
msmeg_3364 3.05 RhtB family transporter COG1280E
msmeg_2349 3.05 glycosyl hydrolase, family 57 COG1543S
msmeg_5061 3.06 bacterial extracellular solute-binding protein COG1653G
msmeg_3710 3.08 cytochrome b561 family protein COG3038C
msmeg_4627 3.08 nucleoside diphosphate kinase COG0105F
msmeg_0788 3.10 putative conserved membrane protein X
msmeg_6034 3.11 hypothetical protein X
msmeg_2963 3.12 bacterial extracellular solute-binding proteins, family 5 COG0747E
msmeg_2853 3.12 conserved hypothetical protein COG0767Q
msmeg_0313 3.13 phosphogluconate dehydratase (edd) COG0129EG
msmeg_6315 3.13 lipoprotein LpqH X
msmeg_5525 3.13 succinyl-CoA synthetase, beta subunit (sucC) COG0045C
msmeg_1019 3.14 ribonucleoside-diphosphate reductase, alpha subunit COG0209F
msmeg_5060 3.15 ABC transporter, permease protein SugA COG1175G
msmeg_2499 3.15 ABC transporter, membrane spanning protein COG0600P
msmeg_4644 3.16 molybdopterin-guanine dinucleotide biosynthesis protein A COG0746H
msmeg_3539 3.17 hypothetical protein X
msmeg_2042 3.18 phosphotransferase enzyme family protein COG3173R
msmeg_1401 3.19 translation elongation factor Tu (tuf) COG0050J
msmeg_1870 3.19 conserved hypothetical protein COG0840NT
msmeg_5897 3.21 virulence factor mce family protein COG1463Q
msmeg_6458 3.23 glutamate synthase, small subunit COG0493ER
msmeg_1524 3.24 DNA-directed RNA polymerase, alpha subunit (rpoA) X
msmeg_1525 3.24 50S ribosomal protein L17 COG2030I
msmeg_4958 3.25 diaminopimelate decarboxylase (lysA) COG0019E
msmeg_4646 3.25 pyruvate synthase COG0674C
msmeg_6404 3.25 UDP-galactopyranose mutase (glf) COG0562M
msmeg_3159 3.26 methylmalonyl-CoA mutase large subunit COG1884I
msmeg_4656 3.27 sugar ABC transporter ATP-binding protein COG1129G
msmeg_1341 3.27 MaoC family protein COG0203J
msmeg_0082 3.27 conserved hypothetical protein COG0202K
msmeg_6402 3.28 PAP2 superfamily protein X
msmeg_4111 3.29 alpha-methylacyl-CoA racemase COG1804C
msmeg_1963 3.30 putative transcriptional regulatory protein COG3629T
msmeg_4118 3.31 acyl-CoA dehydrogenase COG0267J
msmeg_0140 3.32 probable conserved mce associated membrane protein X
msmeg_5091 3.32 hypothetical protein X
msmeg_0840 3.32 hypothetical protein X
msmeg_1339 3.33 ribosomal protein L33 (rpmG) COG1960I
msmeg_4114 3.35 naphthoate synthase (menB) COG0447H
msmeg_5432 3.35 peptidyl-tRNA hydrolase (pth) COG0193J
msmeg_2533 3.36 hypothetical protein X
msmeg_2348 3.36 glycosyl transferase, group 1 family protein X
msmeg_1023 3.36 integral membrane transporter X
msmeg_1256 3.37 hypothetical protein X
msmeg_4087 3.37 major facilitator superfamily COG2271G
msmeg_3962 3.38 lactate 2-monooxygenase COG1304C
msmeg_5222 3.39 GTP-binding protein YchF (ychF) COG0464O
msmeg_6050 3.40 solute-binding lipoprotein COG0803P
msmeg_5968 3.41 polysaccharide biosynthesis protein COG2244R
msmeg_6947 3.41 chromosomal replication initiator protein DnaA (dnaA) COG0593L
msmeg_0059 3.41 ATPase, AAA family COG0012J
msmeg_3051 3.43 guanylate kinase COG0194F
msmeg_6236 3.43 two-component system, regulatory protein COG2197TK
Appendix 182
msmeg_6021 3.43 xylose isomerase (xylA) COG2115G
msmeg_1398 3.43 ribosomal protein S12 (rpsL) X
msmeg_0061 3.44 ftsk-spoiiie family protein COG0048J
msmeg_1255 3.47 UvrD-Rep helicase X
msmeg_5211 3.48 aminotransferase class-III COG5012R
msmeg_6542 3.48 B12 binding domain protein COG1674D
msmeg_0078 3.48 hypothetical protein COG0210L
msmeg_6903 3.49 transcriptional regulator, PadR family protein COG0160E
msmeg_5901 3.49 TrnB2 protein COG1695K
msmeg_0787 3.51 bacterial extracellular solute-binding proteins, family 3 COG0183I
msmeg_5199 3.51 putative acyl-CoA dehydrogenase X
msmeg_2820 3.51 hypothetical protein COG0767Q
msmeg_0055 3.52 hypothetical protein COG0834ET
msmeg_5198 3.52 carnitinyl-CoA dehydratase X
msmeg_3708 3.53 catalase COG1463Q
msmeg_0238 3.53 O-acetylhomoserine-O-acetylserine sulfhydrylase COG1832R
msmeg_6758 3.56 transport integral membrane protein COG0753P
msmeg_5923 3.56 acetyl-CoA acetyltransferase COG0183I
msmeg_4645 3.56 alpha oxoglutarate ferredoxin oxidoreductase, beta subunit X
msmeg_4086 3.57 nitrilotriacetate monooxygenase component A (ssuD) COG1013C
msmeg_6400 3.57 probable conserved transmembrane protein COG0580G
msmeg_5896 3.58 virulence factor Mce family protein COG1024I
msmeg_5899 3.58 virulence factor Mce family protein COG2141C
msmeg_0410 3.60 MmpL protein COG1841J
msmeg_6638 3.61 methyltransferase (metE) X
msmeg_5895 3.63 virulence factor mce family protein COG0458EF
msmeg_3047 3.64 carbamoyl-phosphate synthase, large subunit (carB) COG2409R
msmeg_3161 3.64 lipoprotein, putative COG1463Q
msmeg_1473 3.64 ribosomal protein L30 (rpmD) COG1463Q
msmeg_5057 3.65 conserved hypothetical protein COG0620E
msmeg_0622 3.65 putative DNA-binding protein X
msmeg_0108 3.67 acyl-CoA dehydrogenase COG1960I
msmeg_6759 3.68 glycerol kinase (glpK) COG0554C
msmeg_0062 3.68 ftsk-spoiiie family protein COG1674D
msmeg_3599 3.69 sugar-binding transcriptional regulator, LacI family COG1879G
msmeg_4116 3.71 3-hydroxybutyryl-CoA dehydrogenase COG1250I
msmeg_4561 3.72 ABC Fe3+-siderophores transporter, periplasmic binding protein COG0614P
msmeg_3197 3.73 lipase X
msmeg_1805 3.73 conserved hypothetical protein X
msmeg_6904 3.74 myo-inositol-1-phosphate synthase COG1260I
msmeg_1474 3.75 ribosomal protein L15 (rplO) COG0200J
msmeg_5371 3.78 ectoine-hydroxyectoine ABC transporter, ATP-binding protein COG1126E
msmeg_6307 3.79 glutamine-binding periplasmic protein COG0765E
msmeg_3598 3.80 periplasmic sugar-binding proteins COG1879G
msmeg_6942 3.80 membrane protein OxaA COG0706U
msmeg_0132 3.82 conserved hypothetical protein COG1804C
msmeg_0620 3.82 pe family protein X
msmeg_4756 3.83 holo-(acyl-carrier-protein) synthase (acpS) COG0736I
msmeg_1704 3.83 ABC transporter COG4213G
msmeg_0138 3.84 virulence factor Mce family protein X
msmeg_2130 3.84 putative acyl-CoA dehydrogenase COG1960I
msmeg_1705 3.85 D-xylose transport ATP-binding protein XylG COG1129G
msmeg_2073 3.86 CAIB-BAIF family protein COG0767Q
msmeg_6761 3.87 glycerol-3-phosphate dehydrogenase 2 COG0578C
msmeg_3713 3.87 hypothetical protein COG1463Q
Appendix 183
msmeg_0380 3.88 MmpS4 protein X
msmeg_6585 3.89 acyl-CoA dehydrogenase COG1960I
msmeg_4115 3.90 3-hydroxybutyryl-CoA dehydrogenase COG1250I
msmeg_1349 3.92 dgpf domain family COG3795S
msmeg_4560 3.92 periplasmic binding protein COG0614P
msmeg_0239 3.92 O-acetylhomoserine-O-acetylserine sulfhydrylase COG2873E
msmeg_1342 3.92 conserved hypothetical protein COG2030I
msmeg_0786 3.99 serine-threonine protein kinase COG0515RTK
msmeg_0068 4.00 probable conserved transmembrane protein X
msmeg_0080 4.00 conserved hypothetical protein X
msmeg_1340 4.00 conserved hypothetical protein X
msmeg_3094 4.02 oxidoreductase, inc-binding dehydrogenase family COG1063ER
msmeg_4083 4.04 putative monooxygenase COG2141C
msmeg_4530 4.05 sulfate ABC transporter, ATP-binding protein (cysA) COG1118P
msmeg_4531 4.05 sulfate ABC transporter, permease protein CysW (cysW) COG4208P
msmeg_1448 4.06 integral membrane transporter COG0659P
msmeg_4557 4.09 ABC transporter, ATP-binding protein COG1120PH
msmeg_3602 4.10 ribose transport ATP-binding protein RbsA COG1129G
msmeg_3092 4.11 transcriptional regulator, sugar-binding family COG2390K
msmeg_3603 4.11 oxidoreductase, inc-binding dehydrogenase family COG1063ER
msmeg_5902 4.11 domain of unknown function superfamily COG0767Q
msmeg_1466 4.12 ribosomal protein L24 (rplX) COG0198J
msmeg_2503 4.14 lipoprotein, putative COG0715P
msmeg_3090 4.18 ribose transport system permease protein RbsC COG1172G
msmeg_6018 4.21 xylose transport system permease protein XylH COG4214G
msmeg_1467 4.23 50S ribosomal protein L5 COG0094J
msmeg_0520 4.23 porin X
msmeg_0075 4.24 conserved hypothetical protein X
msmeg_1470 4.29 50S ribosomal protein L6 COG0097J
msmeg_5483 4.31 porin X
msmeg_6229 4.31 glycerol kinase (glpK) X
msmeg_6057 4.32 MspD protein COG0554C
msmeg_0143 4.34 probable conserved mce associated membrane protein X
msmeg_1469 4.34 ribosomal protein S8 (rpsH) COG0096J
msmeg_0550 4.35 sulfonate binding protein COG0715P
msmeg_4301 4.37 acyl-CoA synthase COG2409R
msmeg_4532 4.38 sulfate ABC transporter, permease protein CysT (cysT) COG0555O
msmeg_0382 4.39 putative transport protein COG0318IQ
msmeg_6391 4.41 propionyl-CoA carboxylase beta chain COG0609P
msmeg_6450 4.41 hypothetical protein X
msmeg_4559 4.42 ABC transporter, membrane spanning protein COG4799I
msmeg_0381 4.42 Mmp14a protein COG2409R
msmeg_0079 4.45 hypothetical protein X
msmeg_1807 4.46 acetyl--propionyl-coenyme A carboxylase alpha chain COG4770I
msmeg_1443 4.47 ribosomal protein L16 (rplP) COG0197J
msmeg_0142 4.49 conserved hypothetical protein X
msmeg_6649 4.50 conserved hypothetical protein X
msmeg_6459 4.53 ferredoxin-dependent glutamate synthase 1 COG0069E
msmeg_0131 4.54 AMP-binding enzyme, putative COG0318IQ
msmeg_2534 4.56 putative carboxylesterase protein COG0596R
msmeg_5058 4.59 ABC transporter, ATP-binding protein SugC COG3839G
msmeg_2619 4.65 efflux protein COG2814G
msmeg_1741 4.65 TetR-family transcriptional regulator X
msmeg_3058 4.70 lipoprotein, nlpa family COG1464P
msmeg_1472 4.71 ribosomal protein S5 (rpsE) COG0098J
Appendix 184
msmeg_1442 4.72 ribosomal protein S3 (rpsC) COG0092J
msmeg_1436 4.74 ribosomal protein L3 (rplC) COG0087J
msmeg_3538 4.74 cyclopropane-fatty-acyl-phospholipid synthase 1 COG2230M
msmeg_1435 4.76 ribosomal protein S10 (rpsJ) COG0051J
msmeg_3095 4.77 D-ribose-binding periplasmic protein COG1879G
msmeg_0141 4.80 probable conserved mce associated transmembrane protein COG1714S
msmeg_0965 4.81 porin X
msmeg_2121 4.84 multiphosphoryl transfer protein (MTP) COG1080G
msmeg_1999 4.85 hypothetical protein X
msmeg_1444 4.85 ribosomal protein L29 (rpmC) COG0255J
msmeg_4210 4.86 secreted protein COG3181S
msmeg_0549 4.87 ABC transporter, permease protein COG0600P
msmeg_5816 4.88 conserved hypothetical protein COG3059S
msmeg_1471 4.88 ribosomal protein L18 (rplR) COG0256J
msmeg_1350 4.91 cyclopropane-fatty-acyl-phospholipid synthase 1 COG2230M
msmeg_0134 4.97 virulence factor Mce family protein COG1463Q
msmeg_1465 5.03 ribosomal protein L14 (rplN) COG0093J
msmeg_6760 5.11 conserved hypothetical protein COG3832S
msmeg_0084 5.12 phosphocarrier protein hpr COG1925G
msmeg_1437 5.12 ribosomal protein L4-L1 family (rplD) COG0088J
msmeg_1445 5.15 30S ribosomal protein S17 COG0186J
msmeg_0135 5.18 virulence factor Mce family protein COG1463Q
msmeg_5059 5.21 ABC transporter, permease protein SugB COG0395G
msmeg_1439 5.21 ribosomal protein L2 (rplB) COG0090J
msmeg_1468 5.28 ribosomal protein S14p-S29e (rpsN) COG0199J
msmeg_1438 5.39 ribosomal protein L23 (rplW) COG0089J
msmeg_1441 5.44 50S ribosomal protein L22 COG0091J
msmeg_1440 5.64 ribosomal protein S19 (rpsS) COG0185J
msmeg_5418 5.95 iron permease FTR1 COG0672P
msmeg_0133 6.02 ABC-transporter integral membrane protein COG0767Q
msmeg_6762 6.03 transcriptional regulator COG1777K
msmeg_5591 6.06 conserved hypothetical protein COG4195R
msmeg_0137 6.09 virulence factor mce family protein COG1463Q
msmeg_5412 6.12 immunogenic protein MPT63 X
msmeg_6392 6.23 polyketide synthase COG3321Q
msmeg_0085 6.39 PTS system, Fru family, IIABC components COG1299G
msmeg_1583 6.58 chaperonin GroL (groL) COG0459O
msmeg_6242 6.65 alcohol dehydrogenase, iron-containing COG1454C
msmeg_2535 6.74 dehydrogenase-reductase SDR family member 10 COG1028IQR
msmeg_0880 6.92 chaperonin GroL (groL) COG0459O
msmeg_0020 7.19 periplasmic binding protein COG0614P
msmeg_4326 7.50 acyl carrier protein (acpP) COG0236IQ
msmeg_5435 7.53 acyl-CoA synthase COG0318IQ
msmeg_4329 7.55 propionyl-CoA carboxylase beta chain COG4799I
msmeg_5420 7.77 Tat-translocated enzyme COG2837P
msmeg_1582 7.97 chaperonin GroS (groS) COG0234O
msmeg_4325 7.98 malonyl CoA-acyl carrier protein transacylase COG0331I
msmeg_1812 8.04 conserved hypothetical protein X
msmeg_4328 8.25 3-oxoacyl-[acyl-carrier-protein] synthase 2 COG0304IQ
msmeg_0530 8.35 short chain dehydrogenase COG1028IQR
msmeg_4757 9.08 fatty acid synthase COG4981I
msmeg_1813 9.18 propionyl-CoA carboxylase beta chain COG4799I
msmeg_4327 9.32 3-oxoacyl-[acyl-carrier-protein] synthase 1 COG0304IQ
msmeg_1810 9.98 hypothetical protein X
msmeg_1811 11.24 septum formation protein Maf (maf) COG0424D
Appendix 185
msmeg_5589 12.60 manganese transport protein MntH COG1914P
msmeg_5419 14.63 lipoprotein X
Tab. 10: List of all 284 genes with increased transcript levels in the M. smegmatis wild type strain SMR5 under nitrogen starvation. The msmeg_ gene numbers as well as the fold change of transcripts, an annotational description and the corresponding COG numbers are given. Data are sorted by the strength of fold change in an ascending manner.
Locus tag Fold change
Description COG number
msmeg_6612 3.01 ATPase, MoxR family (moxR) COG0714R
msmeg_5180 3.01 conserved hypothetical protein X
msmeg_2416 3.01 conserved hypothetical protein COG3599D
msmeg_0451 3.02 oxidoreductase, FAD-linked X
msmeg_6506 3.02 nicotinamidase-pyrainamidase COG1335Q
msmeg_0541 3.02 hypothetical protein X
msmeg_3561 3.04 glutamine synthetase, catalytic domain (glnA3) COG0174E
msmeg_3137 3.05 oxidoreductase COG1902C
msmeg_2113 3.05 hypothetical protein X
msmeg_1251 3.05 conserved hypothetical protein X
msmeg_2916 3.06 DNA-binding response regulator, PhoP family COG0745TK
msmeg_1312 3.06 hypothetical protein X
msmeg_5842 3.06 conserved hypothetical protein X
msmeg_1079 3.07 hypothetical protein X
msmeg_0755 3.07 cobalt-inc-cadmium resistance protein COG1230P
msmeg_3254 3.07 RDD family, putative X
msmeg_2112 3.07 secreted protein X
msmeg_2376 3.08 conserved hypothetical protein X
msmeg_2589 3.11 conserved hypothetical protein COG4954S
msmeg_1301 3.12 NanT3 COG2197TK
msmeg_5014 3.12 copper-translocating P-type ATPase COG2217P
msmeg_1883 3.12 glycine betaine transporter OpuD COG1292M
msmeg_3816 3.13 excinuclease ABC, B subunit (uvrB) COG0556L
msmeg_0171 3.13 histone deacetylase superfamily X
msmeg_0450 3.14 hypothetical protein X
msmeg_5308 3.18 conserved hypothetical protein COG3391S
msmeg_0267 3.20 esterase COG0657I
msmeg_2428 3.21 DNA-binding protein X
msmeg_4567 3.21 conserved hypothetical protein COG1305E
msmeg_0752 3.22 fructose-bisphosphate aldolase, class II (fbaA) COG0191G
msmeg_1552 3.22 ethanolamine permease (eat) COG1113E
msmeg_4546 3.23 oxidoreductase X
msmeg_4417 3.25 methionine-S-sulfoxide reductase (msrA) COG0225O
msmeg_3912 3.26 acetoacetyl-CoA reductase COG1028IQR
msmeg_5355 3.27 hypothetical protein X
msmeg_3372 3.28 transcriptional regulator, ArsR family COG0640K
msmeg_2960 3.28 preprotein translocase, YajC subunit (yajC) COG1862U
msmeg_5935 3.29 ATP-dependent DNA helicase COG0514L
msmeg_1755 3.29 anti-sigma factor, ChrR COG1917S
msmeg_4569 3.29 conserved hypothetical protein COG2307S
msmeg_3138 3.29 thioredoxin (trx) COG3118O
msmeg_0393 3.30 Fmt protein COG2226H
msmeg_1273 3.31 conserved hypothetical protein X
msmeg_2696 3.31 putative conserved membrane alanine rich protein X
msmeg_0223 3.32 conserved hypothetical protein X
Appendix 186
msmeg_6212 3.33 hemerythrin HHE cation binding domain subfamily, putative X
msmeg_5917 3.36 conserved hypothetical protein X
msmeg_5401 3.36 conserved hypothetical protein X
msmeg_6477 3.38 methionine-S-sulfoxide reductase (msrA) COG0225O
msmeg_0172 3.38 probable conserved transmembrane protein, putative X
msmeg_4171 3.38 ribose transport system permease protein RbsC COG1172G
msmeg_0850 3.38 conserved hypothetical protein X
msmeg_2115 3.39 conserved hypothetical protein X
msmeg_5647 3.41 conserved hypothetical protein X
msmeg_3417 3.41 conserved hypothetical protein X
msmeg_1501 3.42 methyltransferase, putative, family COG3315Q
msmeg_6616 3.44 S-(hydroxymethyl)glutathione dehydrogenase COG1063ER
msmeg_0222 3.45 conserved hypothetical protein X
msmeg_1802 3.46 ChaB protein X
msmeg_6659 3.47 hypothetical protein X
msmeg_2187 3.47 urea amidolyase COG1984E
msmeg_6416 3.51 phosphoglycerate mutase family protein COG0406G
msmeg_0051 3.52 transcription factor WhiB family X
msmeg_3289 3.57 gp61 protein COG0596R
msmeg_1097 3.58 glycosyl transferase, group 2 family protein COG1215M
msmeg_6879 3.59 ABC-type Nat permease for neutral amino acids NatD COG0559E
msmeg_4465 3.59 cutinase X
msmeg_6876 3.60 branched chain amino acid transport ATP-binding protein COG0410E
msmeg_2913 3.65 hydrolase COG0596R
msmeg_1595 3.65 putative oxidoreductase COG4221R
msmeg_1769 3.68 UsfY protein X
msmeg_3661 3.69 conserved hypothetical protein X
msmeg_6878 3.70 inner-membrane translocator COG4177E
msmeg_6727 3.72 amino acid permease-associated region COG0531E
msmeg_4456 3.74 conserved hypothetical protein COG2128S
msmeg_4294 3.75 glutamine synthetase, type I (glnA2) COG0174E
msmeg_6332 3.75 amino acid ABC transporter, permease protein COG1174E
msmeg_6880 3.76 hydrophobic amino acid ABC transporter, putative COG0683E
msmeg_0637 3.78 iron-sulfur binding oxidoreductase COG0665E
msmeg_0585 3.79 L-carnitine dehydratase-bile acid-inducible protein F COG1804C
msmeg_1762 3.79 piperideine-6-carboxylic acid dehydrogenase COG1012C
msmeg_3022 3.80 transglycosylase associated protein X
msmeg_1090 3.82 amidase COG0154J
msmeg_2925 3.84 permease membrane component COG1174E
msmeg_1151 3.85 DNA-binding protein COG1396K
msmeg_1605 3.85 phosphate transport system regulatory protein PhoU (phoU) COG0704P
msmeg_0074 3.88 IS1549, transposase COG0123BQ
msmeg_1089 3.89 hypothetical protein X
msmeg_3862 3.91 FxsA cytoplasmic membrane protein X
msmeg_6213 3.91 Manganese containing catalase COG3546P
msmeg_6877 3.94 branched-chain amino acid transporter, ATP-binding protein COG0411E
msmeg_5484 3.96 conserved hypothetical protein X
msmeg_1698 3.96 putative ammonia monooxygenase superfamily COG3180R
msmeg_0911 3.97 isocitrate lyase (aceA) COG2224C
msmeg_3564 3.99 bacterioferritin (bfr) COG2193P
msmeg_3419 3.99 hypothetical protein X
msmeg_6254 4.01 hypothetical protein X
msmeg_2659 4.01 alanine dehydrogenase (ald) COG0686E
msmeg_4382 4.02 dehydrogenase-reductase SDR family member 10 COG1028IQR
msmeg_5078 4.04 glucose-1-phosphate adenylyltransferase (glgC) COG0448G
Appendix 187
msmeg_4570 4.04 conserved hypothetical protein COG2308S
msmeg_1292 4.04 FAD binding domain in molybdopterin dehydrogenase protein COG1319C
msmeg_5334 4.05 conserved hypothetical protein X
msmeg_0072 4.06 IS1549, transposase, interruption-C COG5421L
msmeg_1991 4.10 isovaleryl-CoA dehydrogenase COG1960I
msmeg_1088 4.13 glutamyl-tRNA(Gln)-aspartyl-tRNA (Asn) amidotransferase COG0154J
msmeg_1411 4.15 universal stress protein family COG0589T
msmeg_3902 4.16 ATPase, AAA family COG0464O
msmeg_2756 4.16 conserved hypothetical protein X
msmeg_2343 4.16 methylesterase COG4638PR
msmeg_6355 4.17 hypothetical protein X
msmeg_1787 4.18 RsbW protein X
msmeg_5542 4.22 transcriptional regulator, HTH_3 family COG1476K
msmeg_6480 4.23 putative transcriptional regulatory protein COG1309K
msmeg_5682 4.24 conserved hypothetical protein X
msmeg_1768 4.27 conserved hypothetical protein COG0655R
msmeg_3439 4.27 hypothetical protein X
msmeg_5646 4.28 conserved hypothetical protein X
msmeg_5016 4.29 conserved domain protein COG2608P
msmeg_5764 4.30 putative cyanamide hydratase X
msmeg_6354 4.33 serine esterase, cutinase family COG0400R
msmeg_0231 4.33 conserved hypothetical protein COG0011S
msmeg_2755 4.38 conserved hypothetical protein COG1295S
msmeg_4073 4.39 DNA-binding protein X
msmeg_6733 4.42 hydrolase, carbon-nitrogen family COG0388R
msmeg_3471 4.44 GTP cyclohydrolase COG0807H
msmeg_1773 4.49 conserved hypothetical protein X
msmeg_1412 4.50 amino acid permease COG0531E
msmeg_1530 4.51 integral membrane protein COG5006R
msmeg_5333 4.56 hypothetical protein X
msmeg_6874 4.63 aldehyde dehydrogenase COG1012C
msmeg_5374 4.66 glutamate--ammonia ligase COG0174E
msmeg_4499 4.67 hypothetical protein X
msmeg_3722 4.67 bifunctional coenyme PQQ synthesis protein C-D X
msmeg_1296 4.70 uricase COG3648Q
msmeg_5327 4.72 hypothetical protein X
msmeg_5648 4.73 hypothetical protein X
msmeg_4765 4.80 transcriptional regulator, MerR family COG0789K
msmeg_0230 4.80 conserved hypothetical protein COG1937S
msmeg_1771 4.82 methylase, putative COG2890J
msmeg_6467 4.85 starvation-induced DNA protecting protein COG0783P
msmeg_1791 4.90 UsfY protein X
msmeg_5331 4.91 UDP-glucoronosyl and UDP-glucosyl transferase family X
msmeg_5402 4.92 dehydrogenase DhgA COG0300R
msmeg_4542 4.93 oligopeptide transport integral membrane protein COG1173EP
msmeg_3255 5.00 DoxX subfamily, putative COG2259S
msmeg_1950 5.01 conserved hypothetical protein X
msmeg_1767 5.08 conserved hypothetical protein X
msmeg_1508 5.15 amino acid permease-associated region COG0531E
msmeg_1032 5.18 hypothetical protein X
msmeg_5617 5.24 immunogenic protein MPT63 X
msmeg_5558 5.27 hypothetical protein X
msmeg_0429 5.31 putative ferric uptake regulator X
msmeg_5375 5.32 GntR-family transcriptional regulator COG2186K
msmeg_1085 5.33 dipeptide transport system permease protein DppB COG0601EP
Appendix 188
msmeg_1134 5.38 putative protease HtpX COG0501O
msmeg_0566 5.44 aliphatic amidase COG0388R
msmeg_6264 5.44 putative oxidoreductase COG0665E
msmeg_2569 5.48 oxidoreductase, 2OG-Fe(II) oxygenase family COG3491R
msmeg_2695 5.52 35 kDa protein COG1842KT
msmeg_1295 5.54 transthyretin COG2351R
msmeg_5341 5.56 dipeptidyl aminopeptidase-acylaminoacyl peptidase COG2267I
msmeg_1789 5.58 conserved hypothetical protein X
msmeg_1786 5.67 stas domain, putative COG1366T
msmeg_1774 5.71 conserved hypothetical protein X
msmeg_2523 5.81 efflux ABC transporter, permease protein, putative X
msmeg_4989 5.94 sensor histidine kinase COG0642T
msmeg_2798 5.95 hypothetical protein COG1380R
msmeg_6223 5.97 TetR family transcriptional repressor LfrR X
msmeg_6478 6.02 putative cytochrome P450 135B1 COG2124Q
msmeg_1788 6.09 conserved hypothetical protein X
msmeg_1772 6.12 conserved hypothetical protein X
msmeg_5275 6.15 permease of the major facilitator superfamily COG4760S
msmeg_4298 6.16 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) COG0413H
msmeg_6579 6.19 conserved hypothetical protein X
msmeg_5071 6.25 conserved hypothetical protein X
msmeg_5729 6.25 hydantoin racemase COG4126E
msmeg_1234 6.26 taurine import ATP-binding protein TauB COG1116P
msmeg_1794 6.38 dehydrogenase COG2141C
msmeg_5072 6.40 extracytoplasmic function alternative sigma factor COG1595K
msmeg_1052 6.44 amino acid carrier protein COG1115E
msmeg_3371 6.45 short-chain dehydrogenase-reductase SDR X
msmeg_0436 6.68 allophanate hydrolase subunit 1 COG2049E
msmeg_1766 6.76 conserved hypothetical protein X
msmeg_4290 6.85 glutamine synthetase, type I (glnA) COG0174E
msmeg_6507 6.89 glycogen debranching enzyme GlgX (glgX) COG1523G
msmeg_1131 6.94 tryptophan-rich sensory protein COG3476T
msmeg_4381 6.94 amidase COG2421C
msmeg_2751 7.05 hypothetical protein X
msmeg_1792 7.06 conserved hypothetical protein X
msmeg_3403 7.10 formamidase COG0388R
msmeg_1076 7.12 lipoprotein, putative X
msmeg_1990 7.48 conserved hypothetical protein X
msmeg_6881 7.49 transcriptional regulator, GntR family COG1802K
msmeg_5485 7.50 molybdopterin biosynthesis protein COG0521H
msmeg_5015 7.51 secreted protein X
msmeg_6263 7.60 glutamate synthase family protein COG0069E
msmeg_0434 7.70 aminoglycoside 2-N-acetyltransferase (AAC(2)-Id) X
msmeg_0778 7.81 putative transcriptional regulator COG2188K
msmeg_6225 7.89 proton antiporter efflux pump COG2271G
msmeg_2748 7.96 soluble pyridine nucleotide transhydrogenase (sthA) COG1249C
msmeg_0780 7.99 phosphotransferase enzyme family protein COG2334R
msmeg_6116 8.21 conserved hypothetical protein COG3195S
msmeg_3402 8.33 cytosine permease, putative COG1457F
msmeg_0435 8.36 allophanate hydrolase subunit 2 COG1984E
msmeg_6660 8.37 permease, cytosine-purines, uracil, thiamine, allantoin family COG1457F
msmeg_2694 8.40 transcriptional regulator, XRE family X
msmeg_2752 8.63 sigma factor SigB COG0568K
msmeg_1951 8.68 conserved domain protein X
msmeg_1031 8.71 conserved hypothetical protein COG3631R
Appendix 189
msmeg_2157 8.77 hypothetical protein X
msmeg_5356 9.03 hypothetical protein X
msmeg_1030 9.06 monooxygenase COG2072P
msmeg_1596 9.09 transcriptional regulator COG1309K
msmeg_2525 9.58 amino acid permease superfamily COG0531E
msmeg_6115 9.65 phosphoglycerate dehydrogenase COG0111HE
msmeg_5083 9.80 conserved hypothetical protein X
msmeg_6817 9.97 RNA polymerase sigma factor, sigma-70 family COG1595K
msmeg_6262 10.48 FwdC-FmdC family protein COG0070E
msmeg_1790 10.58 conserved hypothetical protein X
msmeg_2159 10.65 conserved hypothetical protein COG3220S
msmeg_4990 10.73 DNA-binding response regulator COG0745TK
msmeg_2978 10.88 ABC transporter ATP-binding protein COG0410E
msmeg_1086 11.03 ABC transporter permease protein COG1173EP
msmeg_2981 11.22 branched-chain amino acid ABC-type transport system COG0559E
msmeg_1415 11.30 AsnC-family transcriptional regulator COG1522K
msmeg_1770 11.53 conserved hypothetical protein X
msmeg_1293 11.94 xanthine-uracil permeases family protein COG2233F
msmeg_1764 11.97 L-lysine-epsilon aminotransferase COG0160E
msmeg_2185 12.49 conserved hypothetical protein COG3665S
msmeg_3400 13.26 glutamyl-tRNA (Gln) amidotransferase subunit A COG0154J
msmeg_1185 14.14 transcriptional regulator, AsnC family COG1522K
msmeg_2980 14.39 putative membrane protein COG4177E
msmeg_0586 14.47 stas domain, putative X
msmeg_5486 14.84 peptidase S1 and S6, chymotrypsin-Hap COG0265O
msmeg_4206 15.10 Molybdopterin oxidoreductase X
msmeg_3401 15.18 LamB-YcsF family protein COG1540R
msmeg_6259 15.21 ammonium transporter (amt1) COG0004P
msmeg_1101 15.80 hypothetical protein X
msmeg_6261 16.46 glutamine amidotransferase, class II COG0067E
msmeg_2979 16.59 ABC transporter ATP-binding protein COG4674R
msmeg_1597 16.64 Transcription factor WhiB X
msmeg_1087 16.86 oligopeptide ABC transporter ATP-binding protein X
msmeg_2427 16.95 protein PII uridylyltransferase (glnD) COG2844O
msmeg_0572 18.21 conserved hypothetical protein X
msmeg_4637 19.71 conserved hypothetical protein X
msmeg_4635 19.87 ammonium transporter family protein (amtA) COG0004P
msmeg_5344 21.36 hypothetical protein X
msmeg_1413 21.40 ornithine--oxo-acid transaminase (rocD) COG4992E
msmeg_5358 21.65 acetamidase-formamidase family COG2421C
msmeg_0781 21.68 amino acid permease COG0531E
msmeg_5342 21.72 conserved hypothetical protein X
msmeg_4501 21.94 sodium:dicarboxylate symporter COG1301C
msmeg_6735 21.95 amino acid permease, putative COG0531E
msmeg_5359 23.33 cyanate hydratase (cynS) COG1513P
msmeg_1184 24.13 serine esterase, cutinase family X
msmeg_4636 24.53 hypothetical protein X
msmeg_5343 24.71 conserved hypothetical protein X
msmeg_5084 24.96 glycosyl transferase, group 2 family protein COG0463M
msmeg_2524 24.97 ABC transporter, ATP-binding protein COG1136V
msmeg_2522 25.50 efflux ABC transporter, permease protein X
msmeg_0569 27.14 flavoprotein involved in K+ transport COG2072P
msmeg_4638 27.62 vanillate O-demethylase oxidoreductase COG1018C
msmeg_2186 27.93 conserved hypothetical protein COG3665S
msmeg_5765 28.31 globin COG2346R
Appendix 190
msmeg_2425 29.43 ammonium transporter (amtB) COG0004P
msmeg_6816 30.09 molybdopterin oxidoreductase COG0243C
msmeg_6260 30.44 glutamine synthetase, type III (glnT) COG0174E
msmeg_0432 31.62 uroporphyrinogen-III synthetase COG1587H
msmeg_2426 31.84 nitrogen regulatory protein PII (glnK) COG0347E
msmeg_5730 33.27 permease for cytosine-purines, uracil, thiamine, allantoin COG1953FH
msmeg_0779 33.83 short-chain dehydrogenase-reductase SDR COG1028IQR
msmeg_2982 35.17 putative periplasmic binding protein COG0683E
msmeg_1082 37.64 putative response regulator COG2197TK
msmeg_0428 37.81 nitrite reductase [NAD(P)H] small subunit (nirD) COG2146PR
msmeg_1987 41.10 conserved hypothetical protein COG4766E
msmeg_6734 44.58 dibenothiophene desulfuriation enyme A COG2141C
msmeg_1084 48.16 peptide-opine-nickel uptake family ABC transporter COG0747E
msmeg_0427 49.99 nitrite reductase [NAD(P)H], large subunit (nirB) COG1251C
msmeg_5329 51.18 conserved hypothetical protein COG2119S
msmeg_0571 54.10 hydrolase, carbon-nitrogen family COG0388R
msmeg_0433 60.20 nitrite extrusion protein (narK3) COG2223P
msmeg_2526 66.11 copper methylamine oxidase COG3733Q
msmeg_1414 98.67 amidinotransferase COG1834E
Tab. 11: List of all 6 M. smegmatis genes that showed increased transcript levels (factor higher than 3) in the glnR deletion strain MH1 compared to the wild type SMR5 under nitrogen starvation. The msmeg_ gene numbers as well as the fold change of transcripts, an annotational description and the corresponding COG numbers are given. Data are sorted by the strength of fold change in an ascending manner.
Locus tag Fold change
Description COG number
msmeg_6498 3.96 hypothetical protein X
msmeg_2274 4.24 hydrogenase assembly chaperone HypC-HupF (hypC) COG0298O
msmeg_2275 4.37 hydrogenase expression-formation protein HypD (hypD) COG0409O
msmeg_1738 4.46 probable conserved transmembrane protein X
msmeg_3680 4.61 hypothetical protein X
msmeg_1999 10.08 hypothetical protein X
Table 12: List of all 125 M. smegmatis genes that showed decreased transcript levels by a factor higher than 3 in the glnR deletion strain MH1 compared to the wild type SMR5 under nitrogen starvation. The msmeg_ gene numbers as well as the fold change of transcripts, an annotational description and the corresponding COG numbers are given. Data are sorted by the strength of fold change in an ascending manner.
Locus tag Fold change
Description COG number
msmeg_3358 3.02 YaeQ protein COG4681S
msmeg_4965 3.07 hypothetical protein X
msmeg_6507 3.07 glycogen debranching enzyme GlgX (glgX) COG1523G
msmeg_1792 3.12 conserved hypothetical protein X
msmeg_4567 3.14 conserved hypothetical protein COG1305E
msmeg_4382 3.15 dehydrogenase-reductase SDR family member 10 COG1028IQR
msmeg_4011 3.26 putative pyrimidine permease RutG COG2233F
msmeg_2116 3.33 PTS system, glucose-specific IIBC component COG1263G
msmeg_4570 3.34 conserved hypothetical protein COG2308S
msmeg_2187 3.36 urea amidolyase COG1984E
msmeg_4569 3.48 conserved hypothetical protein COG2307S
msmeg_1292 3.48 FAD binding domain in molybdopterin dehydrogenase protein COG1319C
Appendix 191
msmeg_4171 3.58 ribose transport system permease protein RbsC COG1172G
msmeg_3994 3.64 short chain dehydrogenase COG0300R
msmeg_5648 3.68 hypothetical protein X
msmeg_2189 3.68 allophanate hydrolase (atF) COG0154J
msmeg_0393 3.73 Fmt protein COG2226H
msmeg_1153 3.73 FAD dependent oxidoreductase X
msmeg_6659 3.74 hypothetical protein X
msmeg_6332 3.79 amino acid ABC transporter, permease protein COG1174E
msmeg_3626 3.89 urease, beta subunit (ureB) COG0832E
msmeg_5083 4.00 conserved hypothetical protein X
msmeg_1152 4.01 citrate-proton symporter COG2814G
msmeg_5331 4.04 UDP-glucoronosyl and UDP-glucosyl transferase family X
msmeg_1151 4.08 DNA-binding protein COG1396K
msmeg_5783 4.10 acetyltransferase, GNAT family X
msmeg_1155 4.16 carnitinyl-CoA dehydratase COG1024I
msmeg_1157 4.17 short chain dehydrogenase COG0300R
msmeg_3912 4.20 acetoacetyl-CoA reductase COG1028IQR
msmeg_0565 4.33 putative glycosyl transferases group 1 COG0438M
msmeg_1184 4.40 serine esterase, cutinase family X
msmeg_1156 4.44 dihydrodipicolinate synthetase COG0329EM
msmeg_1185 4.46 transcriptional regulator, AsnC family COG1522K
msmeg_1089 4.61 hypothetical protein X
msmeg_1088 4.63 glutamyl-tRNA(Gln)-aspartyl-tRNA(Asn) amidotransferase COG0154J
msmeg_0505 4.72 probable sugar ABC transporter, substrate-binding protein COG1653G
msmeg_6880 4.92 hydrophobic amino acid ABC transporter, putative COG0683E
msmeg_6879 4.97 Nat permease for neutral amino acids NatD COG0559E
msmeg_3722 5.04 bifunctional coenyme PQQ synthesis protein C-D X
msmeg_1596 5.05 transcriptional regulator COG1309K
msmeg_6264 5.06 putative oxidoreductase COG0665E
msmeg_2523 5.11 efflux ABC transporter, permease protein, putative X
msmeg_4381 5.14 amidase COG2421C
msmeg_1090 5.24 amidase COG0154J
msmeg_1508 5.54 amino acid permease-associated region COG0531E
msmeg_5729 5.75 hydantoin racemase COG4126E
msmeg_6733 6.32 hydrolase, carbon-nitrogen family COG0388R
msmeg_2748 6.36 soluble pyridine nucleotide transhydrogenase (sthA) COG1249C
msmeg_1085 6.41 dipeptide transport system permease protein DppB COG0601EP
msmeg_2569 6.61 oxidoreductase, 2OG-Fe(II) oxygenase family COG3491R
msmeg_0429 6.64 putative ferric uptake regulator X
msmeg_6878 6.97 inner-membrane translocator COG4177E
msmeg_6263 7.01 glutamate synthase family protein COG0069E
msmeg_6262 7.40 FwdC-FmdC family protein COG0070E
msmeg_1295 7.42 transthyretin COG2351R
msmeg_3402 7.82 cytosine permease, putative COG1457F
msmeg_5356 8.15 hypothetical protein X
msmeg_1296 8.73 uricase COG3648Q
msmeg_0780 8.79 phosphotransferase enzyme family protein COG2334R
msmeg_6877 8.90 branched-chain amino acid transporter, ATP-binding protein COG0411E
msmeg_0566 8.94 aliphatic amidase COG0388R
msmeg_3403 9.26 formamidase COG0388R
msmeg_1990 9.45 conserved hypothetical protein X
msmeg_1086 9.94 ABC transporter permease protein COG1173EP
msmeg_0778 10.22 putative transcriptional regulator COG2188K
msmeg_6261 10.36 glutamine amidotransferase, class II COG0067E
msmeg_6660 10.75 permease, cytosine-purines, uracil, thiamine, allantoin family COG1457F
Appendix 192
msmeg_6817 11.34 RNA polymerase sigma factor, sigma-70 family COG1595K
msmeg_1052 11.63 amino acid carrier protein COG1115E
msmeg_6259 11.67 ammonium transporter (amt1) COG0004P
msmeg_6881 11.75 transcriptional regulator, GntR family COG1802K
msmeg_2185 12.81 conserved hypothetical protein COG3665S
msmeg_2525 14.19 amino acid permease superfamily COG0531E
msmeg_1293 14.73 xanthine-uracil permeases family protein COG2233F
msmeg_2978 15.78 ABC transporter ATP-binding protein COG0410E
msmeg_6260 16.11 glutamine synthetase, type III (glnT) COG0174E
msmeg_4206 16.44 molybdopterin oxidoreductase X
msmeg_3400 17.66 glutamyl-tRNA(Gln) amidotransferase subunit A COG0154J
msmeg_0572 17.72 conserved hypothetical protein X
msmeg_2427 18.22 protein PII uridylyltransferase (glnD) COG2844O
msmeg_4637 18.43 conserved hypothetical protein X
msmeg_3401 18.68 LamB-YcsF family protein COG1540R
msmeg_1988 18.75 conserved hypothetical protein X
msmeg_1597 18.80 Transcription factor WhiB X
msmeg_2979 18.88 ABC transporter ATP-binding protein COG4674R
msmeg_2981 19.17 branched-chain amino acid ABC-type transport system COG0559E
msmeg_6115 19.21 phosphoglycerate dehydrogenase COG0111HE
msmeg_6735 19.26 amino acid permease, putative COG0531E
msmeg_1087 19.33 oligopeptide ABC transporter ATP-binding protein X
msmeg_6116 19.89 conserved hypothetical protein COG3195S
msmeg_5084 20.59 glycosyl transferase, group 2 family protein COG0463M
msmeg_5359 21.35 cyanate hydratase (cynS) COG1513P
msmeg_5360 22.01 formate-nitrate transporter COG2116P
msmeg_4501 22.33 sodium:dicarboxylate symporter COG1301C
msmeg_4635 22.90 ammonium transporter family protein (amtA) COG0004P
msmeg_2980 23.33 putative membrane protein COG4177E
msmeg_2524 24.34 ABC transporter, ATP-binding protein COG1136V
msmeg_2522 24.38 efflux ABC transporter, permease protein X
msmeg_5358 25.10 acetamidase-Formamidase family COG2421C
msmeg_4294 26.01 glutamine synthetase, type I (glnA2) COG0174E
msmeg_5765 29.55 globin COG2346R
msmeg_4638 30.14 vanillate O-demethylase oxidoreductase COG1018C
msmeg_4636 31.81 hypothetical protein X
msmeg_2186 32.35 conserved hypothetical protein COG3665S
msmeg_0570 32.58 conserved hypothetical protein X
msmeg_6816 33.03 molybdopterin oxidoreductase COG0243C
msmeg_0432 34.03 uroporphyrinogen-III synthetase COG1587H
msmeg_4290 34.13 glutamine synthetase, type I (glnA) COG0174E
msmeg_0569 34.95 flavoprotein involved in K+ transport COG2072P
msmeg_0779 35.16 short-chain dehydrogenase-reductase SDR COG1028IQR
msmeg_0781 36.20 amino acid permease COG0531E
msmeg_1987 42.51 conserved hypothetical protein COG4766E
msmeg_5730 45.31 permease for cytosine-purines, uracil, thiamine, allantoin COG1953FH
msmeg_1082 47.68 putative response regulator COG2197TK
msmeg_0571 48.04 hydrolase, carbon-nitrogen family COG0388R
msmeg_2184 48.27 amino acid permease COG0531E
msmeg_0428 48.97 nitrite reductase [NAD(P)H] small subunit (nirD) COG2146PR
msmeg_2426 51.56 nitrogen regulatory protein PII (glnK) COG0347E
msmeg_1084 51.81 peptide-opine-nickel uptake family ABC transporter COG0747E
msmeg_0427 52.06 nitrite reductase [NAD(P)H], large subunit (nirB) COG1251C
msmeg_0433 54.53 nitrite extrusion protein (narK3) COG2223P
msmeg_2425 56.21 ammonium transporter (amtB) COG0004P
Appendix 193
msmeg_6734 62.84 dibenothiophene desulfuriation enzyme A COG2141C
msmeg_2526 66.62 copper methylamine oxidase COG3733Q
msmeg_2982 136.17 putative periplasmic binding protein (urtA) COG0683E
Tab. 13: List of two genes with increased transcript levels in M. smegmatis ΔamtR compared to the wild type under nitrogen starvation. The msmeg_ gene numbers as well as the fold change of transcripts, an annotational description and the corresponding COG numbers are given.
Locus tag Fold change
Description COG number
msmeg_2188 2.35 integral membrane protein X
msmeg_2187 3.91 urea amidolyase COG1984E
7.3 Putative sensor histidine kinases activating GlnR
In a bioinformatic search for sensor histidine kinases able to phosphorylate and thus activate
GlnR, 22 putative candidates have been found (Amon, 2010). Criteria were appearance in
every genome with a GlnR homolog, no appearance in corynebacterial genomes and an
orphan location in the genome. Results of this approach are shown in table 14.
Tab. 14: List of all 22 sensor histidine kinases putatively interacting with GlnR found in a bioinformatic approach. Given are the predicted open reading frames with their corresponding annotation number for the respective genome and their identity in percentage according to BLASTP results. On the right, the putative role based on literature research and homology searches is given. n/a: not available. Adapted from Amon (2010).
M. smegmatis other mycobacteria
N. farcinica streptomycetes corynebacteria putative role
msmeg_5158 n/a NFA17980 (69%)
SCO1217 (49%)
SAV7118 (50%)
n/a LytS (regulation of cell autolysis)
msmeg_2793 yes (all) NFA6630 (46%)
n/a n/a PrrB
(mult. copies) msmeg_5663
msmeg_0246
msmeg_5304 n/a NFA46340 (54%)
SCO5435 (48%)
SAV2816 (47%)
CG0089 (33%) CitA regulating citrate/malate metabolism ?
msmeg_3239
(no orphan)
MAP_3274 (65%)
NFA54920 (48%)
SCO2121 (38%)
SAV6081 (39%)
n/a msmeg_3240 LuxR-type regulator, conserved across species…
Appendix 194
msmeg_5870 yes (all except ML)
NFA5450 (54%)
SAV4197 (46%) SCO4021 (49%)
CG2887 (44%) [JK0342 (48%), DIP1935 (45%), CE2493 (41%)]
PhoR ribonucleotide biosynthesis (mult. copies)
msmeg_4989
msmeg_0106
(no orphan)
yes (all except ML)
n/a SCO1369 (33%) CG2201 28% ?
msmeg_6864 n/a NFA12320 (32%)
SCO7562 (35%) CG3388 25% ?
msmeg_2248 n/a n/a n/a n/a ?
msmeg_4307 yes (all) NFA16340 (64%)
n/a CG2457 (49%) DIP1680 (53%), JK0667 (51%), CE2135 (50%)
?
msmeg_4211
no orphan, cit?
n/a n/a SCO1137 (43%) n/a similar msmeg_5304
msmeg_1918 yes (all) NFA45810 (64%)
SCO5239 (46%) SAV3017 (46%)
n/a ? (VERY good candidate)
msmeg_2915
(no orphan!)
yes (all except ML)
n/a … … similar to msmeg_4989 /5870…
msmeg_0980
(no orphan)
n/a n/a … … similar to msmeg_2248
msmeg_3448
(no orphan)
msmeg_2804
(no orphan)
msmeg_5241 yes (all except ML)
NFA28940 (63% BLASTN)
SCO0203 (61%)
SAV4257 (59%)
n/a “GAF family protein”; orphan, also very good candidate
msmeg_0854 n/a NFA7820 SCO6163/6424/5784 n/a
msmeg_1493 (no orphan)
n/a n/a n/a n/a
msmeg_4968 (no orphan)
n/a n/a SCO4597/4598 n/a
msmeg_0936
no orphan!
Rv0490 (all) NFA51870 SCO4229/sav3973 cg0483/ce0424 “SenX3”
Appendix 195
7.4 Abbreviations and units
A adenine
ACP* acetyl [32P] phosphate
ADP adenosine diphosphate
AMP adenosine monophosphate
AmpR resistance to ampicillin
APS ammonium peroxodisulfate
ATCC american type culture collection
ATP adenosine triphosphate
BCIP 5-bromo-4-chloro-3-indolyl phosphate toluidine salt
BSA bovine serum albumine
C cytosine
CamR resistance to chloramphenicol
CIP calf intestine phosphatase
CM cytoplasmic membrane
CMN corynebacteria, mycobacteria, nocardia
COG cluster of orthologous groups
CSPD disodium 3-(4-methoxyspiro {1,2-dioxetane-3,2´-(5´-chloro)tricyclo
[3.3.1.13´7]decan}-4-yl)phenylphosphate
CTAB cetyl trimethyl ammonium bromide
ddUTP dideoxyuridine triphosphate
DIG digoxigenin
DMSO dimethyl sulfoxide
DNA deoxyribonucleic acid
dNTP deoxynucleotide triphosphate
DSM(Z) Deutsche Sammlung von Mikroorganismen (und Zellkulturen)
DTT dithiothreitol
e.g. for example
EDTA ethylendiaminetetraacetic acid
Fig. figure
FRT Flpe recognition target
et al. et alii
G guanine
g 9.81 m s-2
G3PDH glyceraldehyde 3-phosphate dehydrogenase
GDH glutamate dehydrogenase
GFP green fluorescent protein
GOGAT glutamate synthase (glutamine:oxoglutarate-aminotransferase)
GS glutamine synthetase
HABA 2-(4-hydroxyphenylazo)benzoic acid
Appendix 196
i.e. that is
IPTG isopropyl β-D-1-thiogalactopyranoside
KanR resistance to kanamycin
MALDI-ToF-MS matrix-assisted laser desorption/ionisation time-of-flight mass
spectrometry
MBP maltose binding protein
MOM mycobacterial outer membrane
MOPS 3-morpholinopropane-1-sulfonic acid
MOTT mycobacteria other than tuberculosis
MSX L-methionine-DL-sulfoximine
+N nitrogen surplus
-N nitrogen starvation
NAD(P)H nicotinamide adenine (phosphate) dinucleotide
NBT 4-nitro blue tetrazolium chloride
NCTC national collection of type cultures
oD600 optical density at 600 nm
ONPG ortho-nitrophenyl-β-D-galactopyranoside
ORF open reading frame
PAA polyacrylamide
PAGE polyacrylamide gel electrophoresis
PBS phosphate buffered saline
PCR polymerase chain reaction
RNA ribonucleic acid
RT reverse transcriptase
SDS sodium dodecylsulphate
SSC sodium chloride/sodium citrate
StrR resistance to streptomycin
t time
T thymine
Tab. table
TAE tris acetate EDTA
TBE tris boric acid EDTA
TBS tris buffered saline
TE tris EDTA
TEN tris EDTA sodium chloride
TEMED N,N,N’,N’-tetramethyl-ethylendiamine
TKMD tris, potassium chloride, magnesium chloride, DTT
TMAO trimethylamine N-oxide
Tris 2-amino-hydroxymethylpropane-1,3-diol
TSS transformation and storage solution
UMP uridine monohosphate
UTP uridine triphosphate
Appendix 197
UV ultraviolet
v/v volume per volume
w/v Units
weight per volume
A Ampère
°C degree Celsius
bar unit of pressure
bp base pairs
Da Dalton
F Farad
g gram
kb kilo base pairs
l liter
m meter
M molar
min minutes
mol chemical amount
Ω Ohm
rpm rounds per minute
s seconds
U unit
V volt
Prefixes
k kilo
m milli
µ micro
n nano
p pico
Appendix 198
Amino acid nomenclature (IUPAC-IUB, 1969)
A Ala alanine
C Cys cysteine
D Asp aspartate
E Glu glutamate
F Phe phenylalanine
G Gly glycine
H His histidine
I Ile isoleucine
K Lys lysine
L Leu leucine
M Met methionine
N Asn asparagine
P Pro proline
Q Gln glutamine
R Arg arginine
S Ser serine
T Thr threonine
V Val valine
W Trp tryptophane
Y Typ tyrosine
Appendix 199
7.5 Publications
Amon, J., Bräu, T., Grimrath, A., Hasselt, K., Hänßler, E., Höller, M., Jeßberger, N., Ott, L., Szököl, J., Titgemeyer, F. & Burkovski, A. (2008). Nitrogen control in Mycobacterium smegmatis: nitrogen-dependent expression of ammonium transport and assimilation proteins depends on OmpR-type regulator GlnR. J. Bacteriol. 21, 7108-7116.
Muhl, D., Jeßberger, N., Hasselt, K., Jardin, C., Sticht, H. & Burkovski, A. (2009). DNA binding by Corynebacterium glutamicum TetR-type transcription regulator AmtR. BMC Mol. Biol. 10, 37.
Jeßberger, N., Lu, Y., Amon, J., Niederweis, M., Titgemeyer, F., Sonnewald, S., Reid, S. & Burkovski, A. (2011). The GlnR-dependent nitrogen regulatory network of Mycobacterium smegmatis. Mol. Microbiol. Submitted.