2011 Hydra-Sports Owner's Manual (1)

World HeadquartersMasterCraft Boat Company100 Cherokee Cove DriveVonore TN 37885 U.S.A.

423•884•2221423•884•2295 fax

www.mastercraft.com

prostar

maristar

x-series

saltwater series

2010 mastercraft owner’s manual

W E L C O M E A B O A R D !

Congratulations on your boating choice! You are now the proud owner of a new Hydra-Sports boat. By following the recommendations in this Owner’s Manual, you can expect many years of boating enjoy-ment ahead. Please take a few minutes to read this Owner’s Manual completely in addition to carefully reviewing any additional information provided in the accompa-nying packet. These publications will help to answer most of the remaining questions you may have regard-ing the boat. If you have any additional questions af-ter reading these publications, please feel free to speak with your dealer. Hydra-Sports wants you to feel com-fortable with your boat from the very beginning of your experience as an owner of our products. All information in this Owner’s Manual is based on the latest product information available at the time of printing. Because of our policy of continuous product improvement, we reserve the right to make changes at any time, without notice, in specifications and models, and also to discontinue models. We also reserve the right to change specifications, parts or ac-cessories at any time without incurring any obliga-tion to install the same parts or accessories on models manufactured before the date of the change. Hydra-Sports recommends checking www.hydra-sports.com periodically for updates and additional information. Due to changes in specifications, models, parts and/or accessories that may occur after publication

of this Owner’s Manual, the Owner’s Manual may not cover every circumstance that may arise in owning and operating a Hydra-Sports boat. Also, the illustra-tions used in this Owner’s Manual are intended only as representative reference views and may not depict actual model component parts. Information regard-ing certain on-board components furnished by suppli-ers other than Hydra-Sports, including the engine and power train components, is provided separately by the manufacturers of those components. This information is available through your dealer. A reasonable effort has been made by Hydra-Sports and its suppliers to provide the applicable information required to ensure a long-lasting and enjoyable boating experience.

DANGERS, WARNINGS & CAUTIONS4 4 4

2011 Hydra-Sports Owners Manual • Dangers, Warnings & Cautions • Page ii

This is the safety alert symbol. It is used to alert you to po-tential personal injury hazards. Obey all safety messages that follow this symbol to avoid possible injury or death.

DANGER indicates an imminently hazardous situation which, if not avoided, will result in death or serious injury.

WARNING indicates a potentially hazardous situation which, if not avoided, could result in death or serious injury.

CAUTION indicates a potentially hazardous situation which, if not avoided, may result in minor or moderate injury.

CAUTION used without the safety alert symbol indicates a potentially hazardous situation which, if not avoided, may result in property damage.

Theprecautions listed in thisOwner’sManualandon theboatarenotall-inclusive.Ifaprocedure,method,toolorpartisnot specifically recommended by Hydra-Sports, using it may place you and others in an unsafe situation; in addition, you may render your warranty void. Remember: Always use common sense when operating, servicing or repairing the boat! Observing the safety recommendations found in this Owner’s Manual is critical to keeping your boating experience as safe as possible during routine operation. Your failure to do so may result in severe personal injury or death to you and/or others. Use caution and common sense when operating your boat. Do not ever take unnecessary chances! Be sure to review the Boating Safety section of this manual, which immediately follows this section. Because of the importance of these dangers, warnings and cautions, they are reprinted here, along with the pages on which you will find them. Please note that the safety information statements presented below are catego-rized for information purposes only, and are not presented in any particular order of importance. Each of the statements referenced below and in the other sections of this manual provide you with

important safety-related information and must be read and fol-lowed to avoid injury or damage, as applicable. We strongly en-courage you to cross-reference and read the dangers, warnings and cautions within the context in which they are presented by reading and reviewing those sections.

Following the activation of a hand-held fire extinguisher, a care-ful determination should be made as to whether the boat can safely be operated. If there is any doubt or concern whatsoever, the boat should be towed to shore and/or dock for service by an authorized Hydra-Sports dealer prior to operating again. Fail-ure to follow these instructions could result in death or serious injury/illness. (Page 1-3)

Failure to comply with safety-related information and instruc-tions may result in serious injury or death to you and/or oth-ers. Always use common sense when operating the boat or par-ticipating in any activities associated with the boat, including, but not limited to, periods of time when the boat engine is shut down and the boat is not in operation. (Page 1-5)

Never override or modify the engine emergency safety shut-off switch in any way. (Page 1-5)

Do not add any attachments that are not approved for use on your Hydra-Sports boat. Do not climb on, sit on, stand on, jump off of or dive off of the hard top, where equipped. Never allow passengers to sit behind a tow rope attachment point. Never allow loose tow rope ends to dangle. Secure all equip-ment such as tubes and wakeboards when not in use. Always be certain that all bolts are in place and tight before and dur-ing use. When the antennae are up on the hard top where equipped, watch for low obstacles such as tree limbs, bridges or power lines. (Page 1-6)

Carbon monoxide is a colorless, tasteless, odorless and poison-ous gas that accumulates rapidly and can cause serious injury or death. Exposure to carbon monoxide can be fatal in a mat-ter of minutes. Exposure to even low concentrations of carbon monoxide must not be ignored because the effects of exposure to carbon monoxide can build up and be just as lethal as high concentrations. Carbon monoxide from exhaust pipes of in-board or outboard engines may build up inside and outside the boat in areas near exhaust vents, particularly during slow-speed operations. STAY AWAY from these exhaust vent areas, which are located near the stern of the boat, and DO NOT swim or engage in any watersports or other activities in or near the stern area of the boat, including, without limitation, the swim plat-form, when the engine is in operation. Under no circumstances should the owner and/or operator allow persons to hold onto the swim platform while the engine is operating and the boat is in motion. These activities (sometimes known as “teak surfing”

2011 Hydra-Sports Owners Manual • Dangers, Warnings & Cautions • Page iii

or “platform dragging,” where the participant holds onto the swim platform and is pulled through the water, and/or “body surfs” immediately behind the boat) are extremely dangerous, highly likely to result in death or serious bodily injury, and are a misuse of this product. (Page 2-1)

The safety switch lanyard must be attached to the operator whenever the engine is running. Failure to do so may result in death or serious injury! (Page 6-2)

Only qualified personnel should install batteries and perform electrical system maintenance. Do not expose batteries to open flame or sparks. Do not smoke near batteries. (Page 7-2)

Gasoline is extremely flammable and highly explosive under certain conditions. Always stop the engine and never smoke or allow open flames or sparks within fifty (50) feet of the fueling area when fueling. (Page 9-1)

Take care not to spill gasoline. If gasoline is spilled accidentally, wipe up all traces of it with dry rags immediately and dispose of properly on shore. (Page 9-1)

Gasoline is explosive. If a gasoline odor is present or gasoline is visually observed in the bilge area during inspection, DO NOT START YOUR ENGINE! Remove the ignition key from the ignition switch and call an authorized Hydra-Sports dealer for service. (Page 9-1)

Before starting the engine, open the bilge compartment access and check for gasoline fumes, fuel and oil leaks or the presence of fuel or oil in the bilge. (Page 11-1)

Boat operators should never attempt to duplicate operational skills of professional drivers. When such maneuvers fail, it can result in serious injury or death. (Page 11-3)

All boats have weight limits. Failure to adhere to the posted limits can cause operation instability and/or the boat to sink. This may result in serious injury or death, as well as signifi-cant damage to the boat, which will not be covered by war-ranty. The number of persons who can safely be aboard may be limited by available seats and leaning posts. (Page 2-1)

Engaging the engine synchronization functionality requires practice to master. Because the boat will be in gear and will move during the process, even after mastering the maneuver boat operators should synchronize engines only on bodies of water of sufficient size to accomplish the maneuver without making contact with other vessels or with inanimate objects, which could cause serious bodily injury or significant damage to the boat. (Page 6-2)

Do not lower the tabs all the way at high speeds as it may result in loss of steering control. Lower tabs a little at a time. Observe the effect on boat operations before lowering further. (Page 6-4)

Hydra-Sports electrical system parts are designed and manu-factured to comply with U.S. Coast Guard requirements to minimize risks of fire or explosion. Never substitute automo-tive parts for marine parts. Automotive parts do not provide the necessary ignition spark protection. Consult your authorized Hydra-Sports dealer prior to making any changes to the boat’s electrical system. (Page 7-1)

Sulfuric acid in batteries can cause severe burns. Avoid contact with skin, eyes or clothing. Wear goggles, rubber gloves and a protective apron when working with batteries. In case of skin contact, flush with water at least 15 minutes. If swallowed, drink large quantities of water or milk. Follow with Milk of Magnesia, beaten egg or vegetable oil. Get medical attention immediately. (Page 7-1)

When charging, batteries generate small amounts of danger-ous hydrogen gas. This gas is highly explosive. Keep all sparks, flames and smoking well away from the area. Failure to follow instructions when charging a battery may cause an electrical charge or even an explosion of the battery, which could result in death or serious injury. (Page 7-1)

To prevent personal injury, do not attempt to start your engine with jumper cables. The use of jumper cables could create dan-gerous sparks, which could cause the battery’s hydrogen vapors or gasoline fumes to explode. (Page 7-2)

When leaving the boat for several hours or more, turn the water pump OFF. A powered pump can fill the cabin with water if a water line breaks. (Page 8-3)

Waste in holding tanks can form methane, an explosive gas. Keep the vent open and clear of obstructions. Keep fire and flame away when maintaining sanitary systems. (Page 8-5)

Hot water can cause serious burns! Water can become very hot. Al-ways check the water temperature before using water. (Page 8-5)

DO NOT launch or operate the boat if any problem is found during the Safety Check. A problem could lead to an accident during the outing, resulting in death or serious injury. Any and all problems should receive attention immediately. See your au-thorized MasterCraft Hydra-Sports dealer’s service department for assistance. (Page 10-1)

It is the boat operator’s responsibility to ensure that the boat is never overloaded. Too much additional weight may cause the boat to overturn or sink, which can result in serious bodily in-jury or death. (Page 11-2)

Use of improper parts may cause component failure. Such fail-ure may result in death or serious injury! (Page 13-1)

Battery electrolyte fluid is dangerous. It contains sulfuric acid, which is poisonous, corrosive and caustic. If electrolyte fluid is spilled or placed on any part of the human body, immediately flush the area with large amounts of clean water and immedi-ately seek medical attention. (Page 15-1)

When charging, batteries generate small amounts of danger-ous hydrogen gas. This gas is highly explosive. Keep all sparks,

2011 Hydra-Sports Owners Manual • Dangers, Warnings & Cautions • Page iv

flames and smoking well away from the area. Failure to follow instructions when charging a battery may cause an electrical charge or even an explosion of the battery, which could result in death or serious injury. (Page 15-2)

When charging, batteries generate small amounts of danger-ous hydrogen gas. This gas is highly explosive. Keep all sparks, flames and smoking well away from the area. Failure to follow instructions when charging a battery may cause an electrical charge or even an explosion of the battery, which could cause death or serious injury. (Page 15-3)

Sanitizing solution contains bleach. Do not drink sanitizing so-lution. Tag faucets. Notify everyone aboard that the system is being sanitized. (Page 8-2)

Be sure all fasteners used are approved and rated for marine use. Most fasteners used on Hydra-Sports boats are stainless steel or specially coated to resist corrosion. (Page 13-1)

Gasoline is highly flammable and its vapors may ignite, result-ing in fire or explosion. Be sure to keep all sparks and flames away from the area while inspecting the boat’s fuel system. (Page 15-3)

Continuing to operate the boat while the temperature is above nor-mal operating parameters may cause serious damage to your en-gine. Damage to your engine resulting from operating the engine in an overheated condition can be costly to repair. (Page 6-3)

To prevent damage to the electrical system, never operate the shore power system at less than 105 volts. (Page 7-3)

Some below-deck livewells are equipped with a drain plug in-stead of a drain pump. Removing the drain plug will empty the livewell into the bilge, which could damage boat equipment or cause the boat to sink if the water is not immediately removed via the bilge pump. (Page 8-3)

Running a boat with a damaged or unbalanced propeller can re-sult in further damage to the engine or the drive unit. (Page 8-3)

When boating, avoid using the windshield as an aid for balance or getting out of a seat. This causes undue stress to the window frame and could damage it, which may not be covered under warranty. (Page 10-1)Failure to follow the engine oil recommendations listed in the engine manual can cause additional engine wear and increase the possibility of engine component failure. Damage to the en-gine due to incorrect oil usage can be costly to repair, and is not covered by the warranty! (Page 11-1)

Do not operate the starter motor continuously without a “cool-down” period. Each engine manufacturer has specific guidelines regarding this procedure; refer to your engine owner’s manual for details. Failure to allow a cool-down period when trying to

start an engine that does not immediately fire do so may cause the starter to overheat, resulting in damage. Failure to release the ignition key after the engine has started may cause damage to the starter motor and drive. (Page 11-2)

Continued operation after the warning light has illuminated or alarm has sounded may cause severe engine damage. (Page 11-2)

DO NOT use the hard top for lifting. They are NOT designed to be used as a central lifting point. See the Storage Cradle sub-section of this section. Also never lift a boat with water in the bilge or containing a water-filled device such as a fresh water tank or livewell. The extra stress will put an excessive load on the hull and lifting equipment that may seriously damage the boat. Such damage may not be covered by the warranty. (Page 12-2)

Lifting slings must never contact hardware protruding from the hull. Damage may result that would void the warranty. (Page 12-2)

When the boat is out of the water, it is important to support the hull correctly to avoid any hull damage. Such damage may void the warranty. (Page 12-2)

Exposure to salt water will cause corrosion leading to significant damage to stainless steel and chrome parts. Failure to thorough-ly rinse salt water from all hardware, and to apply protective oil after each exposure to salt water, will accelerate the corrosion of hardware and will void your warranty. (Page 13-1)

Failure to properly maintain the boat surfaces and materials as described in this Owner’s Manual and by the product manufac-turers (who maintain websites that offer additional detail about care and maintenance), can result in damage to the boat that is not covered under warranty. (Page 14-3)

Crossing cables or jumper cables may result in damage to the electrical components due to incorrect battery connections. Such damages may not be covered by your warranty. (Page 15-3)

Because of the complexity of preparing a boat for proper winter storage, as well as the possibility of extreme damage to the drive train if a preparation error was made during winterization, Hydra-Sports recommends scheduling an appointment with an autho-rized Hydra-Sports dealer’s service department to permit a techni-cian to perform all winterization procedures. (Page 18-1)

2011 Hydra-Sports Owners Manual • Table of Contents • Page v

TA B L E O f C O N T E N T S4 4 4

Welcome Aboard................................................. iDangers, Warnings & Cautions...............................ii

Safety KnowledgeBoating Safety..................................................1-2GeneralPrecautions.........................................1-2 Safety Equipment............................................ 1-3 Required Equipment......................................... 1-3 Personal Flotation Devices (PFDs)...................... 1-3 PFD Accessibility........................................... 1-3 Sound Producing Devices............................... 1-3 Visual Distress Signals.................................... 1-4 Registration, Numbering and Documentation......................................... 1-4Insurance...................................................... 1-4Operator’sLicense.......................................... 1-4 Recommended Equipment................................. 1-4 Safety Afloat.................................................. 1-5 Skiing and Wakeboarding Safety...................... 1-5 Warning Plates and Labels............................... 1-6 Operator’s Responsibilities................................ 1-6FloatPlan...................................................... 1-6 Nautical Charts.............................................. 1-6Weather........................................................1-7 Staying Afloat.................................................1-7 Cold Water Survival.........................................1-7 Hypothermia...................................................1-7 Immersion Suits................................................1-7 Inflatable Life Rafts.......................................... 1-8 Anchoring..................................................... 1-8 Communications............................................. 1-8 Law Enforcement............................................. 1-8 Marpol Treaty................................................ 1-9 Accident Reports............................................. 1-9Common Sense Approach...................................2-1Rules of the Open Water.................................... 3-1 Steering and Sailing Rules/ Sound Signals............................................ 3-1 Rules When Encountering Vessels....................... 3-1 Meeting........................................................ 3-1 Crossing....................................................... 3-1 Overtaking.....................................................3-2 Other Special Situations....................................3-2 Sailing Vessel Right-of-Way................................3-2 Fishing Vessel Right-of-Way................................3-2 The General Prudential Rule...............................3-2 Reading Buoys and Other Markings....................3-2Boating Terminology.......................................... 4-1

Guide to Individual ModelsBay Bolt 19......................................................5-2Bay Bolt 23..................................................... 5-3180CC.......................................................... 5-42100WA....................................................... 5-5202DC.......................................................... 5-62100CC.........................................................5-72300DC........................................................ 5-82300CC........................................................ 5-92300VX....................................................... 5-102500CC...................................................... 5-112500VX....................................................... 5-123000CC...................................................... 5-133000VX....................................................... 5-143400CC...................................................... 5-163600VX....................................................... 5-174200VSF...................................................... 5-19MoreLocations...............................................5-20BasicMeasurements.........................................5-22Instrument Gauges & Switches............................. 6-1 12-Volt Receptacle.......................................... 6-1 AM/FM Stereo, CD Player, Remote Control, iPod, TV and DVD Connections.............. 6-1 Bilge Pump Switch.......................................... 6-1 Bow Thruster Control....................................... 6-1 Compass...................................................... 6-2 Circuit Breakers.............................................. 6-2 Courtesy Lights Switch(es)................................. 6-2 Engine Alarm System/Warning Lights................. 6-2 Engine Synchronizing Switch............................. 6-2 Engine Temperature Gauge.............................. 6-3 Fuel Gauge................................................... 6-3 Horn............................................................ 6-3 Ignition Key Slot............................................. 6-3 Navigation/Anchor Lights Switch....................... 6-3 Power Switch................................................. 6-3 Power Trim Gauge.......................................... 6-3 Shift/Throttle Control (Binnacle)......................... 6-3 Shower......................................................... 6-3 Speedometer................................................. 6-4Tachometer.................................................... 6-4 Trim Tab Switch.............................................. 6-4 VHF Radio.................................................... 6-4 Underwater Lights Switch.................................. 6-4Voltmeter....................................................... 6-5 Wash Down Switch........................................ 6-5 Washer/Wiper Control................................... 6-5 Water Pressure Gauge..................................... 6-5 Windlass Up/Down....................................... 6-5

2011 Hydra-Sports Owners Manual • Table of Contents • Page vi

The Electrical System..........................................7-1 12-Volt DC Boat System....................................7-1 12/24-Volt Trolling Motor System.......................7-1 24-Volt Trolling Motor System.............................7-1 Battery/Batteries.............................................7-1 Battery Switch.................................................7-2 AC/DC Battery Charger...................................7-2 Battery Charging.............................................7-2OverloadProtection.........................................7-2 Trolling Motor.................................................7-2 120-Volt AC Electrical System............................7-3 Shore Power...................................................7-3Systems, Comfort & Convenience......................... 8-1 Air Conditioning System................................... 8-1 Bilge............................................................ 8-1 Bilge Pump.................................................... 8-1 Engines.........................................................8-2 Fish Box.........................................................8-2 Fresh Water System..........................................8-2 Sanitizing the Fresh Water System.....................8-2 Filling the Fresh Water Tank.............................8-2 Starting the Fresh Water System........................8-2FreshWaterPumps........................................ 8-3 Livewell System............................................... 8-3Propeller....................................................... 8-3 Cavitation................................................... 8-3Ventilation................................................... 8-3 Refrigerator.................................................... 8-3 Steering System.............................................. 8-4 Stove........................................................... 8-4 Toilet (Marine Sanitation Device MSD)................ 8-4PortableToilet.............................................. 8-4 Holding Tank............................................... 8-4 Washdown, Raw Water Cockpit....................... 8-5 Water Heater................................................ 8-5

PreparationUsing Care When Fueling.................................. 9-1 Fuel System.................................................... 9-1Safety Checks & Services................................. 10-1 Before Each Operation.................................. 10-1 During Operation......................................... 10-1 After Operation............................................ 10-1New Boat Break-In.......................................... 11-1 First Hours of Operation................................. 11-1 After Break-In............................................... 11-1 Starting and Basic Operation.......................... 11-1 Before Starting............................................. 11-1 Starting the Engine........................................ 11-1 Shifting Gears...............................................11-2 Underway....................................................11-2 Stopping......................................................11-2 Operational Hints..........................................11-2 Loading.......................................................11-2 Emergencies.................................................11-2 Courtesy......................................................11-2FirstTimeOperation...................................... 11-3

Basic Maneuvering....................................... 11-3 High Speed Operation.................................. 11-3 Unusual Operating Conditions......................... 11-3 Docking and Tie-Up...................................... 11-3 Remaining Docked........................................ 11-4

Care and MaintenanceLifting the Boat................................................12-2 Using Lifting Eyes...........................................12-2 Using Lifting Slings.........................................12-2 Storage Cradle.............................................12-2Corrosion Prevention........................................ 13-1 Galvanic Corrosion....................................... 13-1 Salt Water Corrosion..................................... 13-1MarineGrowth............................................ 13-1 Stainless Steel and Chrome............................. 13-1Cleaning the Boat........................................... 14-1 Hull........................................................... 14-1 Upholstery................................................... 14-1 Carpet....................................................... 14-1Windshield................................................. 14-1 Enclosed Head.............................................14-2 Hard Top.....................................................14-2 Interior Cabin Finishes.....................................14-2 General Cleaning and Maintenance................ 14-3Before Each Use (Prior to Starting the Engine)....... 15-1 Inspect Seacock Strainer................................ 15-1 Inspect the Battery Connections and and Hold-Downs........................................ 15-1 Inspect the Throttle and Shift Cables for Kinks,WearandInterference.................................15-2 Inspect the Fuel System for Leaks.......................15-2Before Each Use (After Starting the Engine)........... 15-3 Check that the Battery Is Fully Charged............. 15-3After Each Use............................................... 16-1 General Cleaning and Storage....................... 16-1Inspections.................................................. 16-1Annual Maintenance........................................17-1 Fire Extinguisher(s)..........................................17-1Storage & Winterization................................... 18-1 Fuel System Treatment.................................... 18-1 General Power Package Preparation................. 18-1 Other Winterization Preparations...................... 18-1 Re-Activating the Boat After Storage...................18-2Guide to Troubleshooting................................. 19-1

Limited Warranty StatementLimited Warranty Statement............................... 20-2Warranty Registration & Transfer........................ 20-5

Service Log................................................... 21-1Index.............................................................22-1

S A F E T Y K N O W L E D G E

B O AT I N G S A F E T Y4 4 4

2011 Hydra-Sports Owners Manual • Boating Safety • Page 1-2

Yoursafety,aswellasthesafetyofotherswithandaroundyou,isadirectresultofhowyouoperateandmaintainyourboat.You—andanyonewhowillbeoperatingthisboat—shouldreadandseektofullycomprehendthisOwner’sManual,andanyad-ditional information provided by component manufacturers andsuppliers.Makesurethatyouunderstandallof thecontrolsandoperating instructionsbeforeattempting tooperate theboat. Im-properoperationisextremelydangerous! ThebasicsafetyrulesareoutlinedinthissectionoftheOwn-er’sManual.Additionalprecautions throughout theManualarenotedbythefollowingsymbols:

This is the safety alert symbol. It is used to alert you to po-tential personal injury hazards. Obey all safety messages that follow this symbol to avoid possible injury or death.

DANGER indicates an imminently hazardous situation which, if not avoided, will result in death or serious injury.

WARNING indicates a potentially hazardous situation which, if not avoided, could result in death or serious injury.

CAUTION indicates a potentially hazardous situation which, if not avoided, may result in minor or moderate injury.

CAUTION used without the safety alert symbol indicates a potentially hazardous situation which, if not avoided, may result in property damage.

Theprecautions listed in thisOwner’sManualandon theboatarenotall-inclusive.Ifaprocedure,method,toolorpartisnot specifically recommended by Hydra-Sports, using it may place youandothersinanunsafesituation;inaddition,youmayrenderyourwarrantyvoid.Remember:Alwaysusecommonsensewhenoperating,servicingorrepairingtheboat! ObservingthesafetyrecommendationsfoundinthisOwner’sManual iscritical tokeepingyourboatingexperienceassafeaspossibleduringroutineoperation.Yourfailuretodosomayresultin

severepersonalinjuryordeathtoyouand/orothers.Usecautionandcommonsensewhenoperatingyourboat.Donotever takeunnecessarychances!

General Precautions BecertainthatalloperatorsofyourboatareawareofthesafetyinformationwithinthisOwner’sManualandthattheyuseittoconformtoboatsafetyprinciples. Boatingsafetystartswithathoroughunderstandingofboatoperations.InadditiontocarefulreviewofthisOwner’sManual,youshouldalsobeawarethatmanysourcesofhelpfulinformationare available. Hydra-Sports urges you to pursue additional training prior to the independent operation of your boat. However, training atanytimefromrecognizedboatingand/orsafetyorganizationsis beneficial. Thefollowingisalistingofafewagenciesandorganizationsthatoffersafetytrainingand/orinformation:

American Red Cross, National HQ8111 Gatehouse Road, 6th Floor

Falls Church VA 22042(202) 737-8300

www.redcross.org

U.S. A. Water Ski Association1251 Holy Cow Road

Polk City FL 33868(863) 324-4341

www.usawaterski.org

Boat Owners Association of the United States880 South Pickett StreetAlexandria VA 22304

(703) 823-9550www.boatus.com

National Safe Boating Council2550 M Street NW, Suite 425

Washington DC 20037(202) 296-4588

www.safeboatingcouncil.org

U.S. Coast Guard Auxiliary2100 Second Street SW

Washington DC 20593-001(202) 267-1001www.uscg.mil


Safety Equipment Federallawrequirescertainsafetyequipmenttobeon-boardyourboatatalltimes.Responsibleboaterscarryadditionalequip-mentincaseofemergency.Itisyourresponsibilitytocheckwiththelocalboatingauthoritiesforanyadditionalrequirementsand/orequipmentoverandabovethefederalrequirements.

Required Equipment Your Hydra-Sports boat has been equipped at the factory withmostof the federally requiredsafetyequipment for thesizeandtypeofcraftthathasbeenpurchased.Formoreinformationregardingrequiredsafetyequipment,verify theboat lengthandthen seek additional details at the U.S. Coast Guard’s website: www.uscg.mil.

Fire Extinguishers Fire extinguishers should always be carried on-board. Because the size of the various Hydra-Sports models varies consid-erably, the requirements and recommenda-tions as outlined by the U.S. Coast Guard will also vary. Therefore, Hydra-Sports strongly encourages you to work with your autho-rized dealer to determine which types of fire extinguisher(s) should be on-board at all times (and fully charged). This is extremely important and should never be overlooked prior to any outing. If a dry chemical fire extinguisher has been discharged, then you may purchase areplacement five-pound dry chemical fire extinguisher that is rated for Type A, B and C fires from an authorized Hydra-Sports dealer orfromanothersource. Fire extinguishers require periodic maintenance. Monthly,each fire extinguisher on your boat should be examined to be sure thatthesealsandtamperindicatorsarenotbrokenormissing.Thepressuregaugesor indicators, ifapplicable, should read in theoperable range.There shouldbenoobviousphysicaldamage,rust, corrosion, leakageor cloggednozzles.Additionally, if theextinguisherhasnotbeenused,itshouldbeweighedannuallytoassurethattheminimumweightasstatedonthelabelstillexists.Any fire extinguisher that has been partially emptied must be re-placed or taken to a qualified fire extinguisher servicing company forrecharging.

Following the activation of a hand-held fire extinguisher, a careful determination should be made as to whether the boat can safely be operated. If there is any doubt or concern what-soever, the boat should be towed to shore and/or dock for service by an authorized Hydra-Sports dealer prior to operat-ing again. Failure to follow these instructions could result in death or serious injury/illness.

Personal Flotation Devices (PFDs) Federal lawalso requiresat leastonewearableType I, II,III or TypeVPersonal FlotationDevice (“PFD”), foreachpersonon-board or being towed on water skis, wakeboards or otherrecreationalequipment.ATypeVPFDprovidestheperformance

ofaTypeI,IIorIIIPFD(asmarkedon its label)andmustbeusedac-cording to the label requirements.In addition, one throwable TypeIVPFDmustalsobeonboard.As the owner, it is your responsibil-ity to obtain the appropriate PFDs and determine whether people on-board, including those who are underage, are required to wear PFDs when underway.YourHydra-Sports dealer can, and will be happy to, assist you with yourpurchaseofappropriatePFDs. Note:Requirementsforcoastalwatersandinlandwatersdif-fer. Check with the local boating authorities for more information.

PFD Accessibility• WearablePFDsmustbereadilyaccessible.• ItshouldbepossibletoputonthePFDswithinareasonableamountoftimeincaseofemergency.• PFDsshouldneverbestowedinplasticbags, in lockedorclosedcompartmentsorhaveothergearstowedontopofthem.• The U.S. Coast Guard, as well as Hydra-Sports, recommends thewearingofPFDsatalltimeswhenthevesselisunderway,eventhoughitisnotarequirement.ThebestPFD,andtheonethatcansaveyourlife,istheonethatisworn.• Inflatable PFDs must have a full cylinder and all status indica-tors on the inflator must be green, or the device is NOT service-able, and does NOT satisfy the requirement to carry PFDs.• Coast Guard-approved inflatable PFDs are authorized for use onrecreationalboatsbypersonsatleast16yearsofage.• Some states require children to wear PFDs at all times. Check with your state boating safety officials for details. Be certain to equipchildrenwiththeappropriatePFDs.Thelabelwillindicatetheweightlimitsforuse.

Sound Producing Devices Thenavigationrulesrequiresoundsignalstobemadeundercertain circumstances. Meeting, crossing and overtaking situa-tions,whichwillbedescribedinsomedetailshortly,areexamplesofwhensoundsignalsarerequired.Recreationalvesselsarealsorequiredtosoundsignalsduringperiodsofreducedvisibility.YourHydra-Sports boat is equipped with a horn, but you may also pur-chaseaftermarketdevicesincaseofpotentialelectricaldisconnectorfailure. Note:The requirement tocarryabellonboardno longerappliestovesselsoperatingonInternationalWaters.


Visual Distress Signals Allvesselsusedoncoast-al waters, the Great Lakes, territorial seas and thosewaters connected directly tothemup toapointwhereabodyofwaterislessthantwomileswide,mustbeequippedwithU.S.C.G.-approved visual distress signals. Vessels owned in the United States but operating on the high seas must be equipped with U.S.C.G.-approved visual distress signals. Pyrotechnic visual distress signals must be Coast Guard-approved, in serviceableconditionand readilyaccessible. Thismeansthat:• Theyaremarkedwithanexpirationdate.Expiredsignalsmay

becarriedasextraequipmentbutcannotbecountedtowardmeetingthevisualdistresssignalrequirementsincetheymaybeunreliable.

• Ifpyrotechnicdevicesareselected,aminimumof threearerequired.Thatis,threesignalsfordayuseandthreesignalsfor night. Some pyrotechnic signals meet both day and night userequirements.

• Pyrotechnicdevicesshouldbestoredinacool,drylocation,ifpossible.Awatertightcontainerpaintedredororangeandprominently marked “Distress Signals” or “Flares” is recom-mended.

U.S.C.G.-approved pyrotechnic visual distress signals and associated devices include pyrotechnic red flairs, hand-held or aerial, pyrotechnic orange smoke, hand-held or floating, or launch-ers for aerial red meteors or parachute flares. Non-pyrotechnic devices may be allowed. These include an orange distress flag (day signal only) or an electric distress light (whichisacceptablefornightuse).Useofthesedevicesmuststillmeet Coast Guard requirements. Information for these devices is available online and from the Coast Guard. Under Inland Navigation Rules, a high intensity white light flashing at regular intervals from 50-70 times per minute is con-sidered a distress signal. Such devices do NOT count toward meeting the visual distress signal requirement, however. Regula-tionsprohibitdisplayofvisualdistresssignalsonthewaterunderanycircumstancesexceptwhenassistanceisrequiredtopreventimmediateorpotentialdangertopersonsonboardavessel. All distress signals have distinct advantages. No single de-viceisidealunderallconditionsorsuitableforallpurposes.Py-rotechnicsareuniversallyrecognizedasexcellentdistresssignals.However, there is the potential for injury and property damage if not properly handled. These devices produce a very hot flame and the residue can cause burns and ignite flammable materials. Pistol launched and hand-held parachute flares and meteors have many characteristics of a firearm and must be handled with caution. In some states they are considered a firearm and prohib-itedfromuse. Check with local authorities regarding the best visual distress signalforuseintheareainwhichyouwillbeboating.

Registration, Numbering and Documentation Althoughitmightnotbeimmediatelyobviousastohowthisrelatestoboatingsafety,infactitcanbecriticalinemergencies.All undocumented vessels equipped with propulsion machinerymust be registered in the state of principal use. A certificate of num-berwillbeissueduponregisteringthevehicle.Thesenumbersmustbedisplayedonyour vessel. Theowner/operatorof the vessel

must carry a valid certificate of number whenever the vessel is in use. When moving to a new state of principal use, the certificate is valid for 60 days. Check with your state boating authority for registrationrequirements. Numbers must be painted or permanently attached to each sideoftheforwardhalfofthevessel.Thevalidationstickersmustbe affixed within six inches of the registration number. With the exceptionofthevesselfeedecal,nootherlettersornumbersmaybe displayed nearby. Lettering must be in plain, vertical block characters of not less than three (3) inches in height. Spaces or hyphensbetweenletterandnumbergroupingsmustbeequaltothewidthofaletterotherthan“i”oranumberotherthan“1.”

Theownerofavesselmustnotifytheagencywhichissuedthe certificate of number within fifteen (15) days if the vessel is transferred,destroyed,abandoned,lost,stolenorrecovered,orifthe certificate of number is lost, destroyed or the owner’s address changed. If the certificate of number becomes invalid for any rea-son,itmustbesurrenderedinthemannerprescribedtotheissuingauthority within 15 days.

Insurance Inmanystates,theboatownerislegallyresponsiblefordam-agestootherwatercraft,docksorotherpropertyandforinjuriestopeople,evenifsomeoneelseisoperatingtheboatatthetimeoftheaccident.Itisadvisabletocarrypersonalliabilityandpropertydamageinsurancesimilartoanautomobile-typeinsurancepolicy.Insuranceforphysicaldamageortheftofyourboatisfurtherpro-tectionofyourinvestment.

Operator’s License Some states are implementing operator’s license require-ments.Theserequirementsvarywidely.Whetheroperatingaboatlocallyorinaremotelocation,operatorsshouldverifywithstateand local authorities regardingwhether a license or training isrequired.Thisshouldbecheckedatleastannually.

Recommended Equipment Theresponsibleboatownerwillavoidpotentialproblemsonan outing by having additional equipment on board. Normally, the decisionregardingtheappropriateequipmenttotakeonindividualoutingsisdependentuponthebodyofwaterandthelengthofthetrip.Wesuggest the followingequipmentas theminimumequip-ment that you should carry on board (your authorized Hydra-Sports dealercanalsoassistyouwithadditionalrecommendations):• An anchor with at least 75 feet of line (in saltwater operation, particularly);• Amanualbailingdeviceforremovingwater;• Acombinationoar/boathook;


• Aday-and-nightvisualdistresssignal;• A first aid kit and manual;• Anairwaybreathingtube;• A waterproof flashlight;• Anon-electrichornorwhistle;• Asetoflocalnavigationalcharts;• Mooringlinesandfenders;• Extraengineoil;• Atoolkit;and• Aportable,battery-operatedAM/FMradioorweatherra-dio/scanner.

Safety Afloat Thecauseofmanyboatingaccidentsisoftentheoperator’sfailuretofollowbasicsafetyrulesorwrittenprecautions.Manyac-cidentscanbeavoidediftheoperatoriscompletelyfamiliarwiththeboat, itsoperationandcanrecognizepotentiallyhazardoussituationsbeforeanaccidentoccurs.

Failure to comply with safety-related information and in-structions may result in serious injury or death to you and/or others. Always use common sense when operating the boat or participating in any activities associated with the boat, including, but not limited to, periods of time when the boat engine is shut down and the boat is not in operation.

• Improperoperationoftheboatisextremelydangerous!Op-eratorsmustreadandunderstandalloperatingmanualssup-pliedwiththeboat,beforeoperation.

• On-boardequipmentmustalwaysconformtothegoverningfederal,stateandlocalregulations.

Never override or modify the engine emergency safety shut-off switch in any way.

• Never operate the boat while under the influence of alcohol ordrugs.

• Never allow passengers to occupy portions of the boat with-outseatingwhileunderway.

• Never stand or allow passengers to stand in the boat while underway,unlessyouand/oryourpassengersareusingafactory-installedleaningpost.Youorothersmaybethrownwithinor fromtheboat,whichcouldresult inserious injuryordeath.Whenusingaleaningpost,beconstantlyawareofconditionsthatmayresultincreatingunsafeconditionsforremaininguprightorwithintheboat.Anytimethatconditionsworsen, slow down and avoid situations that could resultin you or passengers being thrownoverboard. Passengersshouldnevermovearoundthecockpitorhelmareawhiletheboatisplaned(theprocessduringwhichtheboatspeedsuptorideontopofthewaterinsteadofdisplacingorpushingwateraside).

• Never remove or modify any components of the fuel system. Removal or modification of any component of the fuel system maycauseahazardoussituationandwillvoidthewarranty.The modern Hydra-Sports fuel delivery lines are pressurized

andattempting to loosenorremovethemmayresult in theuncontrolled releaseof fuel,which canbe environmentallyhazardous,andmaypotentiallycauseinjury.

• Never allow any type of spark or open flame on board. It may result in fire or explosion.

Skiing and Wakeboarding Safety Although Hydra-Sports boats are crafted to enhance enjoy-ment of the fishing experience, it may be possible for the boats to be adapted to skiing and wakeboarding. Skiers and wakeboard-ersareobligatedtobeasawareofthefundamentalsafetyrulesas operators. If you are new to water sports, you should seekcertified training before starting. You may find it especially helpful to join a local water-sports club, if available, and the U.S.W.S.A. (United States Water Skiing Association).• Alwaysrememberthatthemajorityofwater-skiingandwake-

boardinginjuriesaretheresultofimpactswithotherobjects,soalwayslookwhereyouaregoingandbeawareofwhatisgoingonaroundyou.

• Never put your arm, head or any other part of your body through thehandle/bridleof the skiorwakeboarding line,norwrapthelinearoundanypartofthebodyatanytime.

• Never ski or wakeboard at night. • Never ski or wakeboard directly in front of other boats. • Never jump from a boat that is moving at any speed, nor

enter or exit the water when the engine is running (ON). The propellerisexposedandmaycauseseriousinjuryordeathifcontacted by a person in the water. (See the Common Sense ApproachsectionofthisOwner’sManualforadditionalin-formationregardingcarbonmonoxidedanger.)

• Makesurethateveryoneknowsandusesapprovedskiing/wakeboardinghandsignalsandadherestocommonskiing,wakeboardingandboatingcourtesy.

• Never ride on the swim platform or hold on to the swim platform or boarding ladder while in the water during en-gine operation, including at idle. Carbon monoxide fumes areexpelled from the lowerportionof the transom-mountedengine(s),andcancausedeathorseriousillness.

• Maintainaclear, unobstructedviewatall times,especiallyforward. Scan the water and avoid tunnel vision. Many boat-ingcollisionsarecausedbyinattention.

Float Plan A “float plan” is a written record indicating the planned des-tination and approximate length of time for the outing. Sample forms are available at the Coast Guard’s website. One should becompletedandleftwitharelativeorfriendpriortoeachtrip.Incaseofanemergencyorfailuretoreturnwithinareasonableperiodoftime,pertinentinformationwillbeavailabletoassistlo-cal marine police or the Coast Guard in determining whether a search should be performed. Be sure to notify the float plan holder uponreturn.

Sample Float Plan Name of vessel’s operator: ____________________________________ Telephone Number: __________________________________________ Name of Vessel: _____________________________________________ Registration No.: ___________________________________________ Description of Vessel: ________________________________________ Type: _______________________________________________________ Make: ______________________________________________________ Color of Hull: _______________________________________________ Color of Trim: ______________________________________________ Most distinguishing identifiable feature: _________________ ______________________________________________________________ Rafts/Dinghies: Number:________ Size:_______ Color:_______ Radio: Type: __________________ Frequencies Monitored: _____________________________________________ Number of persons onboard: _______________________________ Name: Age: Address & Telephone: _____________________________________________________________ _____________________________________________________________ _____________________________________________________________ _____________________________________________________________ _____________________________________________________________ Note: List additional passengers on back. Engine Type:___________ H.P.:_______ Normal Fuel Supply (days):_______ Survival equipment on board: (check as appropriate) Life Jackets _____ Flares _____ Smoke Signals ______ Medical Kit _____ EPIRB _____ Paddles ______ Anchor ______ Loran/Gps _____ Food for ________ days - Water for ________ days Trip: Date & Time of Departure: _________________________________ Departure From: ___________________________________________ Departure To: ______________________________________________ Expected to arrive by:____________ In no case later than:_____________ Additional information: _________________________________ ____________________________________________________________ ____________________________________________________________ ____________________________________________________________

Nautical Charts Especiallyimportantforboatersplanningtrips,particularlyonopenwaters,arenauticalcharts.Thesechartsshowthena-ture and shape of the coast, depths of water, general configura-tionandcharacterofthebottom.Othermarkingsincludepromi-


• Theabovemandatesarenotall-inclusive.Itistheboater’sre-sponsibilitytooperatetheboatinasafefashionandbecomefamiliarwithanyandallrulesandregulationsgoverningboatoperation.

Do not add any attachments that are not approved for use on your Hydra-Sports boat. Do not climb on, sit on, stand on, jump off of or dive off of the hard top, where equipped. Never allow passengers to sit behind a tow rope attachment point. Never allow loose tow rope ends to dangle. Secure all equipment such as tubes and wakeboards when not in use. Always be certain that all bolts are in place and tight before and during use. When the antennae are up on the hard top where equipped, watch for low obstacles such as tree limbs, bridges or power lines.

Warning Plates and Labels Read and note ALL warning plates and labels from bow to stern, including those thatare installed inside lockersandunderseating. YOU MUST READ AND ADHERE TO ALL CAUTIONS AND WARNINGS IN AND ON YOUR BOAT!

Operator’s Responsibilities• Ensuretheboatisintopoperatingconditionandthereareno

hazardstomovingabouttheboat.• Ensurethebilgeiscleanpriortostarting.• File a float plan with a relative or friend.• Have a complete knowledge of the operation and handling

characteristicsofyourboat.• Have familiarity with your starting location and your goal,

andthewaterwaysbetween.• Maintainasafespeedatalltimestoavoidcollisions.• Keepaneyeoutforchangingweatherconditionsandreact

accordingly.• Knowandpracticethenavigationrules.Knowandobeythe

federalandstateregulationsandboatproperlyaroundwater-waymarkers.


nent landmarks, port facilities, aids to navigation, andmarinehazards. Changes brought about by people and nature require thatnauticalchartsbeconstantlymaintainedandupdatedtoaidsafenavigation. National Ocean Service (NOS) charts may be purchased either directly by mail from the NOS Distribution Branch or through an authorized agent. There are more than 1,700 nautical chart agentswhosellthem.

FAA/National Aeronautical Charting OfficeDistribution Division, AVN-530

6303 Ivy Lane, Suite 400Greenbelt, MD 20770

Telephone: (301) 436-8301Email: [email protected]

Website: http://naco.faa.gov/

Weather Never leave the dock without first checking the local weath-erforecast.Weatherinformationisavailablefromtelevision,ra-dio, localnewspaper,onlineor fromaweatherchannelonaVHF radio. Atcertaintimesoftheyear,weathercanchangerapidlyandboaters shouldalwayskeepaneyeout forweatherconditions.Whileboating,payattentiontothefollowing:• Weatherchangesgenerallycomefromthewest.• Watch for cloud build-up, especially rapid, vertically rising

clouds.• Sudden drop in temperature.• Sudden change in wind direction and/or speed.• On-boardbarometersshouldbecheckedeverytwo-to-three

hours.Arisingbarometerindicatesfairweatherandariseinwindvelocity;a fallingbarometer indicates stormyor rainyweather.

What to do in severe weather:• Reduce speed, keeping enough power to maintain head-

way.• PutonPFDs.• Turnonrunninglights.• Head for the nearest shore that is safe to approach, if pos-

sible.• Head bow of boat into waves at about a 45-degree angle.• Keepbilgesfreeofwater.• Seat passengers on the deck, near the centerline.• Iftheenginefails,tryaseaanchoronalinefromtheboatto

keeptheboatheadedintothewaves.Abucketwillworkasaseaanchorinanemergency.

• Anchortheboat,ifnecessary.Althoughnotadirectresultofweather,attentionshouldbepaid

to tidal changes as well. Coupled with foul weather, tidal changes canadversely affect the ability to navigate safetytoshore.

Staying Afloat Itiscommonlybelievedthatsomeonedressedinheavycloth-ing or waders will experience considerably more difficulty staying afloat if they fall overboard, sinking quickly. This is not true. Air trapped in clothing provides flotation and bending the knees will trap air in waders. To stay afloat:• Remaincalm.Donotthrashaboutortrytoremoveclothingor

footwear.Thisleadstoexhaustionandincreasesthelossofair that may keep you afloat.

• KeepyourPFDon.• Keepyourkneesbent.• Floatonyourbackandpaddleslowlytosafety.

Cold Water Survival Sudden immersion in cold water can induce rapid, uncon-trolledbreathing,cardiacarrestandotherphysicalbodycondi-tions,whichcan lead todrowning.AlwayswearingaPFDwillhelpsurvivalinrapidimmersionsituations. Inothersituationswhenentryintocoldwaterisnecessary:• WearaPFD.• Buttonallclothing.• Cover your head if possible and enter the water slowly.• Keepyourheadoutofthewaterifatallpossible.• Assume the Heat Escape Lessening Posture (HELP) position

as taught within a Coast Guard safety course. See www.uscgboating.orgonline.

Hypothermia Immersion inwater speeds the lossofbodyheatandcanlead to hypothermia. This is the abnormal lowering of internalbody temperature. If a boat capsizes it will likely float on or just belowthesurface. Toreducetheeffectsofhypothermia,getinorontheboat.Trytogetasmuchofyourbodyoutofthewateraspossible.Ifyoucan’tgetintheboat,aPFDwillenableyoutokeepyourheadoutof the water. This is very important because about 50 percent of bodyheatlossisfromthehead. Itmaybepossibletoreviveadrowningvictimwhohasbeenunder water for some time and shows no sign of life. Cases docu-mentinstanceswherevictimshavebeenresuscitatedafterextend-ed periods. Start CPR immediately and get the victim to a hospital asquicklyaspossible.

Immersion Suits Immersionsuitswilldelaytheeffectsofhypothermiaincoldwater and are available throughmany retailerswho specializeinsalesofmarineproducts.Thesuitsshouldbestoredandmain-tainedaccordingtothemanufacturer’sinstructions.

Inflatable Life Rafts An inflatable life raft can provide a survival platform foran extendedperiodof time.Be suretheliferaftislargeenoughforeveryoneonboardwhen the boat operates off-shore. It should havethe appropriate emergency equipment pack andshouldbeprofessionally servicedperiodically,ac-cording to the manufacturer’s instructions. Coast Guard-approved life rafts must meet a number of stringentmaterialandperformancestandards.

Anchoring Anchoringisdonefortwoprincipalreasons:first, to stop for fishing, swimming, lunch or an overnightstay,andsecondly,tokeepaboatfromrunningagroundinbadweatherorasaresultofenginefailure. Whenpreparingtoanchor,bringthebowofthe vessel into the wind or current. Place the en-gine in neutral.When the boat comes to a stop, slowly lowertheanchor.Donot throw theanchoroveras itwill tend to foultheanchorortangleline.Whentheanchorlinehasbeenletout,backdownontheanchorwiththeengineinidlereversetohelpset the anchor. After it is firmly set, use reference points (landmarks) in relation to the boat to be sure that the boat is not drifting. Check thepointsfrequently.

Communications Thefollowingappliestosaltwaterboating: When boating off-shore, carry communications gear suchas a marine VHF-FM and/or HF transceiver(s), appropriate to the operating area. Cellular phone coverage is available in many coastal areas. However, cellular phones should NOT be consid-ered a substitute for VHF-FM marine band radios for emergency purposes. Satellite EPIRBs (406 MHz) are designed to quickly and reli-ably alert rescue forces, indicate an accurate distress position,andguiderescueunitstothedistressscene,evenwhenallothercommunicationsfail. Whenactivated,thesatelliteEPIRBtransmitsadistresssig-nalwithabeacon-unique identifyingcode.Thesystemdetectsthe signal, calculatesanaccuratedistress position, checks theuniqueidentifyingcodeagainsttheEPIRBregistrationdatabase(vesselandpointofcontactinformationsuppliedbytheowner)and routes thedistressalertwith registration information to theresponsible U.S. Coast Guard (or International) Rescue Coordi-nation Center (RCC). 406MHz EPIRBs with GPS (internal or at-tached) also provide an immediate GPS position in the informa-tion passed to the RCC. Geostationary satellites make detection almost immediate. If the EPIRB does not have the ability to provide a GPS position, theprocesstodetermineapositiontakesaboutanhouronaver-age and almost always less than two hours. Satellite EPIRBs also includeahomingbeaconandstrobetohelprescueforcesquicklylocatethedistressscene. Satellite beacons have significant coverage, alerting time-liness, position accuracy, and signaling advantages over othertypes of EPIRBs (121.5 MHz). Before purchasing or using some-thing other than the 406 MHz EPIRB, be sure to understand the capabilitiesandlimitations. In distress situations, tune the VHF-FM radio to Channel 15 and press the transmit button. Clearly say: MAYDAY, MAYDAY,

MAYDAY.Followthiswiththevesselnameand/ordescription,thelocation,natureofemergencyandnumberofpeopleon-board.Then release the transmit button and wait for 10 seconds. If there isnoresponse,repeattheMAYDAYcall. Further information and a complete listing of VHF channels andfrequenciesisavailableat:www.navcen.uscg.gov.

Law Enforcement A vessel underway, when hailed by a Coast Guard vessel is requiredtoheaveto,ormaneuverinsuchamannerthatpermitsaboarding officer to come aboard. Other federal, state and local law enforcement officials may board and examine a vessel. The Coast Guard may impose a civil penalty up to $1,000 for failure to (i) comply with equipment re-quirements;(ii)reportaboatingaccident;or(iii)complywithotherfederal regulations. Failure to comply with the Inland Navigation Rules Act of 1980 can result in a civil penalty up to $5,000. Details of the Act are available online or through the U.S. Coast Guard and the Coast Guard Auxiliary. Improperuseofaradio-telephoneisacriminaloffense.Theuseofobscene,indecentorprofanelanguageduringradiocom-munications is punishable by a $10,000 fine, imprisonment for two yearsorboth.Otherpenaltiesexistformisuseofaradio,suchasimproper use of Channel 16 VHF-FM. Channel 16 is a calling and distresschannel.Itisnottobeusedforconversationorradiochecks.Such traffic should be conducted on an authorized channel. Note that there are stringent requirements regarding pollu-tion,dischargeofoil, dischargeofgarbageand theoperationanddischargefromsanitationdevices.Itistheboatowner’sandoperator’s responsibility todeterminewhat the lawsandregula-tionsareandtoensurethatthoselawsandregulationsarerespect-edandenforced.Withinbodiesofwaterunderthejurisdictionofthe United States, the Federal Water Pollution Control Act prohibits thedischargeofoiloroilwasteintooruponnavigablewatersifsuch discharge causes a film or sheen upon, or a discoloration of, thesurfaceofthewaterorcausessludgeoranemulsionbeneaththesurfaceofthewater.Violatorsaresubjecttoapenaltyrangingfrom $5,000 to $25,000. Plastic refuse can kill fish and marine wildlife,aswellasfoulboatpropellersandcoolingwaterintakes.Dumpingisprohibited,andlawsextendtorestrictionsongarbagedisposal within specified distances from shore. Details are available through the Coast Guard.


Marpol Treaty Boats26feetorlongermustdisplayasignstatingthedispos-al regulation of the Federal Water Pollution Control Act. The U.S. Coast Guard has issued these regulations to implement pollution controlscommonlyknownastheMarpolTreaty.Theregulationsapply to all U.S. boats wherever they are operated (except waters undertheexclusivejurisdictionofastate)andforeignboatsoper-ating in U.S. waters out to and including the Exclusive Economic

Zone (200 miles). It is important to know these regulations and adheretothem. The regulations require U.S. recreational boaters, if your boat is 26 feet or more in length, to affix one or more USCG TrashDumpingRestrictionsplacards toyourboat.Theplacardwarnsagainst thedischargeofplasticandother formsofgar-bage within the navigable waters of the United States and speci-fies discharge restrictions beyond the territorial sea. (The territorial sea generally ends three nautical miles from the seashore.) Inaddition, the placardmust contain thewarning that a personwhoviolatestheserequirementsissubjecttocivilpenaltiesupto$25,000 and criminal penalties, including imprisonment. The placardalsomustnotethatstateandlocalregulationsmayfur-therrestrictthedisposalofgarbage. Operatorsshalldisplayoneormoreplacardsinapromi-nent location and in sufficient numbers so they can be observed and readbycrewandpassengers. These locationsmight in-cludeembarkationpoints,foodserviceareas,galleys,garbagehandlingspacesandcommondeckspacesfrequentedbycrewandpassengers. Important:Itisillegaltodischargewastefromamarinesani-tarydevice(toilet)intothewaterinmostareas.Itisyourrespon-sibility tobeawareofandadhere toall local lawsconcerningwaste discharge. Consult with the Coast Guard, local marina or yourdealerforadditionalinformation.

Accident Reports After an accident, the boat operator is responsible for fil-ingareportwithappropriateauthorities.Reportsarerequiredby the Federal Boating Safety Act for accidents involving loss of life, injury or damages over $500. Insurance agents are a good source of information. Local authorities can also provide detailsregardingreportingrequirements. Intheeventofsightingdistresssignals,youmustassumethatit is a real emergency and render assistance immediately. Thepersoninchargeofaboatisobligatedbylawinmostauthoritiestoprovideassistancetoanyindividualindangeratseaoronanybody of water. However, never put your crew or passengers in dangerorinasituationthatexceedsyourcapabilitiesorthoseoftheboat.


ThisOwner’sManualhasbeendevelopedtohelpensureanenjoyableexperienceasyouboat.Asstatedearlier,thisinforma-tionisnotall-inclusive.Therearemanyfactorstoconsiderandad-ditionalinformationthatyouneedtoresearchbeforeundertakinganyboatingactivity. InadditiontoreadingthisOwner’sManualorotherrelatedmaterial,andfamiliarizingyourselfwiththeproperoperationoftheHydra-Sports boat, you should always use common sense when boating. For example, when the boat is anchored, you MUST turn OFF theengine.Exhaust fumescontainingcarbonmonoxideareemittedfromthelowerunitontheoutboardenginenearthepro-peller,which isalsonear the transomandswimplatform,whereequipped. No one should ever be on the swim platform or transom whiletheengineisoperating.Thisincludeswhileusingtheshower.Inthoseinstances,showeringmustneverbedoneontheswimplat-formortransomasthecarbonmonoxidefumesaretoxic. Yourboatcanbethesourceofcountlesshoursoffamilyfun,aswellasbuildingfriendships.ButitworksonlyifYOUuseyourheadbefore,duringandafteryourboatingactivity. As you anticipate many good times ahead with the Hydra-Sports boat, be sure that, first and foremost, you are well-prepared tobearesponsibleoperator.

Carbon monoxide is a colorless, tasteless, odorless and poi-sonous gas that accumulates rapidly and can cause serious injury or death. Exposure to carbon monoxide can be fatal in a matter of minutes. Exposure to even low concentrations of carbon monoxide must not be ignored because the effects of exposure to carbon monoxide can build up and be just as lethal as high concentrations. Carbon monoxide from exhaust pipes of inboard or outboard engines may build up inside and outside the boat in areas near exhaust vents, particularly dur-ing slow-speed operations. STAY AWAY from these exhaust vent areas, which are located near the stern of the boat, and DO NOT swim or engage in any watersports or other activi-ties in or near the stern area of the boat, including, without limitation, the swim platform, when the engine is in opera-tion. Under no circumstances should the owner and/or oper-ator allow persons to hold onto the swim platform while the engine is operating and the boat is in motion. These activities (sometimes known as “teak surfing” or “platform dragging,” where the participant holds onto the swim platform and is pulled through the water, and/or “body surfs” immediately behind the boat) are extremely dangerous, highly likely to re-sult in death or serious bodily injury, and are a misuse of this product.

Overloadingaboatmaycauseittobecomeunstableandmay potentially result in the boat’s flotation system becoming over-whelmed. Toomuchweight can sink any boat! Bear inmindthattotalweightincludesballast,gearbroughtontotheboat,ad-

ditionaloptionsandallpeople.Equallycriticalishowweightisdistributed throughout theboat. If toomuchweight isplaced inoneareaitcanhaveseriousimpactonmaintainingcontrol.Itemsandpeoplecanalsoshiftpositionsduringoperation,potentiallycausingadangeroussituation.

All boats have weight limits. Failure to adhere to the post-ed limits can cause operation instability and/or the boat to sink. This may result in serious injury or death, as well as significant damage to the boat, which will not be covered by warranty. The number of persons who can safely be aboard may be limited by available seats and leaning posts.

See information specific to the your model in the “Guide to IndividualModels”forguidance. Incalculatingtheamountofweight,youmustalsotakeintoconsiderationtheweightofthegasolineinremovablecontainersandanyballastadded.Theweightofgasolineisapproximately5.8 to 6.5 pounds (U.S.) per gallon, depending upon the weather andotherfactors,includingtheadditionofethanol,whichisslight-lydenserandwilladdveryslightlytotheoverallweight.Waterpumped into the freshwater system will add 8.3 pounds (U.S.) for everygallonadded. Care should also be taken to avoid interfering with the boat operator’s lineofsightwhentheboatisunderway.Thisappliesparticularlytoindividualsridinginthebow.Itispossibletounin-tentionallyobscurethedriver’sview.Evenmomentaryinterferencecan result in the driver’s inability to respond to a situation thatrequiresavoidanceofanother vesselor submergedorpartially-submergedobjects.Attentionshouldalwaysbepaidbyeveryoneonboardtobeingsupportiveoftheboatoperator. Hydra-Sports strongly encourages individuals to wear Person-alFlotationDevices(PFDs).Inmanystates,itisalegalrequirementfor children to wear them. Non-swimmers and swimmers of limited abilityofanyageshouldneverbewithoutone. Avoidactivitythatmayresultindamagetotheboat,therebyvoiding the warranty. Some things, such as avoiding stationary objects,areobvious.Othersmaybemoresubtle reminders thatevenawell-builtboatissubjecttodamage.Forexample,whileabeachorshorelinemaybesofttowalkon,runningaboatupontoshore may result in significant scratches in the fiberglass finish. This kindofdamageisusuallyobvioustotrainedservicepersonnelandisnotcoveredbywarranty. Hydra-Sports cannot anticipate and warn against every in-stanceofactivityorneglect thatcouldresult indamageto theboat or illness, injuryor evendeath toboaters. Theoperator,ownerand/orall personsonboardare responsible for usingcommonsenseandacarefulthoughtprocesstoensurethateverymeasure has been taken to keepboating enjoyable formanyyearstocome.

C O M M O N S E N S E A P P R O A C H4 4 4

2011 Hydra-Sports Owners Manual • Common Sense Approach • Page 2-1

Justastherearerulesthatapplywhendrivingavehicleonthestreet,therearewaterwayrulesthatapplywhenyouaredriv-ingaboatonthewater.Theserulesareusedinternationally,andthey are enforced by the United States Coast Guard and local agencies.You shouldbeawareof these rulesand follow themwheneveryouencounteranothervesselonthewater. In various geographic locations, certain rules prevail thatmaybeuniquetothelocale.Eachstatealsohaslawsandboatinglimitations thatmaybeapplicableonlywithin theirboundaries.It is theoperator’sresponsibility toseekout this informationandbecomefamiliarwithallsafety-relatedinformation,lawsandrulesgoverningboatingoperation. TherulespresentedinthisOwner’sManualarecondensedand have been provided for convenience only. Consult your lo-cal U.S. Coast Guard Auxiliary (USCGA), Department of Motor Vehicles (DMV) or Department of Natural Resources (DNR) for a completesetof rulesgoverning thewaters inwhichyouwillbeusingyourboat.Ifyouplantotravel—evenforashorttrip—youwould be well-served to contact the regional USCGA, DMV or DNR in the area where you will be boating. Often, basic informa-tion is available through websites sponsored and prepared bytheseorganizationsandgoverningbodies.

Steering and Sailing Rules/Sound Signals Anytimetwo(2)vesselsonthewatermeetoneanother,onevessel has the right-of-way. It is called the stand-on vessel. Thevessel that does nothavetheright-of-wayis called the give-way or burdenedvessel. These rules de-terminewhichvesselhastherightofway,and accordingly,what each vesselshoulddo. The vessel withthe right-of-way hasthe duty to continueitscourseandspeed,except to avoid animmediate collision.When you maintainyour direction andspeed,theotherves-sel will be able todetermine how besttoavoidyou. Thevesselthatdoesnothavetherightofwayhasthedutytotakepositiveandtimelyactiontostayoutofthewayofthestand-on vessel. Normally, the give-way vessel should not cross in front of the stand-on vessel. Slow down or change direction briefly and passbehindtheothervessel.Youshouldalwaysmoveinsuchawaythatthestand-onoperatorcanseewhatyouaredoing.

Rules When Encountering Vessels Therearethree(3)mainsituationsinwhichyoumayencoun-terothervessels,andyoumustavoidacollision.Theseare:• Meeting(youareapproachinganothervesselhead-on).• Crossing (you are traveling across the other vessel’s path).• Overtaking(youarepassingorbeingpassedbyanotherves-

sel).

Meeting Ifyouaremeetinganothervesselhead-on,andyouarecloseenoughtoruntheriskofcollision,neitherofyouhastheright-of-way.Bothofyoushouldaltercourse toavoidanaccident.Youshould keep the other vessel on your port (left) side. (This ruledoesn’tapplyifbothofyoucancleareachotherbycontinuingyoursetcourseandspeed.)

Crossing Whentwo(2)power-drivenvesselsarecrossingeachother’spathcloseenoughtoruntheriskofcollision,thevesselthatviews

R U L E S O F T H E O P E N WAT E R4 4 4

2011 Hydra-Sports Owners Manual • Rules of the Open Water • Page 3-1

thecrossingvesseltothe starboard (right)sidemustgiveway.Iftheothervesselistotheport(left)side,youarethestand-onvessel,andprovidedtheothervesselgivesyoutheright-of-way,maintainyourcourseanddirection.

Overtaking Ifyouarepassinganothervessel,youare the give-way vessel. This means thattheothervesselisexpectedtomaintainitscourseandspeed.Youmuststayoutofitsway as you clear it, altering course andspeedasnecessary. Conversely, if you are being passed byanothervessel,youarethestand-onves-sel, and you shouldmaintain your speedand direction so that the vessel can besteeredaroundyou.

Other Special Situations Thereareadditionalrulestorememberwhenoperatingyourboataroundothervessels,suchas:• Whennavigatinginnarrowchannels,youshouldkeeptothe

rightwhenitissafeandpracticaltodoso.• When preparing to go around a bend that may obstruct

your viewofotherwater vessels, you should soundapro-longed blast on the horn or with a whistle for four (4) to six (6) seconds.Evenifnoreplyisheard,youshouldstillproceedaroundthebendwithcaution.

Sailing Vessel Right-of-Way Sailing vessels should normally be given the right-of-way. The exceptionstothisare:• Whenthesailingvesselisovertakingthepower-drivenvessel,

thepower-drivenvesselhastheright-of-way.• Sailing vessels should keep clear of any fishing vessel.• Inanarrowchannel,asailingvesselshouldnothamperthe

safepassageofapower-drivenvesselthatcannavigateonlyinsuchachannel.

Fishing Vessel Right-of-Way Under international rules, all vessels that are fishing with nets,

lines or trawls are considered to be fishing vessels; however, boats with trolling lines are not considered fishing vessels. Fishingvesselshavetherightofway,regardlessofposition,but thesevesselscannotimpedethepassageofothervesselsinnarrowchannels.

The General Prudential RuleThis rule is called Rule 2 in the International Rules and says, “In obeying and construing these rules due regard shall be had to all dangers of navigation and collision, and to any special circumstances, which may render a departure from the above rules necessary in order to avoid immediate danger.”

Reading Buoys and Other Markings The waters of the UnitedStates are marked for safe navigation by the lateral systemof buoyage. The markers andbuoys you encounter will havean arrangement of shapes, col-ors,numbersandlightstoshowwhichsideofthebuoyaboatershouldpasswhennavigatinginaparticulardirection. Themarkingsonthesebuoysareorientedfromtheperspectiveofbeingenteredfromaseawarddirectionwhiletheboaterisgo-ing toward theport. Redbuoysare passed on the starboard(right) side when proceedingfromopenwater intoport, andgreenbuoysarepassedon theport(left)side.Whennavigatingoutofport,yourposition to thebuoys should be reversed: redbuoys to port (left) and greenbuoystostarboard(right). Manybodiesofwaterareentirelywithintheboundariesofasingle state. The Uniform State Waterway Marking Systems have beendevisedforthesewaters.Thissystemusesbuoysandsignswithdistinctiveshapesandcolorstoshowregulatoryoradvisoryinformation.Thesemarkersarewhitewithblacklettersandorangeborders. The information signifies speed zones, restricted areas, dangerareasandgeneralinformation. Remember:Markingsmayvarybygeographiclocation.Al-ways consult appropriate boating authorities before boating inunfamiliarwaters.

2011 Hydra-Sports Owners Manual • Common Sense Approach • Page 3-2

Aft:In,near,ortowardthesternofaboat.Aboard:On,inorintoaboat.ABYC: American Boat and Yacht Council, the organization that

setsvoluntarysafetyandconstructionstandardsforsmallcraftin the U.S.

Adrift:Withoutmotivepowerandwithoutanchorormooring.Afloat:Onthewater.Aground:Aboatstuckonthebottom.Amidships:Inortowardthepartofaboatmidwaybetweenthe

bowandstern.Anchor:Aspeciallyshapedheavymetaldevicedesignedtodig

efficiently into the bottom under a body of water and hold a boatinplace.

Anchorage: An area specifically designated by governmental au-thoritiesinwhichboatsmayanchor.

Ashore:Onshore.Astern:Behindtheboat,tomovebackwards.Athwartship:Atrightanglestothecenterlineoftheboat.Aweigh:Anchorisoffthebottom.

Bail:Toremovewaterfromaboatbypumporbailer.Barnacles: Small, hard-shelled marine animals that are found in

saltwaterattachedtopilings,docksandbottomsofboats.Beacon:Apostorbuoyplacedoverashoalorbanktowarna

vessel.Alsomaybeasignalmarkonland.Beam: Thebreadth orwidth of aboat usuallymeasuredat its

widestpart.Bearing:Thedirectionofanobjectfromtheboat,eitherrelativeto

theboat’sdirectionortocompassdegrees.Below:Beneathorunderthedeck.Berth:Abunkorabedonaboat.Bilge: The bottom of the boat below the flooring.Bilge pump: A pump that removes water that collects in the

bilge.Boarding: Entering or climbing into a

boat.Boarding ladder: Set of steps temporarily

fitted over the side of a boat to assist personscomingaboard.

Boat hook: Short shaft of wood or metal with a hook fitting at one end shaped toaid inextendingone’s reach fromthesideoftheboat.

Bollard: A strong post for holding linesfast.

Bottom:Theintersectionofthebodyofwa-terandlandbelowit.

Bow: Thefrontendofaboat’shull.Bow line:Alinethatleadsforwardfromthe

bowoftheboat.Bow rail:Kneehighrailsofsolidtubingto

aid inpreventingpeople from fallingoverboard.

Breakers: Waves cresting as they reach

shallowwater.Breakwater:Astructure,usuallystoneorconcrete,builttocreate

aharbororimproveanexistingone.Bridge:Theareafromwhichaboatissteeredandcontrolled.Bridge deck: A deck forward and usually above the cockpit

deck.Broach:Whentheboatissidewaystotheseasandindangerof

capsizing;averydangeroussituationthatshouldbeavoid-ed.

Bulkhead:Verticalpartitionorwallseparatingcompartmentsofaboat.

Cabin:Enclosedsuperstructureabovethemaindecklevel.Capsize:Whenaboatlaysonitsideorturnsover.Cardinal points:Thefourmainpointsofacompass:north,east,

southandwest.Chart:Amapofabodyofwaterthatcontainspilotinginforma-

tion.Chine:Theintersectionofsidesandbottomofaboat.Chock: A deck fitting, usually of metal, with inward curving arms

throughwhichmooringoranchorlinesarepassedsoastoleadthemintheproperdirectionbothonboardandofftheboat.

Cleat: A deck fitting, usually of metal, with projecting arms used forsecuringanchorandmooringlines.

Closed cooling system: A separate supply of freshwater that isusedtocooltheengineandcirculatesonlywithintheengine.

Coaming:Averticalpiecearoundtheedgesofcockpit,hatches,etc.tostopwaterondeckfromrunningbelow.

Cockpit:Anopenspace,usually in theaftdeck,outsideof thecabin.

Companionway:Openinginthedeckofaboattoprovideac-cessbelow.

B O AT I N G T E R M I N O L O G Y4 4 4

2011 Hydra-Sports Owners Manual • Boating Terminology • Page 4-1

Compartment:Theinteriorofaboatdividedoffbybulkheads.Compass:Theinstrumentshowingtheheadingofavessel.Cowls: Hooded openings used for ventilation.Cradle:Aframeworkdesignedtosupportaboatassheishauled

outorstored.Cutlass bearing:Arubberbearing in thestrut thatsupports the

propellershaft.Current:Themovementofthewaterinahorizontaldirection.

Deadrise: The riseof thebottomofamidship’s frame from thekeeltothebilge.

Deck: The floor-like platform of a boat that covers the hull.Displacement: The volumeofwater displacedby the hull. The

displacementweightistheweightofthisvolumeofwater.Draft: The depth of water a boat needs to float.Dry rot:Afungusattackonwoodareas.Dry-dock:Adockthatcanbepumpeddryduringboatconstruc-

tionorrepair.

Ebb:Anoutgoingtide.Electrical ground:Aconnectionbetweenanelectricalconnector

andtheearth.Engine beds: Sturdy structural members running fore and aft on

whichtheinboardenginesaremounted.EPIRB:EmergencyPositionIndicatingRadioBeacon.Operatesas

apartofaworldwidesatellitedistresssystem.Estuary:Aninletorarmofthesea.Even keel: When a boat floats properly, as designed.

Fathom: A measure of depth. One fathom equals six (6) feet(1.8288meters).

Fender:Asoftobjectofrubberorplasticusedtoprotectthetop-sidesfromscarringandrubbingagainstadockoranothervessel.

Fend off:Topushorholdtheboatofffromthedockoranotherboat.

Flying bridge:Acontrolstationabovethe levelof thedeckorcabin.

Flukes:Thebroadportionsofananchorthatdigintotheground.Fore:Appliestotheforwardportionsofaboatnearthebow.

Foundering: When a boat fills with water andsinks.Freeboard:Theheightfromthewaterlinetothelowestpartofthedeck.

Galley:Thekitchenofaboat.Grab rail: Handhold fittings mounted on cabintopsorsidesforpersonalsafetywhenmovingaroundtheboat,bothondeckandbelow.Ground tackle: A general term includinganchors, lines,andothergearusedinan-choring.Grounds:Aboattouchesthebottom.Gunwale:(Pronounced“gunnel”)Theupperedgeofaboat’sside.

Hand rail: Rail mounted on the boat, forgrabbing with your hand, to steady youwhilewalkingabouttheboat.Harbor: An anchorage that provides rea-sonably good protection for a boat, with

shelterfromwindandsea.Hatch:Anopeninginthedeckwithadoororlidtoallowforac-

cessdownintoacompartmentofaboat.Head:Atoiletonaboat.Heat exchanger:Usedtotransfertheheatthatispickedupbythe

closedcoolingsystemtotherawcoolingwater.Helm:Thesteeringandcontrolareaofaboat.Holding tank: Storage tank for sewage so that it will not be

pumpedoverboard.Hull:Thepartoftheboatfromthedeckdown.

Inboard:Aboatwith theenginemountedwithin thehullof theboat. Also refers to the center of the boat away from thesides.

Inboard/outboard:Alsosterndriveor I/O.Aboatwithanin-boardengineattachedtoanoutboarddriveunit.

Inland rules:Rulesthatapplytovesseloperationinharborsandcertainrivers,lakesandinlandwaterways.

Jetty:Astructure,usuallyofmasonry,projectingoutfromtheshore.Mayprotectaharborentrance.

Keel:Aplateortimberplaterunninglengthwisealongthecenterofthebottomofaboat.

Knot:Unitof speed indicatingnauticalmilesperhour. 1knotequals 1 nautical mile per hour (1.15 miles per hour/1.85 kilometersperhour).Anauticalmileisequaltooneminuteof latitude: 6076 feet (1852 meters).

Launch:Toputavesselintothewater;orasmall,openpowerboatmainlyusedfortransportationbetweenavesselandshore.

Lay-up:Todecommissionaboatforthewinter(usuallyinnorthernclimates).

Leeward:Thedirectiontowardwhichthewindisblowing.Length on the waterline (l.w.l.):Alengthmeasurementofaboat

at thewaterline fromthestern towhere thehullbreaks thewaternearthebow.

Limber hole: A passage cut into the lower edges of floors and frames next to the keel to allow bilge water to flow to the low-estpointofthehull,whereitcanbepumpedoverboard.


Line:Thetermusedtodescribearopewhenitisonaboat.Lists: A boat that inclines to port or starboard while afloat.L.O.A.:Boatlengthoverall.Locker:Acloset,chestorboxaboardaboat.Loran: An electronic navigational instrument that monitors the

boat’sposition,usingsignalsemittedfrompairsoftransmit-tingstations.

Lunch hook:Asmalllightweightanchortypicallyusedinsteadofthe working anchor. Normally used in calm waters with the boatattended.

MAYDAY:Aradiodistresscall;fromFrenchm’aidez(helpme).Midships:Thecenteroftheboat.Marina:Aprotectedfacilityprimarilyforrecreationalsmallcraft.Marine ways or railways: Inclinedplanesat thewater’sedge

ontowhichboatsarehauled.Moored:Aboatsecuredwithcables,linesoranchors.Mooring:Ananchorpermanentlyembeddedinthebottomofa

harborthatisusedtosecureaboat.

Nautical mile:Aunitofmeasureequaltooneminuteoflatitude.(6076 feet/1852 meters).

Navigation:Theartofconductingashipfromporttoport.Nun buoy:Aredorred-stripedbuoyofconicalshape.

Outboard: A boat designed for an engine to be mounted onthetransom.Alsoatermthatreferstoobjectsawayfromthecenterlineorbeyondthehullsidesofaboat.

Pad eye: A deck fitting consisting of a metal eye permanently securedtotheboat.

Pier:Astructurethatprojectsoutfromtheshoreline.Pile or piling:Alongcolumndrivenintothebottom,towhicha

boatcanbetied.Pitching:Theforeandaftrockingmotionofaboatasthebow

risesandfalls.Pitch:Themeasureoftheangleofapropellerblade.Referstothe

theoreticaldistancetheboat travelswitheachrevolutionofthepropeller.

P.F.D.: Personal flotation device.Port: Theleftsideoftheboatwhenfacingthebow.Porthole (port):Theopeningin thesideofaboat toallowthe

admittanceoflightandair.Propeller:Adevicehavingtwoormoreblades,thatisattached

totheengineandusedforpropellingaboat.Propeller shaft: Shaft that runs from the back of the engine gear

box, aft, through the stuffing box, shaft log, struts, and onto whichthepropellerisattached.

Pyrotechnical Distress Signals:Distresssignalsthatresemblethebrilliant display of flares or fireworks.

Raw water cooled:Referstoanenginecoolingsystemthatdrawsseawater in through a hull fitting or engine drive unit, circu-lates thewater in theengine,and thendischarges itover-board.

Reduction gear:Oftencombinedwiththereversegearsothatthepropellerturnsataslowerratethantheengine.

Reverse gear: Changes the direction of rotation of the propeller toprovidethrustintheoppositedirectionforstoppingtheboatorgivingitsternway.Roll:Aboat’ssidewaysrotationalmotioninroughwater.Rope locker:Alocker,usuallylocatedinthebowofaboat,usedforstowingtheanchorlineorchain.Rubrail:Railing(oftenrubberorhardplas-tic)thatrunsalongtheboat’ssheertopro-tectthehullwhencomingalongsidedocks,piers,orotherboats.Rudder: A moveable flat surface that is attached vertically at or near the stern forsteering.

Sea anchor:Ananchorthatdoesnottouchthebottom.Providesdragtoholdthebowinthemostfavorablepositioninheavyseas.Scupper:Anopeninginthehullsideortran-somoftheboatthroughwhichwaterondeckorinthecockpitisdrainedoverboard.Seacock: Safety valves installed just inside the thru-hull fittings and ahead of the piping

or hose running from the fittings.Seat: Portionoftheboatdesignedtobeoccupiedbyapersonat

boat speeds above 5 mph.Sheer:Theuppermostedgeofthehull.Sling:Astrapwhichwillholdtheboatsecurelywhilebeinglifted,

lowered,orcarried.Slip:Aboat’sberthbetweentwopilingsorpiers.Sole:Thedeckofacockpitorinteriorcabin.Spring line:Alinethatleadsfromthebowaftorfromthestern

forwardtopreventtheboatfrommovingaheadorastern.Starboard:Therightsideofaboatwhenfacingthebow.Steerageway: Sufficient speed to keep the boat responding to the

rudderordriveunit.Stem:Theverticalportionofthehullatthebow.Stern:Therearendofaboat.Stow:Topackawayneatly.Strake:Planksrunningforeandaftontheoutsideofavessel.Stringer: Longitudinal members fastened inside the hull for addi-

tionalstructuralstrength.Superstructure: Something built above the main deck level.


Swamps: When a boat fills with water from over the side.Swimming ladder:Muchthesameastheboardingladderexcept

thatitextendsdownintothewater.

Taffrail:Railaroundtherearcockpit.Thru-hull: A fitting used to pass fluids (usually water) through the

hullsurface,eitheraboveorbelowthewaterline.Topsides:Thesideskinofaboatbetweenthewaterlineorchine

anddeck.Transom: A flat stern at right angles to the keel.Travel lift:Amachineusedatboatyardstohoistboatsoutofand

backintothewater.Trim:Referstotheboat’sangleorthewayitisbalanced.Trough:Theareaofwaterbetweenthecrestsofwavesandparal-

leltothem.Twin-screw craft:Aboatwith twopropellers on two separate

shafts.

Underway:Whenaboatmovesthroughthewater.

Wake:Disruptedwaterthataboatleavesasternasaresultofitsmotion.

Wash: The flow of water that results from the action of the propel-lerorpropellers.

Waterline:Theplaneofaboatwhere thesurfaceof thewatertouches the hull when it is afloat on even keel.

Watertight bulkhead:Bulkheadssecuredsotightlysoasnottoallowwatertopass.

Wharf: Astructuregenerallyparalleltotheshore.Working anchor:Ananchorcarriedonaboatformostnormal

uses. Refers to the anchor used in typical anchoring situa-tions.

Windlass:Awinchusedtoraiseandlowertheanchor.Windward:Towardthedirectionfromwhichthewindiscoming.

Yacht basin:Aprotected facilityprimarily for recreational smallcraft.

Yaw: Whenaboatrunsoffcoursetoeitherside.


guide to individual

models

B ay B o lt 1 94 4 4

a

A = Baitwell with light or storageB = Fish box or storage compartmentC = Navigation light baseD = Remote oil fill (optional)E = Bench seat with cushions and removable back restsBilge access under aft bench seat

B B

C d

A = Storage compartmentB = Trolling motor (optional)C = Stainless steel cleatD = Rod holderE = DrainsF = L.E.D. light

a

e

B

C

d

eF F

e

a a

a

C

d

See the Instrument Gauges and Switches section of this Owner’s Manual for more information regarding the equipment found at the helm.

A = Storage binB = Navigation light holderC = Gunwale bolsterCooler forward of console

2011 Hydra-Sports Owners Manual • Guide to Individual Models • Page 5-2

a

BC

A = Clarion AM/FM CD player (Optional)B = Courtesy lightC = Rod holders (both sides of console)D = Subwoofer (Optional)

da

B

C

B ay B o lt 2 34 4 4

A = Anchor lockerB = Storage compartmentC = Mount for casting seatD = BaitwellE = Fish boxF = Fish boxG = Storage compartment

B

Cd

e

F

a

A = Engine mountB = Stern light receptacle baseC = Storage compartmentsD = LivewellE = DrainF = Pump room

BC

e e

d

F

a

aC

A = Three-drawer tackle box (port and starboard sides)B = Self-draining cockpitC = Rod holderD = Stainless steel cleatE = Bilge accessF = Helm seat handrailG = LivewellH = Padded helm seat/leaning postI = Plumbing access

C

d

e

F g

a

C


A = Battery access G = WindscreenB = Helm storage bin H = Cooler with padded seatC = CupholdersD = Console rod holdersE = Raw water washdownF = Stainless steel hand rail

H

C d

BF

ea

g


g

B

C

H

i

1 8 0 C C4 4 4

a

B

C

a

A = Anchor locker

A = Rod holderB = Access door to livewellC = Plumbing access


A = Piehole access G = Stainless steel hand railB = Bow hand rail H = Storage boxC = Fuel fillD = Rod holders (in gunwale)E = Accessory plugF = Cupholders

C

d e

F

g

a

A = WindscreenB = Bow cooler (can be used as seat)C = Helm seatD = Swim platform with swing-down two-step boarding ladderE = Rod holder

C

d

B e

a


B

gH

i

2 1 0 0 W a4 4 4

A = Stainless steel bow railB = Anchor lockerC = Hatch access to cabin belowD = Windshield

BC

da

A = Engine mountB = Navigation/anchor light receptacle baseC = Stainless steel cleatD = Rod holderE = Removable seat cushion with storage below and bilge accessF = Stainless steel hand railG = Rod holder in gunwaleH = Self-draining cockpitI = Shore power plug-in (optional)J = Storage compartmentK = Piehole access to fuel tank

BCd

F Fe

g H

a

A = Hatch access to bow deckB = Access to anchor lockerC = Padded back restD = Padded seat cushion with storage belowE = CupholderF = Self-contained head

de F

a

C


A = Companion helm seat F = Rod holder in gunnelB = Driver helm seat (also on port side)C = Molded seating with storage beneath D = Rod holderE = Swim platform with swing-down two-step boarding ladder

C

d

B

F

e

a


BC

Cd

e

gH

iJ

K

dd

dd

2 0 2 d C4 4 4

A = Navigation lightB = Anchor lockerC = Stainless steel cleatD = Stainless steel bow railE = Storage/fish boxF = Removable bow seatingG = Cupholder

BC

d e

F

a

A = BaitwellB = Jump seat with cushionC = Stainless steel hand railD = Stainless steel cleatE = Navigation light receptacleF = CupholderG = Self-draining cockpitH = Rod holders in gunwale

BCd

FH

e

gH

a d


A = Bow cushion with back restB = Stainless steel cleatC = Fuel tank fillerD = Rod holderE = Head compartment with portable toiletF = Access door to head compartment

Cd

eF

a

A = Aft-facing seatB = Rod holderC = Stainless steel cleatD = Integrated swim platformE = Rod holders in gunwale

B

C

d

B

Bea C


g

Bi

C

d

g

F

C

Fg

B

2 1 0 0 C C4 4 4

A = Anchor lockerB = Center bow seating with optional cushionC = Optional cushions over bow seating with fish boxes belowD = Padded back restE = Storage compartmentF = Padded seat over cooler, forward of center console

B

C

e F

a

A = Battery accessB = Self-draining cockpit

B

a


A = Stainless steel cleatB = Stainless steel hand railC = Cupholders

C

a

A = Stainless steel cleat J = Rod holders in gunwaleB = Navigation light K = Aft seatingC = Tow eye L = Swim platform with swing-downD = Head compartment two-step boarding ladderE = VHF radio antenna F = T-Top G = Navigation/anchor lightH = Rod holders on T-TopI = Pedestal seats

H

Cd

B

gF

a

e


B

C d

F

Bi J K

l

2 3 0 0 D C4 4 4

A = Stainless steel cleatB = Windlass with anchor (optional)C = Anchor lockerD = Bracket for bow boarding ladder (optional)E = Stainless steel bow railF = Padded seat cushions with storage compartments beneathG = CupholdersH = Courtesy lightsI = Storage compartment

B C D

F

G

A = Gunwale paddingB = Rod holderC = Gunwale storage binD = Stainless steel hand railE = LivewellF = Transom doorG = Pump room

B

C

D

FE

A

A = Head compartment with toiletB = Magazine rackC = Toilet paper holderD = Head pump-out panelE = Sink with single controlF = Head compartment lights

C

D E

F

A


A = Storage compartmentB = Swivel helm seatC = Freshwater sink with single controlD = Cup holderE = Clarion AM/FM CD Player Stereo (optional)

C

D

B

EA


H

B

I

AA

E

FF

G

H

GG IG

2 3 0 0 C C4 4 4

A BCA

A = Access to anchor locker (also door on top of bow)B = Fish box/storage compartmentC = Padded back rest and cushion over compartmentsD = Stainless steel cleatE = Padded cushion on seat forward of console

A = VHF Radio antennaB = GPS antenna (optional)C = T-TopD = Foldable navigation lightE = Windscreen (tempered glass)F = Head compartment, access on port sideG = Rod holdersH = Stainless steel hand railI = Padded aft seating with foldable cushionJ = Transom door


A = Stainless steel cleat G = Helm storage binB = Rod holderC = Padded helm back rest and cushionD = FootwellE = Cup holderF = Clarion AM/FM CD Player Stereo (optional)

C

DE

FG

A

A = Head compartment with portable toiletB = Courtesy shelf with cupholderC = Boarding ladder storage

C

BA


B

B

B

C

CDD

E

D

E

F

GG

H

IJ

C

2 3 0 0 V X4 4 4

A = Windlass with anchorB = Stainless steel bow railC = Hatch access to cabin belowD = VHF Radio AntennaE = HornF = Spotlight (optional)G = HardtopH = OutriggerI = Hardtop rod holdersJ = Fuel tank fillerK = Integrated swim platform

CC

D

A

A = Rod holders, under gunwaleB = Padded back rest and cushions, foldableC = Storage compartmentD = Stainless steel hand railE = Transom doorF = Bilge accessG = Piehole access to fuel tankH = Rod holderI = Self-draining cockpit

B

C

D

FH

A

A = Hatch access to bow deckB = Access to anchor lockerC = Stereo speakersD = Rod holdersE = Padded back restF = Padded seat cushionG = Removable cabin tableH = Head compartment

DE

F

A

C


A = Windshield G = Rod holders under gunwaleB = Cabin access door H = Piehole access to fish box drainC = Stainless steel hand rail I = Padded cushion over baitwellD = Cup holder J = Shore power plug-inE = Padded back rest and K = Stainless steel cleatcushion over fish box L = Padded pedestal seatF = Rod holder

H

CD

B

I

E

A


B

D E

G

H

G

D

F

G

A

BC

I

I

C

E

FH

F

J

KL

BEF

G

K

HI

J

2 5 0 0 C C4 4 4

A = Navigation light B = Anchor lockerC = Stainless steel cleatD = Anchor locker accessE = Stainless steel bow railF = Fish box/storage compartmentG = Storage compartment

B C

DE

F

A

A = Rod holders under gunwaleB = Heavy duty snap hold for transom doorC = Courtesy lightD = Rod holderE = Transom doorF = LivewellG = SinkH = Foldable aft bench seatI = Raw water washdown

BC

D

H

E

G

I

A

D

Shown is the optional Bait Station. In boats with standard installation, a removable cooler with cushion seat is located here. There is also a similar cooler forward of the console on all 2500CC boats.

A = Bait station G = Rod holder in gunwaleB = BaitwellC = Rod holderD = Stainless steel hand railE = Access to plumbingF = Stainless steel hand rail

C

D

EF

A


A = Storage binsB = Helm storage compartmentC = Cupholders

C

BA

C


G

B

G

C

EF

F

C F

A

2 5 0 0 V X4 4 4

A = Windlass with anchor L = Integrated swim platformB = Stainless steel bow railC = Hatch access to cabin belowD = Spotlight (optional) E = VHF Radio antennaF = HornG = HardtopH = Navigation lightI = Navigation/anchor lightJ = Rod holderK = Fuel tank filler

B G

E H

A

A = Rod holderB = SinkC = Access to bilge D = Foldable padded aft bench seatE = LivewellF = Piehole access to fuel tankG = Hot/cold shower controls (optional)H = Heavy-duty snap to transom doorI = Transom doorJ = Rod holder under gunwale

AG H

A = Hatch access to bowB = Cabin lightingC = Stereo speakersD = Anchor locker accessE = Padded back restF = Padded cushionG = Removable tableH = Galley, including sink, microwave, refrigerator and electronics

C

A


A = Cabin access doorB = FootrestC = WindshieldD = Padded helm driver’s seatE = Midship padded seating

C

DA


B

C

DF

B

IJ

K

L

A

E

BC

DF

JI

B

B BCD

E E

FFG

H E

3 0 0 0 C C4 4 4

A = Anchor lockerB = Stainless steel cleatC = Access to anchor lockerD = Stainless steel bow rail E = Fish box/storage compartmentF = Storage compartment

B A

D

B

A = Rod holderB = SinkC = Pump roomD = Foldable padded aft bench seatE = LivewellF = Self-bailing drainG = Transom doorH = Courtesy lightI = Rod holder in gunwale

GH


A = Storage binB = Drop-down padded helm seatingC = FootrestD = Helm storage binE = Cup holdersF = Stainless steel hand rail

A

A = Horns G = Integrated swim platformB = VHF Radio antenna H = Fuel tank fillerC = OutriggerD = T-TopE = Rod holdersF = Bait station (optional)

B

C

A


B

C

D

F

E E

A

E

B

C

DF

I

C

DE

F

D

F

E

G

H

3 0 0 0 V X4 4 4

A = Windlass with anchorB = Anchor lockerC = Hatch access to cabin belowD = WindshieldE = Stainless steel cleat

AB

A = Rod holder under gunwaleB = Rod holderC = SinkD = LivewellE = Foldable padded cushion with back restF = Pump roomG = Piehole access to fuel tankH = Integrated swim platformI = Transom doorJ = Access to bilgeK = Self-draining cockpit

G

H

See the Instrument Gauges and Switches section of this Owner’s Manual for more information regarding the equipment found at the helm.A = Fuel tank filler B = CleatC = Shore power connectionD = Cabin access doorE = Integrated step to bowF = Tackle drawersG = Galley up stoveH = Baitwell

A

A = Rod holders on hard topB = Padded helm seat with bolsterC = Storage binD = Tackle drawersE = Padded helm passenger seatF = Cooler under seatingG = Cup holders

B

A


B

C

D

A

E

AE

B C

D

F

I

CD E

F

D E G

FC

J

K

G

H

3 0 0 0 V X4 4 4

A = Galley, including sink, microwave, refrigerator and electronicsB = Hanger eye for hanging bunkC = Cabin lightingD = Hatch access to bowE = Stereo speakersF = Anchor lockerG = Padded back rests and cushionsH = Removable table

B

A

DB

A = Door to head compartmentB = Mid-cabin berthC = Sliding sleeping curtainD = Berth lightingE = Access to shower sumpF = StepsG = Refrigeration

G

A = Granulon countertop and backsplashB = Faucet with hot/cold tapsC = Access to under-sink storage compartmentD = Switch panelE = Head flush panelF = Vacuflush head with 12 gallon holding tank

A

A = Integrated swim platform J = Fuel tank fillersB = Rod holder C = Rod holder under gunwaleD = Foldable navigation lightE = Hard topF = Navigation lightsG = Stainless steel hand railH = VHF Radio antennaI = Horn

F


B

C

D FG

E

A

E

B

CD

F

C

D

E

F

D

C

H

B

A

C

CCE

GH

F

IE G

B

JB

3 4 0 0 C C4 4 4

A = Windlass with anchor J = OutriggerB = Removable padded cushions K = VHF Radio antenna over fish boxes L = Navigation/anchor lightC = CoolerD = Stainless steel cleatE = Fuel tank fillersF = Rod holderG = T- TopH = Sirius radio antennaI = Outrigger

A

B

A = SinkB = Access to bilgeC = Tackle trayD = Rod holdersE = Foldable aft bench seatingF = Pump roomG = Transom doorH = Under gunwale rod storage with locking door

GH

See the Instrument Gauges and Switches section of this Owner’s Manual for more information regarding the equipment found at the helm.A = Tack drawers I = Head compartment port lightB = Cup holder J = Head pump-outC = Rod holderD = Bait stationE = Padded helm seatingF = Storage bin under gunwaleG = FootrestH = Windscreen

A

A = Multi-function holderB = Head flush control panelC = Sink with single faucetD = 110-volt plug-inE = Battery switches F = Toilet with holding tank and discharge

B


B

C

DE

AE

BC

D

F

CD

E

F D

EA

F

C

G B

F

GIH

J

K L

B

C

C

C

H

I

J

3 6 0 0 V X4 4 4

A = Windlass with anchor L = Navigation lightB = Stainless steel bow rail M = Rod holders C = Hatch access to cabin belowD = Skylights to cabin belowE = Tow eyeF = Hard topG = HornH = SpotlightI = VHF Radio antennaJ = RadarK = GPS antenna

A B

A = Rod holders under gunwaleB = Fish boxC = Self-draining cockpitD = Pump roomE = Foldable padded aft bench seatingF = SinkG = LivewellH = Fresh water shower

G

H

See the Instrument Gauges and Switches section of this Owner’s Manual for more information regarding the equipment found at the helm.A = Storage bin under gunwaleB = Fish boxC = Cup holderD = Storage compartmentE = Fish boxF = Tackle drawersG = Storage compartmentH = Glove box

A

A = Cup holderB = Tackle compartmentC = Padded helm seatingD = Console compartmentE = Tackle compartment

B


B

CD

E

AE

BC

D

F

C D

E

D

EA

C

C

F

F

G

I

H

JK L

M

G

H

3 6 0 0 V X4 4 4

A = Galley, including sink, microwave, refrigerator and electronicsB = SkylightC = Hatch access to bowD = Cabin lighting (several)E = Hanger eye for hanging bunkF = Stereo speakersG = Mirror H = Padded seat cushions and back restsI = Removable sleeping berthJ = Removable table

A

B

A = Mid-cabin sleeping berthB = Courtesy lightingC = Sliding sleeping curtainD = Steps to additional sleeping berthE = Refrigerator

A = Storage compartment with sliding mirrored doorB = Air conditioning ventC = Detachable shower head D = Water-resistant back splash

A

A = Single-handle faucet, adjustable to hot and cold waterB = Stainless steel sinkC = Single-handle faucet, adjustable to hot and cold waterD = Corian countertop with stainless steel railE = Storage compartmentF = Flush control panelG = Toilet with holding tank

B


CDE

A

B

C DE

D

D

E

A

F

C

F G IH

B

C

B

HJ

G

4 2 0 0 V S F4 4 4

A = Windlass with anchorB = Stainless steel cleat (multiple locations)C = Rod holder (multiple locations)D = Padded bow back rest and cushionsE = Removable coolerF = Horn L = Navigation lightG = Radar M = Rod holdersH = VHF Radio antennaI = Hard topJ = OutriggerK = Outrigger

A

A = Bait stationB = Rod holders (multiple locations)C = Rod holders under gunwaleD = Livewell/baitwellsE = Pump roomF = Rod holders

A = Storage compartment B = Cup holderC = Helm storage binD = Padded helm seating

A

A = Padded helm seating, foldable to leaning postB = Additional padded seatingC = Cup holders (multiple locations)D = Rod holders (multiple locationsE = Fish box F = Fish box

B


I JA

E

BC

D

F

D

D

EA

F

C

E

GD

B C

F HJ

B

C

KL

M

F


M O R E L O C AT I O N S4 4

Bay Bolt 19Battery: Under consoleBilge Access: Pump roomCircuit Breakers: Switch panel on consoleDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Port gunwale mid-ship (opt.)Washdown: Starboard console (opt.)

Bay Bolt 23 and 23 TunnelBattery: Under consoleBilge Access: Pump room hatch, aftCircuit Breakers: Switch panelDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Port gunwale mid-shipWashdown: Console, starboard side

180CCBattery: Starboard aft, under seatBilge Access: Inspection plate in splashwellCircuit Breakers: Instrument panelDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Port side gunwaleWashdown: N/A

2100WABattery: Aft starboardBilge Access: Pump room, aft centerCircuit Breakers: Switch panel at helmDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Port gunwale mid-shipWashdown: Pump room

202DCBattery: Aft starboard, under seatBilge Access: Inspection plate in splashwellCircuit Breakers: Switch panelDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Port side on gunwaleWashdown: Port aft, under gunwale

2100CCBattery: Aft port under seatBilge Access: Pump room hatch, aftCircuit Breakers: Switch panel on consoleDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: StarboardWashdown: Pump room

2300DCBattery: Under driver consoleBilge Access: Pump room, aft centerCircuit Breakers: Switch panel at helmDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Starboard mid-ship below windshieldWashdown: Pump room

2300CCBattery: Under consoleBilge Access: After center, under transom doorCircuit Breakers: At instrument panelDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Port gunwale, mid-shipWashdown: Port aft, under gunwale

2300VXBattery: Cabin, aftBilge Access: Inspection plate in splashwellCircuit Breakers: Switch panel at instrument panelDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Port gunwale, mid-shipWashdown: Starboard aft above swim platform

2500CCBattery: Under consoleBilge Access: Inspection plate in splashwellCircuit Breakers: Switch panel on consoleDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Starboard gunwale, mid-shipWashdown: Starboard aft cockpit

2500VXBattery: Cabin, aft centerBilge Access: Door behind aft jump seatCircuit Breakers: Switch panel at the helmDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Port & starboard gunwale, mid-shipWashdown: Port & starboard, fwd of transom door

3000CCBattery: Inside consoleBilge Access: Pump room, aft floor hatchCircuit Breakers: Switch panel at helmDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Starboard gunwale, mid-shipWashdown: Starboard aft, above swim platform

3000VXBattery: Cabin, aft berthBilge Access: Pump room, aft hatchCircuit Breakers: Switch panel at helmDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Port gunwale, mid-shipWashdown: Starboard aft, above swim platform

3400CCBattery: Inside console head compartmentBilge Access: Pump room, aft hatchCircuit Breakers: Inside head compartmentDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Port gunwale, mid-shipWashdown: One forward at console, one aft starboard in sink


3600VXBattery: Under consoleBilge Access: Deck, aftCircuit Breakers: Switch panel at helm and under consoleDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Port & starboard gunwale, mid-shipWashdown: Port side, aft

4200SVFBattery: Under consoleBilge Access: Pump room, hatch aftCircuit Breakers: Switch panel at helm and under consoleDrain Plugs: TransomFire Extinguisher: As determined by boat ownerFuel Tank Filler: Four total; two port and two starboard on gunwaleWashdown: Port side transom at the walk-thru door


BA S I C M EA SU R E M E N TS4 4

4200 VSFLength overall ......................................... 41’6”Beam .......................................................... 12’Total Weight Capacity .............Yacht CertifiedDry weight/triple 350 hp outboards .................. ............................................22,450 lbs. est.Dry weight/quad 300 hp outboards .................. ............................................19,950 lbs. est.Fuel capacity ................................630 gallonsFreshwater capacity .......................50 gallonsMaximum horsepower ........................1400 hpDead rise ...................................... 23 degreesBridge clearance w/std top ......................... 10’

3600 VXLength overall ......................................... 34’8”Beam .......................................................11’6”Total Weight Capacity .............Yacht CertifiedDry weight ..............................13,500 lbs. est.Fuel capacity ................................372 gallonsFreshwater capacity .......................40 gallonsMaximum horsepower ..........................900 hpDead rise ...................................... 23 degreesBridge clearance w/std top ..................... 10’5”

3400 CCLength overall ......................................... 33’5”Beam ...................................................... 10’4”Total weight capacity ...............Yacht certifiedDry weight .................................8,749 lbs. est.Fuel capacity ................................352 gallonsFreshwater capacity .......................29 gallonsMaximum horsepower ..........................900 hpDraft (engines up) ........................ 24” approx.Dead rise ...................................... 23 degreesBridge clearance w/std top ....................... 7’9”

3000 VXLength overall ......................................... 29’8”Beam ........................................................ 9’8”Total weight capacity ...............Yacht certifiedDry weight .................................8,396 lbs. est.Fuel capacity ................................300 gallonsFreshwater capacity .......................27 gallonsMaximum horsepower ..........................600 hpDraft (engines up) ........................ 22” approx.Dead rise ...................................... 23 degreesBridge clearance w/std top ....................... 8’9”

3000 CCLength overall ......................................... 29’8”Beam ........................................................ 9’8”Total weight capacity ...............Yacht certifiedDry weight .................................7,904 lbs. est.Fuel capacity ................................300 gallonsFreshwater capacity .......................23 gallonsMaximum horsepower ..........................600 hpDraft (engines up) ...................... 224” approx.Dead rise ...................................... 23 degreesBridge clearance w/std top ....................... 8’9”

2100 CCLength overall ........................................20’11”Beam ........................................................ 8’6”Total weight capacity .....8 persons/1,160 lbs.Dry weight .................................3,100 lbs. est.Fuel capacity ................................120 gallonsMaximum horsepower ..........................250 hpDraft (engines up) ........................ 15” approx.Dead rise ...................................... 20 degrees

202 DCLength overall ......................................... 20’1”Beam ........................................................ 8’6”Total weight capacity .....8 persons/1,200 lbs.Dry weight .................................2,965 lbs. est.Maximum horsepower ..........................250 hpDraft (engines up) ..................... 14.5” approx.Dead rise ...................................... 22 degreesBridge clearance w/Bimini top .................. 8’8”

2100 WALength overall ........................................20’11”Beam ........................................................ 8’6”Total weight capacity .....8 persons/1,160 lbs.Dry weight .................................3,600 lbs. est.Fuel capacity ................................105 gallonsFreshwater capacity .........................9 gallonsMaximum horsepower ..........................300 hpDraft (engines up) ........................ 15” approx.Dead rise ...................................... 20 degrees

180 CCLength overall ......................................... 17’6”Beam ........................................................ 8’2”Total weight capacity ........6 persons/980 lbs.Dry weight .................................1,844 lbs. est.Fuel capacity ..................................55 gallonsMaximum horsepower ..........................150 hpDraft (engines up) ........................ 13” approx.Dead rise ...................................... 18 degreesBridge clearance w/opt Bimini top ............ 5’7”

Bay Bolt 19 Length overall ......................................... 19’3”Beam ........................................................ 8’8”Total weight capacity ........5 persons/737 lbs.Dry weight .................................2,500 lbs. est.Fuel capacity ..................................50 gallonsMaximum horsepower ..........................225 hpDraft (engines up) ........................ 10” approx.Dead rise ...................................... 14 degreesBridge clearance w/std top ....................... 6’8”

Bay Bolt 23 and 23 Tunnel Length overall ........................................22’11”Beam ...................................................... 8’10”Total weight capacity .....7 persons/1,020 lbs.Dry weight .................................3,150 lbs. est.Fuel capacity ...............77 gal (69 gal Tunnel)Maximum horsepower ..........................300 hpDraft (engines up) ........................ 10” approx.Dead rise ...................................... 14 degreesBridge clearance w/opt Bimini top ............ 7’2”

2500 VXLength overall ....................................... 24’10”Beam ...................................................... 8’10”Total weight capacity ....10 persons/1442 lbs.Dry weight .................................6,044 lbs. est.Fuel capacity ................................176 gallonsFreshwater capacity .......................13 gallonsMaximum horsepower ..........................500 hpDraft (engines up) ........................ 21” approx.Dead rise ...................................... 23 degreesBridge clearance w/std top ....................... 8’6”

2500 CCLength overall ....................................... 24’10”Beam ...................................................... 8’10”Total weight capacity ....10 persons/1442 lbs.Dry weight .................................5,474 lbs. est.Fuel capacity ................................176 gallonsFreshwater capacity .......................15 gallonsMaximum horsepower ..........................500 hpDraft (engines up) ........................ 21” approx.Dead rise ...................................... 23 degreesBridge clearance w/std top ....................... 8’0”

2300 VXLength overall ......................................... 22’4”Beam ........................................................ 8’6”Total weight capacity .....8 persons/1,130 lbs.Dry weight .................................3,842 lbs. est.Fuel capacity ................................115 gallonsFreshwater capacity .......................13 gallonsMaximum horsepower ..........................300 hpDraft (engines up) ........................ 15” approx.Dead rise ...................................... 23 degreesBridge clearance w/opt top ....................... 8’0”

2300 CCLength overall ......................................... 22’4”Beam ........................................................ 8’6”Total weight capacity .....8 persons/1,130 lbs.Dry weight .................................3,400 lbs. est.Fuel capacity ................................142 gallonsFreshwater capacity .........................8 gallonsMaximum horsepower ..........................300 hpDraft (engines up) ........................ 15” approx.Dead rise ........................................ 2 degreesBridge clearance w/std top ....................... 8’0”

2300 DCLength overall ......................................... 22’4”Beam ........................................................ 8’6”Total weight capacity .....8 persons/1,086 lbs.Dry weight .................................3,776 lbs. est.Fuel capacity ................................115 gallonsMaximum horsepower ..........................300 hpDraft (engines up) ........................ 15” approx.Dead rise ...................................... 23 degreesBridge clearance w/Bimini top .................. 8’0”

INSTRUMENT GAUGES & SWITCHES4 4 4

2011 Hydra-Sports Owners Manual • Instrument Gauges and Switches • Page 6-1

PropercontrolofHydra-Sportsboatsextendsbeyondthesteer-ingwheel.Eachboatisequippedwithmultiplegaugesthatprovideinformationtoguidetheoperatorinmaintainingcontrol.Therearealsoavarietyofswitchesandbuttonswithintheboatthatcontrolvarious functions related to safety, comfort, fishing and watersports enhancement.Itisimportantfortheboatownerand/oroperatortobecomefamiliarwithallgaugesandswitchesintheboat,thefunctionalityofeach,andhowtorespondtoalarmsandwarningsthattheinstrumentpanelmayprovide. In theGuide to Individual Models sectionof thisOwner’sManual are photos of the helms of most models. Prior to boat-ing,ownersandoperatorsshouldalsoreviewandunderstandthefollowingsectionregarding theboat’selectricalcomponentsandoperations through thebatteryorbatteries,aswell as the circuitbreakersystem.Athoroughunderstandingofthesesystemsiscriticaltoavoidingpotentialissuesthatmayariseduringanouting. The following is an explanation of the functionality of thegaugesandswitchesthatarelistedforthevariousmodels.Notethatnotallmodelsareequippedwithallgaugesandswitches,andadditionalfunctionalitybeyondwhatisexplainedheremayexist.VerifywithyourHydra-Sportsdealerthelocationsandop-erationsofallgaugesandswitchespriortooperatingtheboatforthe first time.

12-Volt Receptacle Hydra-Sportsboatshaveone(1)ormore12-voltreceptacles.Examineyourboattodeterminewhetherthereareadditionalout-lets. Prior toplugginganyaccessory intoa12-volt receptacle,ensurethatthedeviceisdesignedforusewhenconnectedtoa12-volt receptacleandwillnotbedamagedby theconnectiontothereceptacle.

Accessory Switches TheboatmaybeequippedwithAccessorySwitches. Thespareswitch(es)provideacontrolswitchforaftermarketequipment

thatmaybeaddedtotheboat.Togglingwillturnacon-nectedaccessoryONandOFF.

AM/FM Stereo, CD Player, Remote Control, iPod, TV and DVD Connections BoatsmaybeequippedwitharangeofentertainmentopportunitiesfromradiosandCDplayerstoconnectionsforpersonaldevices.Somemayalsohaveremotecontroldevices,whichmaybelocatedonthehelm.Careshouldbetaken toavoidexcessiveusageofsuchdevicesandbyrespondingtoanyalarmsthatsoundsothattheboat’sbattery(ies)doesnotbecomefullydis-charged.Thestereo,DVDplay,TVandcomponentscomewithaseparatemanualexplainingoperationof thedevices.Pleasereviewandbecomefamiliarwiththeequipment.

Bilge Pump Switch Thebilgepumpswitchactivatesthebilgepumpwhen

turned ON. In the OFF position, the automatic bilge pump float switchwillturnthepumpONandOFFasdeterminedbythelevelofwaterinthebilgecompartment.

Bow Thruster ControlThebowthrusterisoperatedfromapadcontrollerlocatedonthehelm.Tooperatethebowthrusterfromthepadcontroller:• TurnthepowerforthebowthrusterONbypressingbothON

buttonssimultaneously.(AlwaysturnthepowerOFFwhennotinusebypressingbothbuttonssimultaneously.)

• Turn thebow in thedesireddirectionbypushing thebowthrustercontroltoportforportmovementorthebowthrustercontroltostarboardforstarboardmovement.

• Dependingonthesidewaysspeedofthebow,theoperatormustdisengagethebowthrustercontrolshortlybeforethebowisinthedesireddirection,astheboatwillcontinuetomoveafterstoppingthebowthruster.Practiceinopenwater,awayfromothercraftuntilsuchtimeasmaneuveringtheboathasbeenmastered.Thismaneuverrequirespracticetomaster!


Compass Whereequipped,thecompasslocatedontopoftheinstru-mentpanelautomaticallyadjustsastheboat’sheadingchangestogiveanapproximateheadinginthemostbasicofdirectionalheadings. Readings on top of the compass are directional fornorth,south,east,westandbearingsinbetween,whiletheread-ingsonthesideareindegrees.

Circuit Breakers Allmajorboatcircuitsareprotectedfromshortingandover-loadby re-settable circuit breakers. If a problemdevelopswithoneof thefollowingcircuits,switchOFFthecircuitandwait forapproximately one (1) minute. Then fully push the appropriatebreakerbuttonandswitchONthecircuit. If thecircuitcontinuestotrip,thereisaproblemsomewherethatmustbeattendedtoim-mediately.SeeyourauthorizedHydra-Sportsservicedepartmenttoresolvethismatter. Thelocationofthemaincircuitbreakerboardisunderthedashpanel.Insomemodels,thereisanadditionalbreakerpaneltoassistwiththeaccessoryload,andwhereequippedislocatednearthebatterybox.Onsomemodels,thecircuitbreakerislo-catedon thehelmadjacent to theaffectedswitchorgauge. Iftheboat’saccessoriesaremalfunctioning,checkandthenre-setbreakersasnecessary. Ifduringmaintenanceorinspectionitbecomesnecessarytoremoveorre-positionanyoftheengine’swiringorwireharness(es)verifythatthewiringhasbeenreturnedtoitsoriginalpositionandthatallharnessesareroutedcorrectlybeforeattemptingtousetheboatagain.Ifawiringcliporretainerbreaks,replaceitimmedi-ately. Wiring is specifically routed to eliminate problems related tosprayorimmersioninliquids.Electricalproblemsmayresultifwiringismovedfromitsoriginalposition!

Courtesy Lights Switch(es) This switchoperates the illumination lighting for the console.Onsomemodelsitalsocontrolstherodlockerlightingandcabinentrancelighting.

Engine Alarm System/Warning Lights Someenginesareequippedwithanaudiblewarningalarmand/orwarninglights.Analarm(locatedunderthehelmdash)willsoundifanyoneofthefollowingoccurinanyengine:1)thecool-ingsystemwater temperature is toohigh;2)VRO(Variable-RatioOiling) tankoilsupply is low;3) fuel restriction;or4)engine-op-erationproblems.Ifthealarmsounds,quicklyobservethegaugesandenginelightsforanabnormalreading,thenstoptheengineimmediately. Ifallgaugesreadnormally, thenrefer totheengineowner’s manual to aid in finding and correcting the problem. If thecause for thealarmcannotbe found,consultyourHydra-Sports dealer. To prevent possible damage to an en-gine,donotrestartanengineuntilthecauseforthewarninghasbeenfoundandcorrected.

Engine Emergency Safety Stop Switch Theengineemergencysafetystopswitchisanignitioncut-offswitchdesignedtostoptheengineintheeventofanytypeofemergencyinwhichpowertotheengineshouldbediscontinued.This switch will turn OFF the fuel pump and stop the flow of fuel to theengines. OnsomemodelstheengineemergencysafetystopswitchisaredrockerswitchanditislocatedonthehelmItisactivatedbypressingtherockerswitchUP.Onothermodels,theengineemer-

gencysafetystopswitchisattachedtoalanyard.Thelanyardisequippedwithahookononeendthatshouldbeattachedtoyourclothing or PFD, and the opposite end has a slide that fits over the ignition switch. Be sure that the slide is firmly attached to the ignitionswitchlocatedonthehelm.Iftheslideisleftofforisloose,theenginewillcrankbutwillnotstart.OperatorsshouldNEVERattempttooverridethissafetysystem!

The safety switch lanyard must be attached to the operator whenever the engine is running. Failure to do so may result in death or serious injury!

Engine Synchronizing Switch Dependingonoptionschosenfortheboat,theremaybeanenginesynchronizingswitchonmulti-engineboats.Theswitchwillbeontheshiftcontrol(binnacle).Thisswitchallowstheenginestooperateinsynchronization.Donotengagetheswitchunlesstheenginesarerunningbutstillinneutral(forsafety’ssake)!Priortoengagingthesynchronizingswitch,ensurethatyouareinalargebodyofwater.Avoida tight coveor narrow river,anddocks,damsorotherobjectsthatmayprotrudeintothebodyofwater.Be certain that there is a minimum of other vessels or traffic as you willneedroomtoperformthisprocedure.

Engaging the engine synchronization functionality requires practice to master. Because the boat will be in gear and will move during the process, even after mastering the maneuver boat operators should synchronize engines only on bodies of water of sufficient size to accomplish the maneuver without making contact with other vessels or with inanimate objects, which could cause serious bodily injury or significant damage to the boat.

Seek assistance from your authorized Hydra-Sports dealerindeterminingthepropermannerinwhichtoengageanddisen-gagethesynchronizingfunction.


Engine Temperature Gauge Each engine manufacturer has its own specifications regard-ingappropriateoperatingtemperature,andyouMUSTconsulttheengine owner’smanual to determine the range in your applica-tion.Ifthegaugeindicatesexcessivetemperaturesduringoperation,slowdownimmediatelyandturnofftheengine.Thisindicatesanengineproblemthatneedstobecheckedbythedealer!

Continuing to operate the boat while the temperature is above normal operating parameters may cause serious damage to your engine. Damage to your engine resulting from operating the engine in an overheated condition can be costly to repair.

Fuel Gauge Fuel gauge readingsare only approximate. This gauge isactivatedwiththeignitionswitch.Therockingmotionoftheboatduring normal operation will cause the fuel gauge to fluctuate. Foramoreaccuratereading,makesurethattheboatislevelandthereislittleornomotionpresentandtheengine(s)atidle. Hydra-Sportsrecommendsthatoperatorsdonotruntheboatbelowaquarterofatank,exceptasnecessarytoreturntoshore,andnotuntiltheboathasbeenoperatedenoughtimestodevelopanunderstandingofhowthefuelgaugereadingsrelatetothevi-sualinspectionoffuelleftinthetank.Extendingfuelusagebeyondtheknowncapabilityoftheboatmaycausetheboattorunoutoffuelandmayleaveyoustrandedoff-shore.Itisrecommendedtoavoidallowingthefuelquantitytofallbelowone-quarterofatankfullatanytimeasitmayresultindamagetothefuelingsystem.(SeetheFuelingsectionofthisOwner’sManual.) Althoughtheremaybeasmallamountoffuelinthetank,thefuelpick-upsystemwasdesigned toavoid introducing thesmallamountofwateranddebristhatunavoidablyaccumulateinthebottomof the tank.Therefore,youshouldrefrain fromoperatingtheboatawayfromshorewhenthefuelgaugeisclosetoemptytoavoidtheriskofbeingstrandedoff-shore.Horn Thehornissoundedbymeansofabuttonontheinstrumentpanel.Pressingthebuttonemitsaloudandrecognizablenoise.

Ignition Key Slot Hydra-Sports boats come equipped with an ignition key,whichmustbeinsertedintheignitionkeyslotandusedtoactivatetheboat’selectricalsystem.This,inturn,willallowtheboattobestartedandoperated.Thekeywillbeinoneoffour(4)positions:• Off• Accessory(includingrunningthestereowithouttheenginerun-

ning)• ON(engineisrunning)• Start(turnthekeytoengagetheenginestarter,thenreleaseto

allowthekeytoautomaticallyreturntotheONposition) NeverleavetheignitionswitchintheONpositionwithouttheenginerunning,asthiswillcausethebatterytodischarge.

Navigation/Anchor Lights Switch Thisswitchoperates therunning lights,anchor lights,andonsome models the helm console lighting. Some models have aseparatehelmlightingswitch.Thelightsgenerallyarelocatedatthebowandsternof theboat,butonsomemodelsadditionallightsmaybelocatedamidship.BoatsequippedwithaT-Toporhardtop may have navigation lights, foldable or fixed, on top

Power Switch ThisisthebasicON-OffswitchthatmustbeONinorderforotherswitchesandequipmenttofunction.

Power Trim Gauge Thepower trimgaugeshows thepositionof theoutboardunitrelativetothetransom.Readthegaugecarefullyasitdoesnotshowthepositionoftheunitindegrees.PropertrimshouldbeindicatedbybowattitudeandengineRPM.Formoreinformation,refertotheengineowner’smanual.

Shift/Throttle Control (Binnacle) Theremotecontrolhandleservestwopurposes:1)itregulatestheenginespeed,and2)itactsasagearshift levertocontrolthe rotationof thepropeller.When thehandle is in thecenter,thegearshiftisinneutral.Theneutralpositioncanbedeterminedwhenthecontrolhandledropsintoadetent.Theenginewillnotstartunlessthecontrolisinneutral. Note:Allow theengine towarmupbeforeengaging theshiftcontrol.Monitorallinstrumentswhiletheengineisidlingdur-ing warm-up. See the engine manufacturer’s specifications in the engineowner’smanualforproperoperatingranges.Somecontrolshaveanenginewarm-upbuttonnearthebase.Press-ingthewarm-upbuttonallowstheenginetoremaininneutralwhiletheoperatoradvancesthethrottleforwarminguptheengine.Allowtheenginetowarmupbeforeengagingtheshiftcontrol. Moving the throttle forwardorbackward increasesenginespeedandincreasesboatspeediftheengineisineitherforwardor reversegear. The further the throttle ismoved, the faster theengineruns. Thecontrolhandleactsasthegearshiftlevertocontrolfor-ward or backward movement of the boat. Moving the handleforwardfromtheneutralpositionengagestheshiftingmechanism,causingtheboattomoveforward.Continuingtheforwardmove-mentofthehandleincreasesengineRPMandcausestheboattomoveforwardfaster. Moving the handle backward from the neutral position en-gagestheshiftingmechanism,causingtheboattomovebackward.


Continuing the backward movement increases the engine RPM.Continuedaftmovementcausestheboattomovebackwardfaster.Rapid acceleration in reverse can cause awake that could riseabove the transom and flood the boat. Whenmaneuveringat low speeds, reversing thedirec-tionofpropeller rotationcausesabrakingaction thathelpsstoptheboat. Note: Whenreversingdirectionatanenginespeedover1,000RPM,hesitateinneutralenoughtoletthepropellerslowitsturningtoavoiddamagetotheshiftingmechanism. Somecontrolsmayhaveatriplecontrolswitchthatcanbeused toadjust thepositionof theoutboard. Pressing the switchin theUPpositionmoves theoutboardoutandaway from thetransom.Pressing theswitch in theDOWNposition,moves theoutboardinclosertothetransom.Theswitchreturnstoitscenterneutralpositionwhenreleased. Theowner’spacketmaycontaindetailedinformationabouttheremotecontrolinstalledontheboat.Readthecontrolsinforma-tionorengineowner’smanualforcompleteoperatinginstructions.Shower Asingleswitchwillactivatethesystemandcontrolstheop-tionalshowerfunction.Theswitchismarked.

Speedometer Thespeedometerindicatestheforwardspeedoftheboatinmilesperhour(MPH).Boatspeedisdifferentfromenginespeed(RPMs).Theaccuracyofthisinstrumentdependsontheplacementandcleanlinessofthepick-uptube.Someboatsmaybeequippedwitharemotepick-uptube,whichmaybetilteduptopreventdam-ageduringtrailering.Itmayalsobetiltedupduringoperationinshallowwatertopreventdamageorcloggingthetubwithsandorsilt.Itshouldbetilteddownwhileunderway.

Tachometer Thetachometerindicatestheenginespeedincrankshaftrev-olutionsperminute(RPM),underalloperatingconditions.Enginespeed is different from boat speed. Weather conditions, boatload,andotherfactorsdetermineboatspeedatanygivenengineRPM.Donotexceedtheenginemanufacturer’srecommendationsformaximumRPM.

Trim Tab Switch Whereequipped,trimtabscanbeusedtoadjusttheboat’strim to theoptimumangle for loadandwaterconditions.Trimtabsaddlifttotheboat’sstern,therebychangingtheboat’sat-titudeorangleinthewater.Thisliftcanhelptheboatremainonplaneatslowerspeedsthanifnotabswereused.TrimtabsintheDOWNpositioncanalsobeusedtohelpaheavilyloadedboatgetonplanemorequickly. Whenmakingadjustmentswiththetrimtabattitudeadjustmentplates,useshortmomentarytapsoftheswitch.Continuedpracticewillhelpyoubecomefamiliarwithhowtheplatesperform.

Do not lower the tabs all the way at high speeds as it may result in loss of steering control. Lower tabs a little at a time. Observe the effect on boat operations before lowering fur-ther.

NOTE:Duringearly expeditions, take theboat toopenwaterandexperiment.Aftergettingtheboatonplane,set thetabsinvariouspositionsandnotehowtheboatreacts.Thiswillgiveyouafeelforhowthetrimtabswork.

Usedindependently,trimtabscanalsocompensateforseas,windsorunevenloads. Inheadseas,trimtheenginemorethanusual.Lowertabstokeepthebowdownandgoataslowerspeed.Infollowingseas,preventtakingseawateroverthebowbykeepingthetrimtabsupandthentrimtheengineasneededtokeepthebowup.Iftheboatislistingduetoquarteringseas,beamwindorunevenloads,usethetabsindependentlytoadjustforthelist. If listingtostarboard,raisetheporttab.Iflistingtoport,raisethestarboardtab. Rememberthatboatsreactveryslowlytotrimtabs.Oftenopera-torsdonotgivetrimtabstimetowork.Pressthetrimtabsswitchesforonlytwo(2)secondsatatimeandthenallowsometimefortheboattoreact.Iftheboatisstilllistingafteraminuteortwo,pressthetrimtabswitchagainforanothertwo(2)secondinterval.

VHF Radio Hydra-SportsoperatorsboatingonopenwatersshouldhaveaVHFradioaboardtobepreparedforemergencies.Somemod-elsareequippedwithVHFradio.Thehandsetisusuallylocatedonthehelmormaybeonahardtop. Operators shouldalsooperatewithin the rulesandguide-linesoftheU.S.CoastGuardandtheFederalCommunicationsCommission.

Underwater Lights Switch Thisswitchisatwo-positionswitchthatactivatestheunder-waterlights(whereequipped),simultaneously.Turningtheswitchupwardswill turn the lightsON,and turning itdownwardswillturnthelightsOFF. Alsonote that theunderwater lightsshouldneverbeoper-atedunlesstheboatisinthewater.EventhoughtheseareL.E.D.lights,theygeneratesomeheatandrequirethecoolingeffectofthewatertoavoidprematureburn-outofthebulb.

Water Pressure Gauge Thewaterpressuregaugemeasuresthepressureoftheen-ginecoolingwater.Alowgaugereadingisanalerttopotentialengineissues.Checktoseeifthewaterintakeiscloggedoriftheoutboardmotoristilteduptoohightodrawincoolingwater.Op-eratingtheenginewithlowwaterpressurecouldleadtoengineoverheatingandseriousenginedamage.

Windlass Up/Down Thewindlassraisesandlowerstheanchor.PresstheWind-lassDown switch to begin the process of anchoring. Press theWindlassUpswitchtobegintheprocessofraisingtheanchorlinebackin. Anytimetheboatisunderway,theanchorshouldbefullyre-tracted(intheUpposition)forgeneralsafetyandsmoothrunningoftheboat.IftheanchorisatanypositionbelowfullUp,itmaymakecontactwiththeboathull,whichcancausedamagethatisnotcoveredunderwarranty.


Voltmeter Thevoltmeterregisterstheelectricalactivitynecessarytoop-erateyourboat.Normaloperatingvoltagewhen theengine isrunningat1,000RPMorhigher isbetween12and15volts.WhentheignitionisONandtheengineisnotrunning,thevolt-metershouldreadin the11.5to12.5volt rangeif thebatteryis fully charged. Check the battery and charging system if thevoltmeter reads below these normal ratings. A fluctuating voltmeter readingmayindicateloosebeltsorlooseelectricalconnections. Ifthebattery(orbatteries,inboatmodelsrequiringtwo[2])islowornon-functional,orifvariouselectricalitemsontheboat,suchasstereoequipment,aredrainingthebattery(ies)andimpact-ingtheboat’sabilitytofunctionproperly,thevoltmeterwilllikelybe the first gauge to indicate that you have an electrical problem. Thevoltmetercannottellyouwhichbatteryisdrainingonboatswithtwo(2)batteries,butratherfunctionsasageneralalarmtoalertboatersregardingpotentialissues.Onboatsequippedwithtwo(2)batteries,thealarmindicatesseveredrainontheenginestartingbattery.Todeterminewhichbatteryistheenginestartingbattery,readthemarkingsonthebatterycables.

Wash Down Switch Awater tank optionwithin availablemodels can providea fresh-water wash of the boat interior. The tanks vary in sizedependinguponthemodel.Thetwo-positionswitchispressedupforONanddownforOFF.

Washer/Wiper Control TheWiperswitchturnsONthewindshieldwiperwhenitispressed.ToturnitOFF,pressdown.Insomemodels,awasherfunctionisalsoavailable.Thisswitchwillcontinuetoapplywash-er fluid to the windshield as long as it is held. Releasing it will stoptheprocess.Besuretopayattentiontotheamountofwasherfluid in the container. Use only approved, environmentally friendly washer fluid for marine applications. See your authorized Hydra-Sportsdealerfordetails.

2011 Hydra-Sports Owners Manual • Electrical System • Page 7-1

Your boat was designed to protect you from hazardousshocks. To continue protecting yourself, always have a qualified Hydra-Sports technician make any modifications to the system. DirectquestionstoyourauthorizedHydra-Sportsdealer.

12-Volt DC Boat System The12-voltDC(directcurrent)systemisa12-volt,two-wirenegativegroundtype.Thehotwireispositive,feedingthelightsand appliances for instance, and the negative return is by aninsulatedwiretothenegativeterminalofthebattery.

12/24-Volt Trolling Motor System (where equipped) The12/24-voltDC(directcurrent)electricalsystemisa12or24-volt,three-wire,negativegroundtype.Onehotwireis12-volt.Theotherhotwiresarepositive, feeding the trollingmotor,and thenegative return isbyan insulatedwire to thenegativeterminalofthebatteries.

24-Volt Trolling Motor System (where equipped) The24-voltDC(directcurrent)systemisa24-volt,twowire,negativegroundtype.Thehotwireis24-volt,feedingthetrollingmotor,andthenegativereturnisbyaninsulatedwiretothenega-tiveterminalofthebatteries. NOTE: TurningtheignitionswitchOFFdoesnotcutoffpow-er toallcomponents.Poweredcomponents,suchas thestereo,candrawdownthebatteryiftheyareleftonforanextendedpe-riodwithoutrunningtheengine.IndividualcomponentsmayneedtobepoweredOFFtoavoiddischargingthebattery(batteries).Apowerswitch,whichcanshutoffthesecomponents,isstandardonsomemodels.Theelectricalsystemiswiredtohandlefactory-installedelectricalequipment.ItisrecommendedthatyouhaveanauthorizedHydra-Sportsdealerinstallanyadditionalequipment.Anerrorinwiringthe electrical circuits can cause a fire or damage electrical system

components.HaveyourauthorizedHydra-Sportsdealerrepairtheelectricalsystemanddeterminewhetheranyadditionalequipmentmaybeinstalled.

Hydra-Sports electrical system parts are designed and manu-factured to comply with U.S. Coast Guard requirements to minimize risks of fire or explosion. Never substitute automo-tive parts for marine parts. Automotive parts do not provide the necessary ignition spark protection. Consult your autho-rized Hydra-Sports dealer prior to making any changes to the boat’s electrical system.

Whenaddingequipmentthatrequireselectricalconnection,theequipmentmustbeadaptabletothenegativegroundsystem.Besuretotakethepowersupplyfromthecircuitbreakerpanel.Ifadditionalcircuitprotectionisrequired,itmustbeaddedatthefuseblockatthehelmconsole.Protectallelectricalcomponentsfromrain,waterorseaspray. NOTE:PowerfeedsforaccessoryequipmentmustNOTbetaken from thevoltmeter terminals.ConsultwithyourauthorizedHydra-Sportsdealers foradditionalDCpowerneeds.Consult your authorized Hydra-Sports dealer prior to making any changes to the boat’s electrical system.

Battery/Batteries

Sulfuric acid in batteries can cause severe burns. Avoid con-tact with skin, eyes or clothing. Wear goggles, rubber gloves

and a protective apron when working with batteries. In case of skin contact, flush with water at least 15 minutes. If swallowed, drink large quantities of water or milk. Follow with Milk of Magnesia, beaten egg or vegetable oil. Get medical attention immediately.

When charging, batteries generate small amounts of dangerous hydrogen gas. This gas is highly explosive. Keep all sparks, flames and smoking well away from the area. Failure to follow instructions when charging a battery may cause an electrical charge or even an explosion of the battery, which could result in death or serious injury.

T H E E L E C T R I C A L S Y S T E M4 4 4

Only qualified personnel should install batteries and perform electrical system maintenance. Do not expose batteries to open flame or sparks. Do not smoke near batteries.

YourHydra-Sportsdealerhas installedabatteryorbatter-iesthatsupplypowertotheDC(directcurrent)electricalsystem.Marinebatteriesprovidehighreservecapacitypluscoldcrankingperformance.Whentheengineisrunning,thebatteryischargedautomatically. Batteriesproducehydrogenandoxygengaseswhenbeingcharged. These explosive gases escape through the vent/fill caps andmayformanexplosiveatmospherearoundthebatteryifventi-lationispoor.Thisgasmayremainaroundthebatteryforseveralhours after charging. Sparks or flames can ignite the gas and causeanexplosion. NOTE:Neverdisconnect thebatterycableswhile theen-gineisrunning.Doingsocandamagetheelectricalsystemandsuchdamageisnotcoveredunderwarranty.

Battery Switch Adualbatterysystemisavailableonsomemodelsasop-tionalequipment.Thistypeofsystemhasadualbatteryswitch,which enables DC (direct current) power to be used from oneor twobatteries.This switchcontrolspower to theenginesandall12-voltelectricalequipment,excepttheautomaticbilgepumpandtrollingmotor.Thedualbatteryswitchsettingsavailableare

OFF,1,2andALL.• OFF: All 12-volt power to theboat is shut OFF except for theautomatic bilge pump and stereopresets.Iftheboatisunattendedforextendedperiods,turnthedualbat-teryswitchtotheOFFposition.NOTE:Donotturnthedualbat-teryswitchtoOFFwhiletheengineisrunning.Enginechargingsystemsandwiringcanbedamaged.•1: Setting1usesbattery#1topower the engine and all 12-volt


equipment. Battery #2 is isolated and remains in reserve.Battery#1ischargedbytheenginechargingsystem.

• 2: Setting 2 uses battery #2. Except for the bilge pump,battery#1isisolatedandremainsinreserve.Battery#2ischargedbytheenginechargingsystem.

• ALL: TheALL setting uses bothbatteries.Use this positionONLY to start an engine that can’t be started using justonebattery.Aftertheengineisstarted,changetheswitchtoposition#1or#2tochargetheweakbattery.UsingtheALLpositionwillnotproperlychargebothbatteries.

Useonlyonebatteryatatime,using#1or#2setting.Alternat-ingbatteryusagewilllikelyresultinlongerlifeforthebatteries.

NOTE:Thebatteryswitchonsomemodelsisatwo-position(ON/OFF)switch. In theOFFposition,power isonlyprovidedtothebilgepump.TheswitchmustbeintheONpositiontostarttheengineoroperativeanyelectricalequipment.SeeanauthorizedHy-dra-Sportsdealertomodifyorchangetheboat’selectricalsystem.

AC/DC Battery Charger Theboatmaybeequippedwithabatterychargingsystemthat operates off 120-volt AC (alternating current) power fromshore.Turn thechargeronwheneveryourboat isconnected toshorepowertokeepthebatteriesfullcharged.Thechargingsys-temisfullyautomaticandpermanentlywiredintothe12-voltDC(directcurrent)system.If themonitoredbatteryleveldropsunderthe full charge range, the charger automatically turnsONandrestoresthebatterytoFULLchargestatus.

Battery Charging Theenginealternatorwillrechargetheenginebatterywhentheengineisrunning.Onsomemodelsavoltageregulatorcon-trolstherateofchargebysensingbatteryvoltageandincreasesor decreases the alternator output accordingly. If your boat isequippedwithabatterycharger,pleaserefertothebatterychar-gerowner’smanualfordetailedinstructions.

To prevent personal injury, do not attempt to start your engine with jumper cables. The use of jumper cables could create dangerous sparks, which could cause the battery’s hydrogen vapors or gasoline fumes to explode.

Overload Protection Theengineisequippedwithafuseorcircuitbreakertopro-tecttheenginewiringharnessandinstrumentationpowerleads.Ifanelectricaloverloadoccurs,acircuitwill“open”andinterruptthecurrent flow when the current draw exceeds the rated amperage. Refertoyourengineowner’smanualforthebreakerlocation,re-settingprocedure,orforfuseratingandreplacementprocedure.

Trolling Motor SomeHydra-Sportsboatshaveaheavy-duty trollingmotorreceptaclelocatedatthebowoftheboat.Thisreceptacleisusedtoprovideelectricalpowertothetrollingmotor.Runningfromthereceptacleisaheavy-dutycopperwireharnessthatsuppliespow-ertothereceptaclefromthededicatedtrollingmotorbattery.Thisextra-heavywireassuresmaximumthrustandlongerbatterylife.AllHydra-Sportsboats featureanelectricaldevice thatprotectsthisharness,whichislocatednearthetrollingmotorbattery.Thetrollingmotorandbatteryareisolatedfromtheboat’selectri-

calsystem.Thereareseveralbatterychargingoptions.YourHy-dra-Sportsdealercanassistyouindecidinguponthebestwaytochargethebattery. NOTE:Topreventequipmentdamageandpossible injury,alwaysconnectthetrollingmotorandbatteriesbyusingthefactory-suppliedwiring.Therearea largenumberof trollingmotors thatcanbeusedwiththeboat.AHydra-Sportsdealercanassistyouinchoosingatrollingmotorandproperlyinstallingitontheboat.

120-Volt AC Electrical System The AC (alternating current) electrical system meets or ex-ceedsnationalstandardsatthetimeofconstruction.Itoperatesoffastandard30-amp,120-volt,60-hertz(Hz)shortpowersystemoranoptionalonboardgenerator. ThemaindistributionpanelinthecabinareahasmainACbreaker(s)thatturntheentireACsystemonandoff,allowingtheoperator to check for proper voltage and polarity immediatelyafterashorepowerconnectionhasbeenmadeandbeforeindi-vidualcircuitsareenabled.ThesebreakerswitcheshaveanLEDindicatortoindicatewhentheyareon. If theboathasanairconditioningsystem, themainpanelhas an additional set of breaker switches dedicated to the airconditioner.Iftheboathasanon-boardgenerator,thegeneratorcanbeused topower theairconditioner.Moredetailed infor-mation about the generator and the air conditioning is in themanufacturer’sinformationintheowner’spacket.CheckwithanauthorizedHydra-Sportsdealerformoreinformationaboutpropergeneratorusage.

Shore Power Ashorepowerconnectiontoprovide110-voltAC(alternat-ingcurrent)powerisavailableonsomemodels.Theconnectionconsistsofamale receptacle locatednear thestern.QuestionsregardingthesystemshouldbedirectedtoanauthorizedHydra-Sportsdealer.

To prevent damage to the electrical system, never operate the shore power system at less than 105 volts.

TheACbreaker(s)onthemainelectricalpanelturnstheen-tireACsystemONandOFF,allowingtimetocheckforpropervoltageandpolarityimmediatelyafterashorepowerconnectionhasbeenmade. Beforeconnectingtoshorepower,turnOFFthecircuitbreak-ersattheelectricalpanel.MakesurethedocksideshorepowerbreakerisOFF,thenpluginthecord.Attachtheshorepowercordto theboat receptacleand turn it clockwise to lock the thread-locking ringon thecord to secure it to the receptacle.Turn thedocksideshorepowerbreakerON. NOTE: Connecting the cord to the boat first will prevent drop-pinga“hot”cordintothewater.Besurethatuponleavingthedockthat the cord is removed from the dockside shore outlet first. MakesurethedocksideshorepowerbreakerisOFF;thenpluginthecord.TurnthedocksideshorepowerbreakerON.Immediatelycheckthepolaritylightsonthemainelectricalpanelintheboat.IftheREVERSEDPOLARITYlightisilluminated,donotturnONthemainbreaker.TurnOFFthedocksideshorepowerbreakeranddisconnecttheshorepowercord.Informthemarinamanageroftheproblem. NOTE:Someequipmentwillnotworkormaybedamagedifthepolarityisreversed.Yourwarrantydoesnotcoverdamagecauseby reversedpolarity.Besure thepolarity iscorrectwhenconnectiontheboattoshorepower. AnACcircuitmayoverloadifthecurrentdraw(amperage)oftheaccessoriesinuseexceedsthesystem’scapacity.Ifacircuitoverloads,turningoffoneormoreaccessorieswillbenecessary.


SySTEMS, COMFORT & CONVENIENCE4 4

2011 Hydra-Sports Owners Manual • Systems, Comfort & Convenience • Page 8-1

Hydra-Sports offers significant standard and op-tionalitemstomaketheboatingexperiencemoreenjoy-able.Someoftheseitemscomewiththeirowninstruc-tionsandinformationfromtheoriginalmanufacturer.Inthoseinstances,suchaswiththestereoequipment,themanual is included with the boat. In other instances,somegeneralinformationisprovidedinthissection.If,atanytime,youareuncertainabouttheuseorcareofanythingontheboat,neverhesitatetocontactyourauthorizedHydra-Sportsdealer foradditional informa-tionandguidance.

Air Conditioning System Theboatmaybeequippedwithareversecycleairconditioner.ThisunitcanheatorcooltheboatwhentheACelectricalsystemisenergized.Whentheaircondition-ingisrunning,thepumpdrawsinrawwaterthroughaseacockinthebilge.Itdischargestherawwaterthroughathru-hullfittingabovethewaterline. AirconditioningunitsarecontrolledthroughbreakerswitchesattheACelectricalpanel.Whenusinganairconditioner,itsbreak-erswitchandtheairconditioningpumpswitchmustbeON. Tooperatetheairconditioner:1. Opentheairconditionerseacock.Thevalveisopenwhenit

isinlinewiththehose.2. Checkthestrainer.Cleanitifnecessarytoassureasteady

flowofwatertotheunit.3. Setthethermostattothetemperaturedesired. Note:Besuretoclosetheairconditionerseacockwhentheairconditionerisnotinuse. Refer to the air conditioning ownersmanual formore de-tailedinformationregardingitsoperation.

Bilge Thedeepestpartofthehull,underthefloor,isthebilge.Wa-termayaccumulateintheaftportionofthebilge.Besuretokeepthebilgeareafreeofdebrissothatthewatercandrainthroughthestringersandbulkheadstothebilgepumparea.Itisnormaltohave

asmallamountofwaterinthebilge.However,ifyounoticefueloroilinthebilge,checkforleaksandcorrectthematterimmediately.Donotpumpfueloroiloverboardasthisactofpollutionisaviola-tionoffederallaw.Cleanupfuelandoilandproperlydisposeofthesecollectionsonshore.OilstainscanberemovedbyusingabilgecleaneravailablefromyourauthorizedHydra-Sportsdealer.Donotuseflammablesolventstocleanthebilge.

Bilge Pump Hydra-Sports boats are equipped with an electric bilgepump.Theremayalsobeanautomaticfloatswitch.Risingwateractivatesafloatswitchtostartthebilgepump.Whenthewaterispumpedout,thepumpshutsoffautomatically. Note:Electricallyoperatedbilgepumpscanfail.Thereisno substitute forchecking thebilge frequently,especiallyduringperiodsofheavyrain,highseas,orstormconditions. If for some reason the pump fails to start, check the fuseandwiringconnections. If thepumpmotorrunsbutnowater isdischarged,itmaybeclogged.Keeptheareaaroundtheswitchandthepumpfreeofdebris.Ifthereisnovisibledebriscloggingthepumporblockingthefloatswitchandwaterisstillnotbeingremoved,inspectthedischargehoseforkinksorobstruction. Ifoilisspilledinthebilge,donotrunthepump.Keeptheoilfromspreadinginthebilgeandproperlydisposeoftheoilonshore.YourHydra-Sportsdealercanassist inselectingproductsthatcanbeusedtosoakuptheoil.Alwaysproperlydisposeofclean-upmaterialonshore. Thebilgepumpson somemodelsmaynothaveautomaticfloatswitches.Checkthewaterlevelinthebilge,and,ifnecessary,operatethepumpmanuallyusingtheON-OFFswitchatthehelm. CheckwithyourauthorizedHydra-Sportsdealer regardingtheproperoperationandmaintenanceofthebilgepumpanden-tirebilgesystem.Thisiscriticaltoensuringthatyourboatdoesnotbecomesofilledwithwaterinthebilgethatitbecomesdifficulttooperateorevensinks.


Engines TheHydra-Sportsboatscomewithawiderangeofengineoptions.Intheowner’spacketisanengineowner’smanual.Refertothatmanualforinformationaboutenginecareandmaintenance. Hydra-Sportsdealersemployfactory-trainedtechnicianscer-tified to service the engine. Some basic maintenancemust beperformed by the boat owner/operator, such as checking theengineoil,butwith theever-advancingengine technologyandtheexpertiserequiredforefficientandsafeengineservicemeansthatcustomersarebetterservedbyhavingtheworkperformedatanauthorizedHydra-Sportsdealership.

Fish Box Thefishboxonsomemodelsisequippedwithamaceratorpumptoremovewaterandsmallparticles(fishscales)fromthefishbox.ThepumpiscontrolledbyahelmswitchlabeledMacerator,FishboxDrainorBaitDrain. Removelargeobjectsfromthefishboxbeforeoperatingthemacerator pump in order to avoid clogging or damaging thepump. If thepumpdoesgetclogged, turn itOFF.Sometimesastreamofwater fromagarden hosedirected into the fishboxdrainwillfreetheclog.SeeyourauthorizedHydra-Sportsdealerifthisproceduredoesn’tclearthepump.

Fresh Water System Amanualorpressurizedwatersystemisavailableonsomemodels.Abasicmanual systemhasa handpumpat the sink.Morecomplexsystemsuseafreshwaterpumptopressurizethesystem.Adocksidewatersupplyisavailableonsomemodels. Freshwaterissuppliedtovariousareasincludingthegalley,themarinesanitationdevice,andatransomshower,dependingonhowtheboatisequipped.Adropinwaterpressureturnsonthepumpthatcontinuestorununtilpressurereturnstothesetpoint.Watertemperaturewitheithersystemisapproximatelythesameasairtemperature. Note:FillthetankwithfreshwaterONLY.Refillingthetankoftenhelpskeepitasourceoffreshwater. Sanitizing the Fresh Water System: Sanitize thefreshwatersystembeforeusingitthefirsttime,afterwinterstorage,orwhenthesystemhasnotbeenusedforextendedperiods.

Sanitizing solution contains bleach. Do not drink sanitizing solution. Tag faucets. Notify everyone aboard that the system is being sanitized.

Note:Thewatertankmustbeemptybeforebeginningthesanitizingprocess.1. Inanappropriatelysizedbucket,makeasolutionof1-1/4

cups(10oz)ofhouseholdbleachandfive(5)gallons(19liters)offreshwater.

2. Dump thewater into thewater tankandallow the treatedwatersolutiontoremaininthewatertankforthree(3)tofour(4)hours.

3. Usethefaucetpumptobleedairfromthefreshwaterline.4. Drainthetreatedwatersolutionfromthelinesandemptythe

tank.5. Flushtheentiresystemwithfreshwater. Note: Thoroughly flush the entire systemwith freshwateraftereachsanitizingprocess. Iffreshwaterhasanexcessivechlorinetasteaftersanitizingthesystem:1. Pourasolutionofone(1)quarter(0.95liter)ofvinegarand

five(5)gallons(19liters)offreshwaterintothetank.2. Allowthesolutiontostandinthetankforseveraldays.3. Draintheentiresystemandthoroughlyflushwithfreshwater

afterthetreatment. Filling the Fresh Water Tank:Normally,theonlyat-tentionthefreshwatersystemneedsiskeepingthetankfull.Thetankhasaseparatefilleronthegunwale.Awatertankventisnexttothefillplate.1. Makesurethedocksidewatersupplyissuitablefordrinking.

Not all docksidewater is drinkingwater. Checkwith thedockmasterifnecessary.

2. Insertthefillercapkeyprovidedwiththeboatintotheslotonthefillercapandturncounterclockwisetounlock.Removethefillercap.

3. Usingthehosefromthedocksidewatersupply,fillthetankuntilwaterflowsoutofthevent.

4. Closethefillfitting.

Starting the Fresh Water System:Whenever thetankisemptyandairisinthewaterlines,itwillbenecessarytostartupthesystem.Thiswillnormallybebeforeusingthesystemthefirsttimeorafterwinterstorage.1. Sanitizethesystemasdescribedabove.2. Fillthefreshwatertankwithdrinkingwater.3. Turnonthepumptopressurizethesystem.4. Open a hot water faucet to fill the water heater (where

equipped)andallowairtoescapefromtheline.Closethefaucet.

5. Startingwith thecoldwater faucet furthest from thepump,openeachfaucetuntilthereisasteadyflowofwater.Thenclosethefaucet.

6. Startingwiththehotwaterfaucetfurthestfromthewaterheat-er,openeachfaucet.Closethefaucetwhenthereisasteadyflowofwater.

7. Refillthetanktocapacity,ifnecessary.


Fresh Water Pump: The fresh water pump supplieswaterunderpressure to thesystemwhen thesystem isnotcon-nectedtoashorewatersupply.PumpoperationiscontrolledwithabreakerswitchontheDCelectricalpanel. Whenthepumpispowered, it runsuntil thehotandcoldwatersystemsarepressurized.AnautomaticpressureswitchshutsthepumpOFFuntil thepressuredropstoapre-set level.Forex-ample,untilapressuredropiscausedbyopeningafaucet.ThepumpthenrunsagainuntilthesystemispressurizedandturnsitselfOFF.Ifthepumprunsfromtimetotime,eventhoughnowaterisbeingused,aleakinawaterlineisalikelycause.Checkalllinesforaleakandrepair. Note:Thepumpwillnotautomaticallyturnoffwhenthewa-tertankisempty.Ifthepumpiswater-cooled,runningthepumpdrywilldamagetheimpeller.Checkthewaterpumpmanualfordetailedinformationaboutpumpoperations.

When leaving the boat for several hours or more, turn the wa-ter pump OFF. A powered pump can fill the cabin with water if a water line breaks.

Livewell System Note: Thecarefulhandlingand livewellmaintenanceofall fish caught is environmentally responsible.Consider the livereleaseofanyfishthatwillnotbeeaten. The livewell on the boat is designed to supply thewaterandoxygenneededtokeepbaitalivewhilethoseonboardarefishing.Tofill the livewell,open the livewellpumpseacock.Us-ingthelivewellpump,fillthelivewellwithrawwater.Whenthewaterlevelreachestheoverflowfitting,theexcesswaterwillflowoverboard. If your boat has a below deck livewell, it may beequippedwithanoverflowseacock thatwill need tobeopenwhileusingthelivewell. Some livewellsareequippedwithanaeratorpump thatwillrecirculatethelivewellwatertoincreasethewater’soxygencontent. Be sure to keep the livewell pump thru-hull fitting cleanofdebrisandsand.Thepumpcanbedamagedifdebrisorsandentersthepump.Becarefulinshallowwatertoavoidintroducingsandintothelivewellpump. To empty an above-deck livewell, turn OFF the livewellpump.Then remove the livewelldrainplug.Toemptyabelow-decklivewell,activatethelivewelldrainpump.Besuretocloseallseacockswhennotusingthelivewell.

Some below-deck livewells are equipped with a drain plug in-stead of a drain pump. Removing the drain plug will empty the livewell into the bilge, which could damage boat equip-ment or cause the boat to sink if the water is not immediately removed via the bilge pump.

Propeller Theselectionofthecorrectpropelleranditsconditionarethemost important items forpeakboatperformance.Thepropeller’sdiameterandpitchhavebeenmatchedtotheengine(s)fortrouble-freeoperationandmaximumperformance.Seetheengineowner’smanualforpropellerremovalandreplacementprocedures. Allmodelsshouldbe“propped”tobeintheupperhalfofthemaximum RPM rangewith the boat lightly loadedand theoutboardtrimmedappropriately. If fuel consumption is higher than normal or the handlingcharacteristicshavechanged,thepropellermaybedamaged.Adamagedorunbalancedpropellercancauseexcessivevibrationor increased noise.When either condition is noticed, stop theengineandcheckthepropellerfornicks,cracks,pitting,distortionorotherdamage. Note:Neverrunwithadamagedpropeller.Furtherdam-agemayresulttotheengineordriveunit.Keepasparepropelleronboardtocontinueanexcursionwithoutspoilingtheouting.

Running a boat with a damaged or unbalanced propeller can result in further damage to the engine or the drive unit.

Ifthepropellerisdamaged,changeit.Detailedproceduresarefoundintheenginemanual.Ifareplacementpropellerisnoton-board,returntoportslowlytopreventfurtherdriveandenginedamagefromanout-of-balancecondition.Watchthetemperaturegaugetoensuretheenginedoesnotoverheat. Cavitation: Cavitation is the formation of air bubblesalongthesurfaceof thepropeller.Typicalcausesofcavitationareadamagedpropeller,theoutboardtrimmedouttoofarorahullprojection in frontof theengine.Reconditionor replacedamagedpropellers. Ventilation: This is the formation of a void around thepropeller, usually on entering or leaving a sharp turn.Withoutwatertoturnin,thepropellerrunsfeeandtheboatnearlystopsmoving forwarduntil thepropeller findswater to turn inagain.Whenventilationoccurs, throttleback immediately. Ifventilationcontinueswhenyouresumespeed,itmaybenecessarytoadjusttheenginetrimortheload. Note:SeeyourauthorizedHydra-Sportsdealerforthelatestproducttestinginformationonthepropellerselectionandset-up.

Refrigerator AnAC/DCrefrigeratorisavailableonmanymodels.Whenconnectedtotheshorepower,the12VACpowersupplyover-rides the12VDCsystem. IncaseofanACpower failure, therefrigeratorwillautomaticallyswitchbacktoDCpower.


Note:ArefrigeratoroperatingonDCpowercandrawabatterydeadinlessthanaday.Toavoidexcessivebatterydrain,keep the temperaturecontrolatamediumsetting.Onanover-night trip, run theengineoccasionally toensureyourbattery ischarged. Refer to the refrigeratormanual formore informationaboutrefrigeratoroperation.

Seacocks Theboatmaybeequippedwithseacockstoclosethru-hullfittings,someofwhicharebelowthewater line.Closeallsea-cockswhentheboatisinthewaterandunattended,topreventwater intake.As your authorizedHydra-Sports dealer to locatealltheseacocksontheboatandtodemonstratetheiroperation.Openandcloseall seacocksat leastonceamonth topreventdifficultoperation.

Steering System Theboatisequippedwitheitherahydraulicsteeringsystemoramechanicalcablesystem that isequippedwithano-feed-back feature. The hydraulic steering system is comprisedof thehelmpumpandreservoir,hydraulichosesandthehydrauliccylin-der.Thehelmassemblyactsasapumptomovetheoilthroughthesystem.Inmanyrespectsthistypeofsteeringissimilartothemechanicalsystem. Insteadofactivatingacable, turningof thehelmcausesfluidinthehydraulichosestoflowandactivatethehydrauliccylindertoturntheoutboardmotor. Note:Ifequippedwiththehydraulicsystem,aslightclick-ingsoundmaybeheardasthewheelis turned.Thissoundistheopeningandclosingof thevalves in thehelmunit; this isnormal. Inthemechanicalcablesystem,arotarydrumorrack-and-pinionassemblyismountedunderthedashbehindthesteeringwheelwithaone-piececablerunning through theboat to theengine.Atthetransom,thecableturnsandisconnectedtotheengineoroutdrive. It is important for theoperator toget thefeelof theboat’ssteeringsystem.Turn thesteeringwheel from full left to full rightand ensure the motor steering arm is turning accordingly. Thesystemshouldoperatefreelyandsmoothly.Thecableanditsfit-tingsshouldbekeptclearofthefuelline,controlcables,electricalwiringoronboardgearwhenthemotorismovedthroughitsfullsteeringcycleinbothrunningandfull-tiltpositions. Allfittingsandcablesshouldbeinspectedforcorrosionordamageandreplacedifnecessary.Checkforthepresenceoftheoriginalself-lockingnuts thatareused to fasten thesteering linkrod(ordraglink)betweenthesteeringcable(s)andtheengine(s).Thesenutsmustneverbereplacedbycommonornon-self-lockingnuts,whichcan vibrateoff.Also, the steeringwheel shouldbeinspectedforloosenessandtightened,ifnecessary.Replacethesteeringwheelifthereareanycracksaroundthehuborbaseofthespokes. Steeringorpropellertorquecanbepresentinanydrivesys-tem. In some systems, it ismorenoticeable than inothers.Anyconcerns or questions regarding the boat’s steering should bedirectedtoyourauthorizedHydra-Sportsdealer.Often,thedealercan provide guidance and adjustments to the system that canremedyissuesthatoccur. Note:Seethesteeringmanufacturer’srecommendationsforcleaning,lubricationandmaintenanceofthesteeringsystem. Note: Thesteeringsystemshouldbeinspectedbyaquali-fiedmechanicatregularserviceintervals.

Stove Theboatmayhaveaportablebutaneoralcoholstove.Toavoidaccidents,operate the stoveonlywith theboat isat restandstable.Donotoperatethestovewhentheboatisrockingorunderway. Refer to the stove owner’s manual for safety instructions,maintenance,safetyandproperoperatingprocedures.

Toilet (Marine Sanitation Device – MSD)Portable Toilet: Aportabletoiletisavail-ableonsomemodels.A self-contained toiletprovidessimpleopera-tion and convenientdisposal of waste.Waste is transportedofftheboatbyremov-ing the holding tank.Dispose of the wasteproperly at a dumpstationorotherappro-priatelocation.Donotdump the tank’s con-tentsoverboard.Someportabletoiletscanbeemptiedatadocksidepumpout.Seetheholdingtanksectionthatfollowsforthatoperatingprocedure. Note:Amarinetoiletislimitedtowhatcanbeflushed.Toavoiddamage,donotthrowpapertowels,cigarettes,etc.,intothebowl. ForMSDswithaholding tank,apumpdraws rawwaterthrough the intake seacock in thebilge to flushwaste from theMSD into the tank. The seacockmust be open before flushingtheMSD.Theseacockisopenwhenitshandleisinlinewiththehose.Donotdrop foreignobjects into theMSD.Somethingassmallasacigarettecoulddamagethissystem. BesuretoflushenoughrawwaterthroughtheMSDsonosolidwasteremainsinthehosetotheholdingtank.Solidwasteremaininginthehosecancauseodors.Ifwastedriesinthehose,itreducesthediameterofthehose,whichcancontributetofutureflushingproblems. Note:Lessodorisgeneratediffreshwaterisleftinthetoiletbowlinsteadofrawwater.Pouringapintorsointothebowlwillformawaterseal. WiththeownerspacketweremanualsprovidedbytheMSDmanufacturer.Reviewthisinformationcarefully.Checkthemanu-facturer’smanual for spareparts recommendations. If theMSDneeds repair,keepingkeypartsonboardcanassureyouofabetteroutingbypreventingdelaysintoiletrepair.

Holding Tank:Itisillegaltodischargewastefromama-rinesanitarydeviceintothewaterinmostareas.Itisyourrespon-sibility tobeawareofandadheretoall local lawsconcerningwastedischarge.ConsultwiththeCoastGuard,localmarinaoryourdealer foradditional information.Note that fines for illegal waste disposal are substantial, beginning at $3,000 per occurrence in many locations. Onmodelssoequipped,theholdingtankprovidesstorageforwasteflushedfromtheMSD.Youcanemptytheholdingtank

Washdown, Raw Water Cockpit Theboatmaybeequippedwithoneof twodifferent rawwater cockpitwashdown systems. Thededicated systemhasawashdownpumpthatdirectsrawwatertothecockpithostfitting.Beforeactivatingthepump,besuretoopenthesystemseacock. Somemodelsareequippedwithalivewellwashdownsys-tem.Inthissystem,therawwaterpumpsupplieswatertoboththelivewelland thecockpitwashdown.Tooperate thewashdownsystem,firstopen thesystemseacock.Next,use the“T”handleonthelivewellsprayheadtocloseoffthesprayhead,andthenactivatethepumpwiththelivewell/washdownswitch.Water Heater Awaterheaterrequiresafreshwatersystem.Thefreshwaterpump supplieswater to thewater heater from thewater tanks.Checkwith yourauthorizedHydra-Sports dealer for the capac-ityof thewaterheater.Abreakeron theACelectricalpanel isusedtoturntheheaterON.TheheaterwillnotoperateusingDCpower. Note:BeforeturningthewaterheatercircuitbreakerON,makesurethewaterheaterisfullofwater.TurningONpowertoanemptyheatercoulddamagetheheatingelementsandrenderitun-usable.

Hot water can cause serious burns! Water can become very hot. Always check the water temperature before using water.


using a dockside pump out. Connect the hose from the pumpoutfacilitytothefittingmarkedWASTEonthesidedeck.Whenpumpingouttheholdingtank,placethewastecapinasecureplacebecauseitisnottethered.Ifitisdroppedinthewateroritfallsoverboard,itisunlikelytoberetrievable.Considerkeepinganextracaponboardjustincareitdisappears.

Waste in holding tanks can form methane, an explosive gas. Keep the vent open and clear of obstructions. Keep fire and flame away when maintaining sanitary systems.

FlushtheMSDseveraltimestocleanthewastebuildupoutofthelinesandrinsethetank.Iftheboatwillbeleftunusedforsev-eraldays,flushingfreshwaterthroughtheMSDwillclearwastefromthelines.Wasteinthelinestendstodryout.Thesehardenedwastesmayaffectfutureoperationbecausetheycausetheinsidediameterofthehosetobecomesmaller.

P R E PA R AT I O N

US I N G C A R E W H E N F U E L I N G4 4 4

2011 Hydra-Sports Owners Manual • Using Care When Fueling • Page 9-1

Hydra-Sports recommendsdaily inspectionof thebilge forforeignmaterialsandthepossibilityofgasoroilleakagedetec-tion.Aspartofyourdaily inspection, includeavisualcheckofthefuelline.Ifyouseedamagetothelineorinanywaysuspectdamageor fuel leakage,DONOTSTARTTHEBOAT! Immedi-atelycallanauthorizedHydra-Sportsservicingdealerandlethimorherassessthesituation.Eveniftheoutingiscanceled,leakingfuelcancauseseriousdamagetotheenvironmentandmaybeapotentiallyhazardoussituationforpeopleandpropertyinthearea.Therefore,itiscriticaltoattendtoanyindicationthatthereisfuellinedamageorfuelleakageassoonaspossible.

Gasoline is extremely flammable and highly explosive under certain conditions. Always stop the engine and never smoke or allow open flames or sparks within fifty (50) feet of the fueling area when fueling.

Take care not to spill gasoline. If gasoline is spilled acciden-tally, wipe up all traces of it with dry rags immediately and dispose of properly on shore.

Gasoline is explosive. If a gasoline odor is present or gaso-line is visually observed in the bilge area during inspection, DO NOT START YOUR ENGINE! Remove the ignition key from the ignition switch and call an authorized Hydra-Sports dealer for service.

Carefully review the engine manufacturer’s owner’s man-ual, paying particular attention to the requirements and sug-gestions regarding fuel and storage/winterization. Untreated fuel that sits for extended periods of time may damage the engine.

Fuel System NOTE: Several models have a fuel fill/fuel vent combination cap instead of a separate fill and vent. The fuel system is designed to prevent fire and explosion and to provide a continuous flow of clean fuel to the engine. It meets or exceeds the Federal requirements of the U.S. Coast Guard at the time of manufacture. The system is also certified by the National MarineManufacturersAssociation(NMMA).Everyfueltankmust

passrigidtestsandinspectionsbythetankmanufacturer.Beforetakingdeliveryoftheboat,checkthatthedealerhascom-pletedafullinspectionoftheentirefuelsystem.Youshouldalsoinspecttheentiresystematleastonceayear.

• Gas Deck Fill: These boats have an internal gas tankequipped with a deck fill plate labeled GAS or GASOLINE. Be sure to use the proper grade of fuel as specified in the engineowner’smanual.

• Gas Tank Vent:Astheenginedrawsdownfuelinthetank,airentersthetankthroughtheventtopreventavacuumfromforming inside the tank. While filling the tank, be aware that gasoline entering the tank pushes air in side the tank outthrough the vent. Be careful when filling the tank as otherwise gaswillbeejectedthroughtheventwhenthetankisfullornearlyfull.

• Valves: Fuel pick-up lines for the engine have either a shut-off valveorananti-siphon featureat thepointwhere the lineattachestothefueltank.Theanti-siphonvalveautomaticallypreventsgasoline fromsiphoningoutof thegas tank if thefuellineseparates.Themanualshut-offvalvecanbeusedtoshutoff thefuelsupplyincaseofanemergencysuchasabreakinthefuelline.Thevalveisunderaninspectionplateinthecockpitsole.

• Fuel tank: The internal fuel tank fittings are accessible through removable deck plates. The tank is equipped with a gas fill line,gasventlinesendingunitandenginefuelpick-up.

• Two-stroke engines operate on an oil-gas mix. (Four-stroke enginesrunongasolineonly,likeanautomobile,withoilcir-culatingintheengineforlubrication.)Alwayschecktoensuretherearenoleaks.

2011 Hydra-Sports Owners Manual • Safety Checks & Services • Page 10-1

Thefollowingchecksandservicesareessentialtosafeboat-ing and must be performed. Get in the habit of performing these checksinthesameordereachoutingsothatitbecomesroutine.

DO NOT launch or operate the boat if any problem is found during the Safety Check. A problem could lead to an accident during the outing, resulting in death or serious injury. Any and all problems should receive attention immediately. See your authorized MasterCraft Hydra-Sports dealer’s service department for assistance.

Before Each Operation These tasks are best accomplished before the boat islaunched.• Follow all engine and drive train pre-operation maintenance

andsafetychecksasoutlinedintheengineowner’smanualprovided.

• Check the weather report, wind and water conditions.• Check for recommended on-board tools and parts.• Check that all drain plugs are installed properly, including

bilgeandreardrain.• Check the propeller and shaft for damage.• Check that there is an adequate supply of fuel.• Check that the steering system operates properly.• Check that required safety equipment is on board.• Check that the windshield and extrusions do not show any

damage.

When boating, avoid using the windshield as an aid for bal-ance or getting out of a seat. This causes undue stress to the window frame and could damage it, which may not be cov-ered under warranty.

• Check that the fire extinguisher is fully charged.

• Check that no fuel, oil or water is leaking or has leaked into thebilgecompartment.

• Check all hoses and connections for leakage or damage.• Check that all required Scheduled Maintenance Checks and

Services(seefollowingsections)wereperformed.

During Operation• Check gauges frequently for operating conditions.• Payattentionthatcontrolsoperatesmoothly.• Note any excessive vibration.

After Operation• Check for fluid leaks.• Check the propeller for damage after removing the boat from

thewater.

SA F ET Y C H E C KS & S E RV I C ES4 4 4

2011 Hydra-Sports Owners Manual • New Boat Break-In • Page 11-1

Theearlyhoursofoperationarethemostimportantfortheboat. Proper break-in will ensure maximum performance and the longestpossiblepower-trainlife.Thebreak-inperiodallowsmov-ingpartswithintheengineandtransmissiontowear-inproperly.AllHydra-Sportsboatsarelake-testedonthewaterbeforeleavingthefactory,butthebreak-inmustcontinueduringtheearlyhoursofyour ownership. Consult the engine owner’s manual supplied in theowner’spacketformoredetailregardingthiscriticalperiod. Failure to follow the break-in procedure exactly as stated will void the engine warranty! NOTE: Before operating the boat for the first time you must readtheenginemanufacturer’smanualcompletelyinadditiontothisManual! Please follow the break-in procedure carefully. Close atten-tiontothefollowingisveryimportant:

• Maintain the proper oil level. Until the piston rings, cylin-derandotherworkinginternalpartsarethoroughlyseated,oilconsumptioncanbehighandmustbecarefullywatched.(Thiscontinuestobeimportantafterbreak-inaswell).

• Pay close attention to the gauges.Itisimportanttostoptheengine immediately if the gauges indicate a problem. Low oil pressure and overheating are serious issues and require immediateattention.

• Abnormal vibration or noises. These symptomscanpre-cede trouble and should not be ignored. Occasionally,hardwaremayworkloose,mountingsmayneedtobetight-ened or the driveline may require attention.

• Fuel, oil or water leaks. Leaks can pose a serious safety threat. Ifoneoccurs, it ismost likely todosoafterafewhoursofoperation.

• Plane the boat quickly.Operatingtheboatatlowspeedsplaces an excessive load on the engine. Plane quickly, then backdowntoaslowerspeed.

First Hours of Operation Each engine manufacturer has detailed and specific require-mentsforproperenginebreak-in.Thatinformationisfoundintheengine manual supplied, and must be followed exactly as indicat-ed. Failure to do so could cause engine damage and/or failure thatisnotcoveredunderwarranty.

After Break-In See the Scheduled Maintenance Checks and Services sec-tionformoredetails.

Failure to follow the engine oil recommendations listed in the engine manual can cause additional engine wear and increase the possibility of engine component failure. Damage to the engine due to incorrect oil usage can be costly to repair, and is not covered by the warranty!

Starting and Basic Operation NOTE: If you are operating this boat for the first time, you mustfollowtheengineanddrivetrainbreak-inproceduresasde-scribed in the previous section and the engine manual. Failure to followtheseproceduresmayresult inseriousdamageandmayvoidanywarranties!

Before Starting Familiarize yourself with the controls and indicators used on this Hydra-Sports boat. Perform all Safety Checks and Services as described earlier. Also perform all Scheduled MaintenanceChecks and Services.

Step 1: Inspect the bilge for any fluid/vapor leakage. Step 2: Check the hull drain plugs. Make sure they are installed

andsecure.

Before starting the engine, open the bilge compartment access and check for gasoline fumes, fuel and oil leaks or the pres-ence of fuel or oil in the bilge.

NOTE: Always start the engine with the control lever inthe neutral position or with the shift disengaged. Your boat isequipped with a neutral-start safety switch that will not allow the enginetobestartedwheningear.

Starting the EngineStep1:Attachtheemergencyenginesafetyswitchtether(lanyard)

toanarticleofyourclothingandtotheswitch.Step 2: For normal starting, leave the throttle lever in neutral. The

N E W B O AT B R E A K - I N4 4 4


electroniccontrolswillmeterthecorrectfuelandairauto-matically.

Step 3: Turn the key switch to the start position and hold untiltheenginestarts.Releasethekeyassoonastheenginestarts.

Do not operate the starter motor continuously without a “cool-down” period. Each engine manufacturer has specific guidelines regarding this procedure; refer to your engine own-er’s manual for details. Failure to allow a cool-down period when trying to start an engine that does not immediately fire do so may cause the starter to overheat, resulting in damage. Failure to release the ignition key after the engine has started may cause damage to the starter motor and drive.

Shifting Gears Whenshiftinggears,alwaysmovethecontrolleversmoothlyand quickly into gear. Do not hesitate. Slow gear engagement coulddamagetheshiftingmechanisminthelowerunit. NOTE:Whenshiftingfromforwardtoreverseorreversetoforward,besure tostop thecontrol lever in theneutralpositionandallowtheenginetofallbetween600-800RPMbeforecom-pletingtheshift. A one-hand, lever control operates as both agear shifterandathrottle.Theleverautomaticallylocksintheneutralpositionforsafety.Shiftingisaccomplishedbymovingtheleverforwardorbackward. Never attempt to shift without the engine running! Underway If the oil pressure gauge (where equipped) indicates low ornooilpressure, immediatelystop theboatasoutlinedbe-lowandchecktheoillevel.Ifthetemperaturegaugeindicatesoverheating,immediatelystoptheboatasoutlinedbelowandcheckforblockage.

Continued operation after the warning light has illuminated or alarm has sounded may cause severe engine damage.

StoppingStep1: Slowlybringthecontrollevertotheneutralposition.Step 2: Turn the ignition key to the OFF position to stop the en-

gine.

Step3:If any problems were encountered during operation,havetheboatinspectedbyanauthorizedHydra-Sportsdealer. Request any necessary repairs before resuming operationoftheboat.

Operational Hints Hydra-Sports urges allwhowill be operating the boat toseek certified instruction from the local boating authorities. This section is designed to present themost basic operational prin-ciples.ItisNOTintendedtocoverallconditionsencountereddur-ingoperation.Therefore,theprinciplespresentedinthisOwner’sManualare limited to the facts relateddirectly to theoperationoftheboat,whiletheresponsibilityfortheproperapplicationofthese principles belongs with the boat owner and/or operator.

Loading Never overload the boat. The maximum weight capacity as listed on the certification plate includes all items added to the boat (includingpersonsandgear).Properdistributionofweightiscriticaltoboatperformance.Allocatetheloadasevenlyaspossible. The maximum weight capacity includes filled, factory-in-stalled fuel, bait and fish tanks. Portable fuel tanks, coolers and gearaddedbythecustomerreducesthecapacityoftheboat. Note:Addingmoregearreducesthenumberofpeopleandthe amount of gear that can be added. Failure to adhere to the total maximum capacity may result in too much strain on the drive trainormaysinktheboat.Thisisnotcoveredunderwarranty!Seethe Common Sense Approach section of this Owner’s Manual regarding weight, including calculations for added water for fish tanks,baitstationsandlivewells,andgasoline.

It is the boat operator’s responsibility to ensure that the boat is never overloaded. Too much additional weight may cause the boat to overturn or sink, which can result in serious bodi-ly injury or death.

Emergencies Knowhowtouseandspotdistresssignals,and toofferassistance if possible. Remember, you may need assistancesomeday.

Courtesy Alwaysrespecttherightsofothersonthewater.Keepwidewhenpassing, slowdown in crowdedareas,bealert andbeawareofyourwakeandwash.

voidthewarranty.Again,workingwithanauthorizedHydra-Sportsdealer is your best bet to ensure excellent performance.

Unusual Operating Conditions Ifthebodyofwaterisunknown,talktolocalboatersaboutthetypeofobstaclesthatmaybeencounteredbeneaththewater’ssurface.Reefs,rocks,treestumpsandsandbarsarealldangerousanddamaging.Beespeciallywaryofriversandman-madelakes.Rapidlychangingconditionscancausedailychangesinunder-waterhazards. Stay well clear of floating debris. What looks to be a small branchinthewatermaywellturnouttobeanentiretree.Whentravelingthroughweedyareas,keepaneyeontheenginetemperature gauge.Weeds caught upandblocking thewaterflow through the raw water intake will cause trouble. Also, after leaving theweedyarea,shift toneutral fora fewsecondsandthentoreverseforafewsecondstounwindanyweedsthatmayhavewrappedaroundthepropeller.

Docking and Tie-Up Beforetyinguptheboat,besuretouseenoughdockbum-perstoprotecttheboatfromdamage.Ifpossible,tie-upwiththebow toward the waves. Use good quality double-braided nylon line.Tie-uponlytotheliftingortie-downeyesorcleats.Neverusethehandrailsorskipylon. If theboat is tobemooredfora longperiodof time,usechafing protectors to protect the gel coat finish. Leave a little slack in the lines, allowing for somewavemovement or tidal actionwhereapplicable. Iftheboatistobekeptinornearwaterfortheseason,con-siderthepurchaseofaboatliftandbottompaintforthehull. Theseliftspreventthebuild-upofmarinegrowthonthehullaswellasprotectingtheboatfromdamagetypicalofon-waterstorage,suchasblistering.Makesuretheboatliftsupportsthehullcorrectly. See the next section, Lifting the Boat. NOTE: On boats that are equipped with the engine synchro-nizing switch (models with two engines), this switch should bedisengagedduringdockingorwhenloadingandunloadingtheboat from a trailer. These maneuvers require a sensitive touch and controlthatmaynotberealizedwhentheswitchisengaged.


First Time Operation When taking to the water for the first time, you must keep in mindafewgeneralguidelines:

• Practicemakesperfect!Startincalmwaterwithnowindorcurrentandplentyofroomuntilyougetthefeelfortheboatanditscontrols.

• Proceed slowly! Give yourself time to think, react and maneuver.• Recognize outside forces! Check the wind direction and ve-

locity,aswellaswatercurrentsandwaves.• Haveacrewonhand!Have friendsor family readywith

fenders,linesandaboathooktoassistyouwhendocking,aswellaslaunchingandloading.

• Rememberthataboatisnotanautomobile!Boatscannotbemaneuveredandstoppedlikeacar.Boatssteerfromthestern(rear)andhavenobrakes.

Basic Maneuvering Steering response isdependentupon three (3) factors:en-gineposition,motionandthrottle.Whilehigh-speedmaneuveringisrelativelyeasyandtakeslittlepractice,slow-speedmaneuveringis far more difficult and requires time and practice to master.Withboth steeringandpropulsionat the rear of theboat, theinitiation of a turn pushes the stern of the boat away from thedirectionoftheturn.Thesternfollowsalargerturningcirclethanthebow.Thisisespeciallyimportanttorememberwhenmakingmaneuvers within close quarters. While the effects of unequal propeller thrust (torque steering), wind,andcurrentmaynotalwaysbepresent,apracticeddriverwill use them to his/her advantage. Stopping—or checking headway—is a technique that must be mastered.Withnobrakes,reversemustbeusedtostoptheboat.Themomentumoftheboatwillvaryaccordingtotheload.Makeitapracticetoslowtono-wakespeedbeforeshiftingintoreverse. When practicing maneuvering techniques, always do so in open water that is free of traffic. Adequate practice may make the difference between a pleasurable boating experience or a potentiallydamaging(attheveryleast,embarrassing)one.

High Speed OperationHydra-Sportsboatsaredesignedtobehigh-performanceboats.Professionaldriverswithadvancedoperatingskillsperformhigh-speedmaneuvers.DONOTattempttoduplicateorsimulatethesefeats.Paid,professionaldriverslogthousandsofhoursonthewa-terandcarefullychoreographeverymove.Plansaremadeinad-vanceintheeventtheroutinemustbeaborted.Maneuversofthisnaturecouldcauseseriousinjuryordeath,aswellasdamagetoyourHydra-Sportsboatthatwillnotbecoveredunderwarranty.

Boat operators should never attempt to duplicate operational skills of professional drivers. When such maneuvers fail, it can result in serious injury or death.

Hydra-Sports’enginemanufacturerssuggestthatconsumerscon-sultwiththedealerfromwhomtheboatwaspurchasedregardingthebestpropellerfortheapplicationinwhichtheboatwillprimar-ilybe run.However,beaware thatchanging thepropellermay


Remaining Docked Theremaybetimeswhentheboatwillremainatdockforan extended period of time. While it is better to remove the boat fromthebodyofwateriftheboatwillnotbeusedregularly,cir-cumstances may require leaving the boat tied-up. It is important to notethatevenwhentheboatisatrest,water—especiallysaltwa-ter or brackish water—will continue to assault the boat’s finishes. Therefore,thezincanodesshouldbecheckedregularly,atleastonce every two weeks, to determine whether there is sufficient de-terioration to require replacement of the anodes and better protect theothermetalcomponents,particularlythoseunderwater.

Remaininginwater,whethersaltorfresh,alsoimpactstheboat’s hull and finish. In time, the water will cause a conditioning knownas“blistering,”tooccurtothegelcoatandtheunderlyingresin.Thisisnotonlyunsightlybutalsoultimatelyaffectstheboat’sstructural integrity. Therefore, the Hydra-Sports limited warrantyrequires that the underside of the boat be painted with an ap-proved protective paint. See the Cleaning section of this Owner’s ManualandconsultwithyourauthorizedHydra-Sportsdealerforassistanceinassuringthatyourpaintselectionisappropriate.Thisrequirement applies to boats that will be left in any body of water formorethanthirty(30)days.

C A R E A N D M A I N T E N A N C E

L I F T I N G T H E B O AT4 4 4

2011 Hydra-Sports Owners Manual • Lifting the Boat • Page 12-2

Whentheboatishoistedfromthewater,properuseofaslingsystemisrequiredforallHydra-Sportsmodels.

DO NOT use the hard top for lifting. They are NOT designed to be used as a central lifting point. See the Storage Cradle sub-section of this section. Also never lift a boat with wa-ter in the bilge or containing a water-filled device such as a fresh water tank or livewell. The extra stress will put an ex-cessive load on the hull and lifting equipment that may seri-ously damage the boat. Such damage may not be covered by the warranty.

Using Lifting Eyes Anoverheadhoistwithaminimumten-toncapacityshouldbeusedtoliftyourboat.Cablesshouldbeproperlyratedforeachmodel.Eachcableshouldberatedatorabovethefullweightofthemodeltobelifted.

Using Lifting Slings Anoverheadhoistwithaminimumten-toncapacityshouldbeused.Slingsmustbesix(6)incheswidebytwenty(20)feetlongand each sling should have aminimum capacity rating that isequivalenttotheweightofthemodelthatistobelifted.Useaneight-footspreaderbaroneachslingtopreventdamagingsidepressuretothedeckorgunwalemolding.

Lifting slings must never contact hardware protruding from the hull. Damage may result that would void the warranty.

When the boat is out of the water, it is important to support the hull correctly to avoid any hull damage. Such damage may void the warranty.

Storage Cradle Ifastoragecradleisused,thehullmustbeproperlysupportedto prevent load damage. This can occur with as little as fifteen (15)poundspersquare inchofpressure.DONOTsupport theboatbyrestingthehullonthekeel(thecentralfore-and-aftstruc-turalmemberinthebottomoftheboat’shull,extendingfromthebowtothestern).Verticalsupportsmustextendfromthechine(theangular intersectionof thebottomandsidesof theboat) to thekeelwithnogapsbetweenthehullandcradlesupports.Atotalsupportareaofatleast250squareinchesisrequiredforpropersupportofboatsunder25’and500squareinchesforboatsover25’.Protectallitemsextendingfromthehull(i.e.,transducers,etc.)topreventthemfromrestingonthecradleortheground.DONOTapplyanyloadstresstothepropellerorotherprotrudingitems.

4

2011 Hydra-Sports Owners Manual • Corrosion Prevention • Page 13-1

NOTE: DAMAGE DUE TO CORROSION IS NOT COVERED UNDER WARRANTY!

Galvanic Corrosion Galvaniccorrosion(electrolysis)totheboatisthedecompositionofmetalduetotheeffectsofelectrolyticaction.Whentwo(2)dissimilarmet-als are immersed in a conductive fluid (e.g., salt water),anelectriccurrentisproduced,muchlikethe action of a battery. As the current flows, it takeswithittinybitsofthesoftermetal.Ifleftun-checked,severedamagemayoccurovertime.Iftheboatisoperatedinsalt,pollutedorbrack-ishwaters,eventemporarily,theboatshouldbeequippedwithatransom-mountedzincanodetopreventdamagetothosemetalpartscomingincontactwiththewater. The zinc is, by design, self-sacrificing. It is slowly eroded away by electrolytic action andrequiresperiodicinspectionfordeterioration. Ifthezincshowsextremeerosion,itmustbereplacedtocon-tinueprotection,ordamagetoothermetalpartsmayresult.Hydra-Sportsboatscomeequippedwiththezincanode.Forfreshwaterboatsthatmaybeoperatedinpollutedorbrackishwater,anauthorizedHydra-Sportsdealercanprovideguidanceinsecur-ingandinstallingazincanodeforprotection.

Salt Water Corrosion Theboathasbeendesignedforoperation insaltwater,butmayalsobeusedinfreshwater.Ifoperatingafresh-waterboattemporarily in salt, polluted or brackish water, thoroughly flush the boatwith freshwaterassoonaspossibleafterward.Theentireengine cooling system should be flushed with fresh water for at leastten(10)minutesaftereachuseinsuchwaters,aswellasanycomponents,suchasalivewell, thathadwaterrunningthroughthemduringoperationfromthebodyofwater. Boats should haveany systems that havebeen subjected toexposuretosaltwater,aswellastheentireboatexterior,carefullyandthoroughlywashedalloverasdirectedintheCleaning the BoatsectionofthisOwner’sManual.

Marine Growth Ifacceleratedmarinegrowthisaproblemintheareainwhichtheboatwillgenerallybeoperated,ananti-foulingbottompaintmaybenecessarytoslowgrowthwhileprotectingthegelcoat.Boatsthatareleftinthebodyofwater—whetherfreshorsalt—forperiodsexceeding30days,musthavetheanti-foulingpaintontheboathullinordertokeeptheHydra-SportsLimitedWarrantyineffect. Beforeselectingabottompaint,talkwithotherboatersandanauthorizedHydra-Sportsdealer’sservicedepartmenttodeterminethe product that works best in the area. Many local variablesmayalsoaffecttheselectionofpaint.Besuretofollowthepaintmanufacturer’sdirectionsexactly.

Be sure all fasteners used are approved and rated for marine use. Most fasteners used on Hydra-Sports boats are stainless steel or specially coated to resist corrosion.

Use of improper parts may cause component failure. Such failure may result in death or serious injury!

Stainless Steel and Chrome Stainlesssteelandchrome-platedpartsarenottotallyresistanttocorrosion.Occasionalcleaningandpolishingwithamarinechrome-and-stainless polishwillmaintain and extend the life oftheseparts.Insaltwaterareas,itisimperativethatyouthoroughlyrinseallhardwarewithfreshwaterandapplyalightcoatingofprotectiveoiltoenhancetheappearanceaftereachuse.

Exposure to salt water will cause corrosion leading to sig-nificant damage to stainless steel and chrome parts. Failure to thoroughly rinse salt water from all hardware, and to apply protective oil after each exposure to salt water, will accelerate the corrosion of hardware and will void your warranty.

C O R R O S I O N P R E V E N T I O N4 4 4

2011 Hydra-Sports Owners Manual • Cleaning the Boat • Page 14-1

Periodiccleaningisthebestwaytokeepyourboatlookinglikenew.Regularwashingandwaxingkeepdirtandbuild-up fromdeteriorating the finish. If you keep your boat in showroom-new condition thenyourpersonalsatisfactionwillbehigherand theresalevalueofyourboatwillbegreater. The boat is made of fiberglass-reinforced plastic resin material thatiseasytocleanandcarefor.Severallayersofresinmaterialarechemicallybondedtogethertoformthehull.Thesmoothout-sidesurfaceofthehullisalayerofgelcoatresin.Thegelcoatisasolidcolorthatisonlyafewmillimetersthick. Beneaththegelcoatsurfaceisaseriesoflayersofchemicalresin, fiberglass mat and woven roving. It is these layers that give theboatitsstrengthandmaintainthehullshape.Theboatbottomalsousesspecialcore-matmaterial for itsstrength-to-weightandsuperiormarineperformance. Even thoughaHydra-Sportsboathascarefullycraftedboatsfromresilientmaterials,itisstilltheresponsibilityoftheboatownertoperform regularand routine cleaningmaintenance to ensurethat theboatexterior, interiorandcomponents retainboth theirappearanceandstrength.

Hull Whenwashingtheboat,useamilddetergent,suchasDawnor Ivorydish soap,or similar commercially-produceddetergent,andwarmwater solution.DONOTuseabrasivecleaners, sol-vents,ammoniaorchlorine,as thesewilldamage thegelcoatsurface.Underextremeconditions,specialcleanersmaybeusedtoremovemarinegrowthfromthehull.(SeeanauthorizedHydra-Sportsservicedepartmentforfurtherinstructions.)

Upholstery Whilethevinylismadetowithstandtheelements,itisimportanttocareforvinylbykeepingitcleanatalltimes.Manysubstancesmaystainthevinylifleftuntreatedoveraperiodoftime.Remembertoremoveanycontaminantandcleanvinylimmediately. Regular washing with mild detergent and warm water orvinyl cleaners is sufficient to keep the cushion and vinyl cover-ingsingoodcondition.Donotsoakthecushion,anddrythor-oughlyafterwashing topreventmildewaccumulationswhentheboatiscovered.Spraythecushionswithamildewrepellentandpropthemupintheboatwhenitiscoveredtotakeadvan-tageofaircirculation. Hydra-Sportsvinylismadetowithstandtheeffectsofsun,heat,acidrainandsoiling,undernormalconditions,butthisdoesnotpre-cludethecleaningrequirements.Pleaseconsultthefollowingclean-ingrecommendationsbeforecleaningyourupholstery.Certainhouseholdcleaners,powderedabrasives, steelwool,andindustrialcleanersmaycausedamageanddiscoloration,andarenot recommended for use. Dry cleaning fluids and lacquer solvents shouldnotbeusedastheywillremovetheprintedpatternandgloss.Waxesarenotrecommended,asmanycontaindyesandsolventsthatcanpermanentlydamagethevinyl’sprotectivecoating. Insomeinstances,consumershavereportedtheappearance

ofapinkstainonvinylthatisresistanttovariouscleaningmeth-ods.Althoughtherecanbeothercausesforpinkstaininginvinyls,mostpink stainsarecausedbydyesproducedbymicro-organ-isms.Thesedyesaremetabolicproductsofthemicro-organisms,otherwiseknownasaformoffungi. Itisvirtuallyimpossibleforconsumerstoavoidthesemicro-organ-ismsastheyexistintheatmosphere,whicharemoreprevalentinhigh-humidityareas.Raincleansestheair,withtheresultbeingthatthemicro-organismsaredepositedonitemssuchasmarinevinyl. Whilethevinylistreatedtoresistthegrowthofmicro-organisms(meaningthevinylisnotafoodsource),thestainresultsfromfailuretoproperlycleanandmaintainthevinyl.Thismeansthatafteruse,theupholsterymustbecleanedwithasoftbrushandwarmsoapywater,followedbyathoroughrinsewithcleanwater. Thissituationisworsenediftheboatisstoredwithoutproperventi-lationoriftheboatcoverisputonwhilethevinylisstillwet,creatingasituationinwhichallformsoffungi(moldandmildew)thrive. Failuretofollowtheseinstructionsinthepropercareofuphol-sterymaycauseyourwarrantytobevoided! Thecleaningtablepresentedinthissectionisofferedonlyasasuggestionandasanaidinattemptingtodealwithstains.Wedonotguaranteethatthecleaningmethodswillwork.Stainsfromanyexternalsourceareunlikelytobecoveredbywarranty.

Carpet Occasionallywashingwithmild detergent andwarmwateror household carpet cleaners will help keep the carpet clean.Thoroughlyhosethedetergentoutofthecarpetandintothebilge.(Thisisagoodtimetocleanthebilgealso.)Allowtheboattore-mainuncoveredtoairdryforseveraldaystopreventanymildeworodorcausedbymoisture.

Windshield Incleaningtemperedglasswindshields,thenormalglassclean-ers(fromspraybottlesoraerosolcans)workbest.Whiletheglassisverystrong, itcanbescratched ifanythingabrasive isused.

C L E A N I N G T H E B O AT4 4 4


Harshchemicalsorsolventsshouldbeavoidedbecausetheymayaffect the vinyl gaskets or powder-coated finish on the extrusions. MorecareshouldbetakenwhencleaningtheclearEisenglasscurtains,whichareanoptiononsomeboatmodels.SinceEisenglasscurtainsareusuallymadewithclearvinylsheeting,which ismuchsofterandmorepronetoscratchingandhazingthanthewindshieldglass,onlysoftclothsandmilddetergentsshouldbeused.

Enclosed Head Anoptiononsomemodelsistheenclosed,portablehead.Thisconvenience shouldbeemptiedon-shorewithinanacceptableholdingtank,septicsystemorsewer.Itshouldneverbeemptiedwithin theboatingbodyofwateroron-shore,except inanap-provedreceptacle! Theheadshouldbecleanedaftereachouting.Afterthoroughlycleaningwithamilddetergent,addaneutralizingchemicalmadeespecially forportableheads,suchas that foundinRVcenters.Theneutralizingchemicalwillhelpdealwithpotentialodorsthatmightotherwisebefoul.

Hard Top Propercareofthehardtopinvolvesperiodiccleaningwithanon-abrasiveglasscleaner.Therodholdertubesshouldalsobecleaned with glass cleaner. Some of the hard-top is fiberglass with a gel coat finish, which requires a cleaner such as those approved foruseonhullsanddecks.

Interior Cabin Finishes Hydra-Sports has used the finest, highest-grade finishes in the cabin.Asaresult,careshouldbeusedtoavoidabrasivecleanersonanysurfacefoundinthecabin.Gentlecleaningwithmildsoapandwater,followedbydryingwitha100%cottonsoftclothisthebestapproach. Standingwatershouldneverbeleftonanywoodsurfaceasitcanresultinapermanentstain.Becausetheboatoperatesinahigh-humidityatmosphere,attentionshouldbepaidtowhetherbeadsofwaterhaveformedonwoodsurfaces.Ifso,wipewithasoft,cleanclothasneeded. CountertopsareeitherCorian®fromDuPontorGranulonbyFormica.Corian, inparticular, requires regularattention.Soapywater,ammonia-basedcleaners(butnotwindowcleanersastheycanleaveawaxybuild-upthatmaydullthesurface)orcommer-ciallyavailablesolidsurfacecleanerswill removemostdirtandresidue from the finish.

Orange 88 DegreaserRoll OffBleach/Baking SodaTurtle Wax/Tar RemoverAPCOTanneryHarbor MasterAny product not listed above in the list of Acceptable Upholstery Cleaners!Do not use any silicone-based protectants because they will extract the plasticizers, leaving the vinyl hard and brittle. (Eventually cracking will occur.)

Certainhouseholdcleaners,powderedabrasives,steelwool,andsolventcleanerscancausedamageanddiscolorationandare not recommended. Dry cleaning fluids and lacquer solvents shouldnotbeusedastheywillremoveprintedpatternandgloss.Donotusebleachasitwilldeterioratethethread.

Common Stains Steps 1 2 3 Chewing Gum D A Motor Oil B Spray Paint B Mildew or Wet Leaves* C B A Yellow Mustard A B C Oil-Base Paint D B Suntan Lotion* A B Tar/Asphalt D B Lipstick A B Latex Paint A B Crayon D B Ketchup A B Grease D B Ballpoint Ink* E B A Household Soil A B Permanent Marker* E B C Coffee, Tea, Chocolate B

DO NOT USE 409 CLEANER OR SILICONE-BASED PRODUCTS!!!

A=Medium-softbrush;warmsoapywater/rinse/dry.B = Vinyl finish cleaner.C=One(1)tablespoonammonia,one-fourth(1/4)cupof hydrogenperoxide,three-fourths(3/4cupofwater/ rinse/dry.D=Wipeorscrapeoffexcess(chillgumwithice).E=Denaturedalcohol/rinse/dry.

*Sun tan lotion, shoe polish, wet leaves and some other prod-ucts contain dyes that stain permanently.

Vinylupholsteryshouldbecoveredwhennotinusetopro-tect from further sunexposure, treedebris,airpollutantsandacidrain. Forstorage,vinylshouldbecleaned,protected,coveredandstoredinadry,well-ventilatedarea.


Experience has shown that a film builds up on the surface if water is left to dry on the countertop. This film will dull the look of the countertop, making the finish appear blotchy and uneven. To prevent build up of the film, it is very important to wipe the countertopcompletelydryafterspillsandcleaning. SomecolorsofCorianmayrequiremorefrequentcleaningtomaintain a uniform finish. Darker colors tend to require more at-tentionthanlightercolors.Overtime,evenwithpropercare,yourcountertopwillacquireapatina,changingtheappearanceofthefinish. You may restore the look of the original finish by following therefurbishingguidelinesavailableonlineatwww.dupont.com/surfaces/corian.com. Whencleaningthecountertops:•Wipespillswithadampclothandahouseholddishwashingdeter-

gent,mildbleachsolutions,orammonia-basedwindowcleaner.• DonotexposeKaradon tohouseholdor industrialchemicals

suchaspaintstrippers,draincleanersorsolvents. Ifanacci-dentoccurs,immediatelywipechemicalsfromsurface.

• Donotsubjectthesurfacetoheat-emittingappliancesorplacehotitemsdirectlyonthesurface.Alwaysuseahotpadortrivet.

• Avoidcuttingdirectlyonsolidsurface.Alwaysuseacuttingboard.

General Cleaning and Maintenance Cleaningandmaintenancearecrucial tokeepingtheboat inexcellentcondition.Thiswillhelpmaintainthevalueofyourinvest-ment.Notethateverycomponentoftheboatrequiressomeatten-tion. Keep every section of the boat, whether specifically mentioned in thissectionornot,clean, freeofdustanddirt,andasdryasrealisticallypossible.Evensimplematterssuchasleavesthathaveblownontothedeckcanleaveapermanentstainonupholsteryifnot removedand theupholsteryspot-cleaned immediately.Othercommonstains,suchassuntanlotion,food,beveragespills,gum,lipstick,etc.,canleavepermanentmarksonalmostanysurfaceontheboat.Itrequiresvigilancetomaintaintheshow-roomquality.

Failure to properly maintain the boat surfaces and materials as described in this Owner’s Manual and by the product man-ufacturers (who maintain websites that offer additional detail about care and maintenance), can result in damage to the boat that is not covered under warranty.

Acceptable Upholstery CleanersVinyl Finish Vinyl CleanerDish Soap (such as Dawn or Ivory)303 High Tech Fabric Guard™

Unacceptable Upholstery Cleaners409 (it states not for use on vinyl!)FantastikMurphy’s SoapSimple GreenDC PlusArmorAllTop Kote SealantSon of a Gun

B E F O R E E A C H U S E( P r i o r t o S t a r t i n g t h e e n g i n e )

4 4 4

2011 Hydra-Sports Owners Manual • Before Each Use • Page 15-1

All drain plugs must be reinstalled prior to operat-ing the boat!

inspect Seacock Strainer(where equipped) Because a clogged seacock strainer puts undue strain on the engine(s), the strainer should be checked prior to starting the boat. Boats with closed cooling systems are not equipped with this. The seacock strainer is standard on boats built for operation in salt water.

Step1:Removetheplasticwingnutontopofthestrainer.Liftthecover.

Step 2: Remove the filter and inspect for debris. Manually clean thestrainer.

Step 3: Return the filter in place and recover. Tighten the wing nut, but do not over-tighten as it may eventually strip the threads holding the wing nut in place.

inspect the Battery Connections and hold-Downs Because poor connections or hold-downs may result in er-roneous voltmeter readings, Hydra-Sports recommends doing this before starting the boat.

Step 1: Ensure the engine is OFF and the engine safety start-ing switch disconnected. Be certain that the throttle/shift control lever is in neutral. Locate the battery. Batteries are placed in a variety of locations, depending on the model.

Step 2: Check that the battery post connections are clean and tight.Ifnot:

• Loosen and remove the negative terminal connection first. Be carefulnottotouchthepositiveterminalwiththewrench.

• Loosen and remove the positive terminal connection.• Remove the battery hold-downs and remove the battery from

the boat.• Clean corrosion from the battery posts with a battery terminal

cleaner.• Clean the battery with a water-and-baking-soda solution. Use

care to avoid allowing the solution to enter the battery vents. Rinse the battery with fresh water.

Battery electrolyte fluid is dangerous. it contains sulfuric acid, which is poisonous, corrosive and caustic. if electrolyte fluid is spilled or placed on any part of the human body, im-mediately flush the area with large amounts of clean water and immediately seek medical attention.

• Use a battery terminal cleaning brush to remove corrosion from the inside of the battery terminals. Clean the terminals with a water-and-baking-soda solution and rinse with fresh water.

• Check the battery box that normally holds the battery in place to determine whether there is evidence of battery fluid inside it. Battery fluids are corrosive and can cause permanent damage to the battery box. If fluid is evident, wash out the box with the water-and-baking-soda solution that is used in cleaning the terminals. Rinse with fresh water and dry with a cloth.

• Reconnect the positive terminal first, then the negative. Tighten the terminals. Coat both terminals completely with a thin cover-ing of marine grease. Be sure that the rubber boot covers the positive terminal completely.

Note: The boat’s engine(s) is designed to work with the stan-dard electronics installed in the boat. Adding other electrical com-ponents or accessories can change the way the overall electrical system functions. Before adding electrical equipment, consult an authorized Hydra-Sports dealer’s service department. Otherwise, the engine(s) may not perform properly.


Before disconnecting the battery, make sure the ignition key and all accessories are in the OFF position. Also remember to re-attach the cables in the proper order, with the negative cable con-nected to the negative [-] post and the positive cable connected to the positive [+] post.

When charging, batteries generate small amounts of dan-gerous hydrogen gas. this gas is highly explosive. Keep all sparks, flames and smoking well away from the area. Failure to follow instructions when charging a battery may cause an electrical charge or even an explosion of the battery, which could result in death or serious injury.

inspect the throttle and Shift Cables for Kinks, Wear and interference Some engine parts become very hot during operation. This in-spection must be completed while the engine is cool to prevent burns to your skin. Perform this task before starting the boat.

Step 1: Ensure the engine is OFF and the engine safety start-ing switch disconnected. Be certain that the throttle/shift controlleverisinneutral.

Step 2: Locate the throttle and shift cables. Follow each cable back under the floorboards and feel for any kinks and wear on the outer jacket. Any sign of cable damage is cause for replacement. See your authorized Hydra-Sports dealer’s service department if you notice any cable damage.

inspect the Fuel System for Leaks This function should be performed prior to starting the engine(s); and then again after about three (3)-to-five (5) min-utes to determine whether any leaks are apparent.

Step 1: First ensure the engine is OFF and the engine safety start-ing switch is disconnected. Be certain that the throttle/shift control lever is in neutral. The engine must be cool.

gasoline is highly flammable and its vapors may ignite, re-sulting in fire or explosion. Be sure to keep all sparks and flames away from the area while inspecting the boat’s fuel system.

Step 2: Visually check as much of the fuel system from the tank to the engine(s) as you can see. If the odor of gasoline is strong or if you see visual evidence of fuel outside the system, cease all operations and take the boat im-mediately to an authorized Hydra-Sports dealer’s service department to determine the source of the leak. The leak must be repaired before the engine is restarted.

This is important! Fuel leakage can lead to a build-up of po-tentially explosive fumes within the bilge engine compartment. DO NOT IGNORE OR OVERLOOK THIS INSPECTION AND RE-PAIR AS NECESSARY!


Check that the Battery is Fully Charged As the boat is started, check all gauges, but pay particular attention to the voltmeter. While starting the engine(s), check that the voltmeter reads be-tween 12.4 and 14.5 volts. An erratic reading may be a sign of low voltage. The voltmeter is the best indication of the state of your battery. However, it is not fool-proof. While the reading may indi-cate that the battery is producing current, if during a previous opera-tion you had reason to suspect a problem with your battery, check with an authorized Hydra-Sports dealer’s service department. Charge dead batteries with a battery charger before attempt-ing to start the engine. (Some Hydra-Sports models offer an op-tional battery charger; but never jump-start the battery.) Jump-start-ing from another boat or battery is dangerous!

When charging, batteries generate small amounts of dan-gerous hydrogen gas. this gas is highly explosive. Keep all sparks, flames and smoking well away from the area. Failure to follow instructions when charging a battery may cause an electrical charge or even an explosion of the battery, which could cause death or serious injury.

Crossing cables or jumper cables may result in damage to the electrical components due to incorrect battery connections. Such damages may not be covered by your warranty.

inspect the Fuel System for Leaks (repeat) This function should be performed after about three (3)-to-five (5) minutes of running the engine(s) to determine whether any leaks are apparent.

After three (3) -to-five (5) minutes of operation, shut down the engine and ensure that the engine safety starting switch is discon-nected. Be certain that the throttle/shift control lever is in neutral. Again, inspect the fuel system as well as possible. If the odor of gasoline is strong or if you see visual evidence of fuel outside the system, cease all operations and take the boat immediately to an authorized Hydra-Sports dealer’s service department to deter-mine the source of the leak. The leak must be repaired before the engine(s) is restarted.

This is important! Fuel leakage can lead to a build-up of poten-tially explosive fumes within the bilge compartment. DO NOT IGNORE OR OVERLOOK THIS INSPECTION AND REPAIR AS NECESSARY!

B E F O R E E A C H U S E( a F t e r S t a r t i n g t h e e n g i n e )

4 4 4

2011 Hydra-Sports Owners Manual • After Each Use • Page 16-1

general Cleaning and StorageRefertotheCorrosion Prevention and Cleaning the Boat sections of this Owner’s Manual. After each out-ing, the boat should receive a general cleaning and drying prior to being stored. Even if the boat is kept in a slip, owners/operators should wipe down the interior and should periodically remove the boat from the water forageneralcleaning.

inspections As noted in the Before Each Usesection,somefunc-tions there need to be performed following use of the boat, such as checking the intake strainer or seacock strainer if evidence has shown that debris collects dur-ing the outing. Wet debris is often easier to remove.

A F T E R E A C H U S E4 4 4

2011 Hydra-Sports Owners Manual • Annual Maintenance • Page 17-1

Some boat owners choose to personally execute some mainte-nance procedures on their boats. Hydra-Sports has provided infor-mation on several procedures. For safety reasons, a few must be performed by authorized Hydra-Sports service technicians only. These matters must be addressed on a regular basis, at one hun-dred (100) hours or annually, whichever comes first, and these procedures are in addition to seasonal preparation and winteriza-tion (see Storage and Winterization section for additional details). All of these issues are extremely important to continued boating pleasure, as well as long life for the boat, and the critical matter of safety. Hydra-Sports recommends that your annual—or one hundred (100) hour—maintenance requirements be performed by an au-thorized Hydra-Sports dealer. The staff there has the proper equip-ment and technical training to best meet your service needs.

Fire extinguisher(s) Hydra-Sports recommends that boat owners include a check of the extinguish-er units during the annual maintenance to be sure that they are always ready for use. Some units may not require annual checks; refer to the signage and label-ing on the individual units for further guid-ance.

A N N U A L M A I N T E N A N C E4 4 4

STO R AG E & W I N T E R IZ AT I O N4 4 4

Storage or winter lay-up requires special preparation to prevent damage to the boat. Since winter storage is an annual event, it presents an excellent opportunity to perform the annual mainte-nance at this time, depending upon the amount of usage. Check with an authorized Hydra-Sports dealer’s service department re-garding the boat’s needs to determine if this is the appropriate time for annual service. It is also critical to review and follow the instructions for the engine’s proper storage as described in the engine owner’s manual. Without proper preparation, storage for long periods of time (at any time of the year) may cause harm to various components of the boat. Also, if the boat has been stored in below-freezing temperatures with water inside the bilge or engine cooling system (including the shower, wash down tanks, coolers, or any con-tainer or area in which water has been located), this condition may result in major damage from freezing, which would not be covered under the warranty. Refer to the engine owner’s manual for guidance regarding storage and winterization of the engine.

The following procedures will help avoid most potential types of damage during storage for a period not to exceed five (5) months!

Because of the complexity of preparing a boat for proper winter storage, as well as the possibility of extreme damage to the drive train if a preparation error was made during winterization, hy-dra-Sports recommends scheduling an appointment with an au-thorized hydra-Sports dealer’s service department to permit a technician to perform all winterization procedures.

Fuel System treatment Follow the instructions for fuel system treatments as described in the engine owner’s manual. Most manufacturers have specific requirements regarding storage of a boat with fuel still in the fuel tank. If these directions are not followed as directed, the result may be major damage to the engine upon re-commission, and such damage may not be covered under the engine warranty.

general Power Package PreparationStep 1: Lubricate the throttle and shift linkages and cables with

multi-purpose grease.Step 2: Hydra-Sports recommends that batteries be removed

from the boat for winter storage. Batteries should be fully charged before being stored in a cool, dry location, protected from the elements and fully re-charged before being re-installed in the boat. Never store batteries close to heat, spark or flame-producing devices.

other Winterization PreparationsStep 1: Remove the bilge drain plug immediately after taking the

boat out of the water. After a general bow-to-stern wash-ing, raise the bow of the boat higher than the stern to allow as much water as possible to drain from the bilge, whileperformingotherstoragepreparations.

Step 2: Thoroughly clean the hull, deck and interior of the boat as soon as it is removed from the water. Cleaning at this time is easier because any marine growth is still wet. Be sure to allow a few days of air drying to prevent mildew that results from trapped moisture. (See the Cleaning sec-tion of this Manual.)

Step 3: Apply a coat of wax to the entire surface of the boat. We suggest MasterCraft Premium Marine Wax for ex-cellentcoverage.

2011 Hydra-Sports Owners Manual • Storage & Winterization • Page 18-1

Step 4: If the boat is equipped with a shower or any fresh water holding tanks, be sure to disconnect the hoses and drain any remaining water in the lines to avoid freezing. Even small amounts of water in any of these areas can cause significant damage upon freezing and such damage is not covered under the warranty!

Step 5: Cover the boat with a boat cover or tarp.

Note: If the boat is to be stored outside and subject to accu-mulations of snow, water and ice, a support should be made for the boat cover so that it will not sag, rip or tear, thereby allowing water to enter the boat. Two-inch diameter PVC plumbing pipe is ideal for this purpose. It is readily available at local hardware stores, and it is easy to work with. Also, its rounded shape will prevent damage to the canvas.

re-activating the Boat after StorageStep 1: Fully charge the battery and install it in the boat, fol-

lowing all safety precautions associated with changing batteries.

IMPORTANT NOTE: Often, batteries that have been stored over winter will require re-charging. If the battery is charged by utilizing a battery charger, use only a three-stage or more battery charger. It is important that the operator never turn a battery char-ger immediately to “start,” as the sudden jolt of voltage may cause damage to the electrical system. Regardless of whether it is during the re-activation process or at any time, care should also be used in charging the battery.

Step 2: Follow all instructions for reactivating the drive train as detailed in the engine owner’s manual. NOTE: Hydra-Sports recommends having an authorized Hydra-Sports dealer perform this function.

Step 3: Ensure that all drain plugs throughout the boat and drive train have been reinstalled to avoid unwanted intrusion ofwater.

Step 4: If applicable, reconnect the hoses to your shower or fresh watertanks.

Step 5: Check the entire boat for fluid, oil and coolant levels. Add as necessary.

Step 6: Perform the daily maintenance as noted previously in this Owner’s Manual. If it was not done prior to storage, performtheannualmaintenanceaswell.

2011 Hydra-Sports Owners Manual • Storage & Winterization • Page 18-2

GUIDE TO TROUBLESHOOTING4 4 4

The following chart will assist you in finding and correcting minor mechanical and electrical problems with your Hydra-Sports boat. Engine manuals include troubleshooting suggestions regarding drive train issues. To correct a problem, first determine what the symptom is. Start with the first cause and eliminate the possibility of each until the prob-lem is corrected. Due to the specialized skill and tools needed to correct major issues, that information has not been discussed below. If a problem is not addressed herein, please contact an authorized Hydra-Sports dealer’s service department. When experiencing a problem, check the surroundings before shutting down the boat. If a sudden stop would place other boaters in jeopardy, continue on until it is safe to slow or stop to analyze the situation. Always be aware of the surroundings and how actions may impact other boaters!

Throttle/shifting problems. Corrodedcables. Cleanandlubricatethecables. Kinkincable(s). HaveauthorizedHydra-Sports technicianreplacethecable(s).

Steering problems. Hydraulicissues. SeeauthorizedHydra-Sports dealer’sservicedepartment. Excessive vibration. Fouledpropeller. Removeobjectsfromthe propellershaftandrudder.

Damagedpropeller. Replacethepropeller. Electrical problems. Opencircuitbreakerorblownfuse. Re-setthecircuitbreakeror replacethefuse.

Loosewiringconnectionsorcorrosion. Cleanandtightenwiring connections.

Defectivesendingunit. Replacethesendingunit.

Shortedwiringharness. Havethewiringharnessrepaired.

Defectiveswitchorgauge. SeeauthorizedHydra-Sports dealer’sservicedepartment. No speedometer reading. Defectivespeedometer. Havethespeedometercheckedorreplaced. Gauges do not work or the Breakerhastripped. Re-setthebreaker. accessory does not work. Fusehasblown. Replacethefuse.

Lowbattery. Checkthebatteryvoltageforalooseground.

Insufficientbatterysupply. Replacebatterywithonethat hasanincreasedcapacity.

2011 Hydra-Sports Owners Manual • Troubleshooting • Page 19-1

L I M I T E D WA R R A N T Y S TAT E M E N T

LIMITED WARRANTY STATEMENT4 4 4

2011 Hydra-Sports Owners Manual • Limited Warranty Statement • Page 20-2

1.DisclaimerandLimitationofImpliedWarranties. THE EXPRESS LIMITED WARRANTY SET FORTH HEREIN IS IN LIEU OF ALL OTHER WARRANTIES AND REPRESENTATIONS, EXPRESS OR IMPLIED, AND TO THE MAXIMUM EXTENT PER-MITTED BY APPLICABLE LAW, HYDRA-SPORTS DISCLAIMS, AND THE OWNER HEREBY EXPRESSLY WAIVES, ANY AND ALL OTHER WARRANTIES OR REPRESENTATIONS OF ANY KIND OR NATURE, INCLUDING, BUT NOT LIMITED TO, IM-PLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE, OTHER THAN THOSE WAR-RANTIES WHICH ARE IMPLIED BY, AND ARE INCAPABLE OF EXCLUSION, RESTRICTION OR MODIFICATION UNDER APPLICABLE LAW. THE TERM OF ANY IMPLIED WARRANTIES THAT CANNOT BE DISCLAIMED UNDER APPLICABLE LAW, INCLUDING, BUT NOT LIMITED TO, IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE, SHALL BE LIMITED TO THE DURATION OF THE EXPRESS WARRANTY PERIODS APPLICABLE TO THE RESPEC-TIVE COMPONENTS. SOME STATES DO NOT ALLOW THE EXCLUSION OF IMPLIED WARRANTIES AND/OR DO NOT ALLOW LIMITATIONS ON THE AMOUNT OF TIME AN IM-PLIED WARRANTY LASTS, SO THE ABOVE LIMITATIONS MAY NOT APPLY TO YOU. THIS LIMITED WARRANTY GIVES YOU SPECIFIC LEGAL RIGHTS. YOU MAY HAVE OTHER RIGHTS WHICH VARY FROM STATE TO STATE.

2.LimitedWarrantyandTerm. Hydra-Sports Boat Com-pany, LLC. Hydra-Sports, an MCBC Holdings, Inc., company. (“Hydra-Sports” “Hydra-Sports”) warrants to the original retail purchaser that the following components of each new boat shall be free from material defects in materials and workman-ship to the extent set forth below, under normal use and when operated and maintained in accordance with Hydra-Sports’ instructions, for the period indicated:

2.1.Deck,Hull,LinerandStringers. From the date of the original retail purchase, the deck, hull, liner and stringer system (collectively, “Structural Components”) is warranted for ten (10) years.

2.2.Gel Coat. On condition that the consumer has pro-vided maintenance and care as described in the Corro-sion and Cleaning the Boat sections of the Hydra-Sports Owner’s Manual, the gel coat, which is applied to all Hydra-Sports boats at the factory, will be warranted for a period of one (1) year from the date of the original retail purchase of the boat or the initial use of the boat, whichever first occurs, for stress crazing of the gel coat. However, no warranty is provided, and Hydra-Sports expressly disclaims any warranty for, scratching, discol-oration or fading of the gel coat because environmental operating conditions and customer maintenance/care are factors that have a significant effect on the condition and durability of the gel coat and are factors that are out-side of Hydra-Sports’ reasonable control. Hydra-Sports boats that remain in bodies of water, whether fresh or salt, must have the hull below the water line coated with anti-fouling paint to prevent blistering of the gel coat and the resin beneath.

2.3.OtherComponentParts(ExcludingEngine). Hydra-Sports provides the following warranty for other component parts of your Hydra-Sports boat: All other components not specifically referenced in Sections 2.1 through 2.3 hereof (excluding the engine), including in-strumentation, marine carpeting, upholstery vinyl mate-rial and upholstery stitching, are warranted for a period of one (1) year. All warranties are from the date of the original retail purchase of the boat or the initial use of the boat, whichever first occurs.

2.4WarrantyPeriod. All express warranties are for the applicable time periods set forth in this Section 2, unless a longer warranty period is required by applicable law, in which case such longer warranty period will apply.

3.Engine. The engines used in Hydra-Sports boats are supplied by a wide variety of outboard engine manufacturers. These cor-porations provide a separate warranty of specific length from the date of the original retail purchase of the boat or the initial use of the boat, whichever first occurs, for the engine. A state-ment of the power train warranty is provided separately to the original retail purchaser. Hydra-Sports provides no independent warranty with regard to the engine; however, the owner may contact an authorized Hydra-Sports dealer to obtain contact information for making claims or inquiries under the applicable engine manufacturer’s warranty.


4.WarrantyConditions,LimitationsandExclusions. Hydra-Sports boats are manufactured by trained craftsper-sons from high-quality materials and components. However, conditions outside of Hydra-Sports’ control require specific limitations on, and exclusions from, coverage under this Limited Warranty. The Limited Warranty on the Structural Components set forth in Section 2 of this Warranty does not cover or include any other components fastened or applied to the hull or deck. This Limited Warranty constitutes the final, complete and exclu-sive statement of warranty terms, and no other person or entity is authorized to make any other warranties or representations on behalf of Hydra-Sports. Furthermore, the Limited Warranty set forth in Section 2 (including all subsections) hereof does NOT cover any of the following:

(a) damage caused by misuse, negligence, accident; colli-sion or impact with any object;

(b) damage caused by any improper alteration or modification to the boat or any of its component parts or accessories;

(c) damage caused by the use of improper or contaminated fuel or fluids;

(d) damage caused by the use of customer-applied chemi-cals or accidental spills;

(e) damage caused by failure to maintain the boat in ac-cordance with the maintenance provisions in the Owner’s Manual or improper maintenance of the boat;

(f) damage caused by the failure to comply with any recall or request for repair;

(g) damage resulting from the use of the boat for any racing, speed, commercial competition or performance demonstration;

(h) damage resulting from use of the boat for rental, com-mercial or industrial purposes;

(i) damage to hardware and other components fastened or adhered to the hull, deck or liner;

(j) damage caused by fire, theft, freezing, vandalism, explo-sion, lightning, wind, hail storms, flooding or other natural disaster;

(k) damage to any component parts and accessories not manufactured by Hydra-Sports, including but not limited to, the engine, propeller, shift and throttle control levers and cables, pumps, blowers, windshields, canvas, uphol-stery, tower and accessories, instrumentation and steering systems; however, such items may be warranted by the individual manufacturer, and if possible, Hydra-Sports will

provide the owner with a copy of the manufacturer’s war-ranty:

(l) damage resulting from trailering or improper storage or carriage of the boat on a trailer;

(m) damage caused by improper support of the boat on da-vits, hoist system or boat lift of any kind;

(n) damage to paints, varnishes, gel coat surfaces and col-ors, chrome-plated or anodized finishes, floor and floor covers and any other surface coatings, as well as dam-age due to in-water storage without proper barrier coat and bottom paints (NOTE: Although Hydra-Sports uses the highest-grade gel coat materials, a condition may develop where the bottom of the boat may show signs of discoloration and/or blisters if the boat is left in the water for long periods of time; therefore, Hydra-Sports recom-mends a proper barrier coat and bottom paint should be used whenever it is anticipated that the boat will be left in the water for an extended period of time, which is defined as being in excess of 30 days);

(o) damage caused by dealer-installed options or accessories;(p) damage caused by consumer-installed options or accessories; and/or(q) all warranty coverage will expire after ninety (90) days

on boats used for commercial purposes.

5.LimitationofLiability.

5.1 LiabilityLimitation:ExclusionofConsequen-tial Damages. This Limited Warranty is forthe benefit of the owner and Hydra-Sports, and shall not create or evidence any rightinanythirdparty.THEREPAIRORREPLACE-MENTOFDEFECTIVECOMPONENTPARTSASPROVIDEDUNDERTHISLIMITEDWARRANTYISTHEEXCLUSIVEREMEDYOFTHECONSUM-ER.TOTHEMAXIMUMEXTENTPERMITTEDBYAPPLICABLE LAW, IN NO EVENT SHALL HY-DRA-SPORTS BE LIABLE FOR ANY INCIDEN-TAL, CONSEQUENTIAL, SPECIAL, INDIRECT,PUNITIVEOREXEMPLARYDAMAGESORLOSTPROFITSWHATSOEVERARISINGOUTOFTHEUSEORINABILITYTOUSETHEBOATORANYCOMPONENT PART THEREOF, OR FOR ANYBREACH OF THIS LIMITED WARRANTY OROTHERWISE, EVEN IF HYDRA-SPORTS HASBEENADVISEDOFTHEPOSSIBILITYOFSUCHDAMAGESORSUCHDAMAGESCOULDREA-SONABLYHAVEBEENFORESEENBYHYDRA-SPORTS. However, some states do not allow the exclusion or limitation of incidental orconsequentialdamages, so theabove limi-tationorexclusionmaynotapplytoyou.

5.2.Purchase Price Limitation. In any event, Hydra-Sports’ entire liability under any provision of this Limited Warranty shall be limited to the repair or replacement of the boat or component part, or the refund of the purchase price paid by the consumer for the boat or component part found to be defective within the applicable warranty period. This shall constitute Hydra-Sports’ sole liability and obligation in the event of any claim arising out of its performance or non-performance of any provision of this


Limited Warranty. Because some states and jurisdictions do not allow the exclusion or limitation of liability, the above limitations may not apply to you.

6.TransferofLimitedWarranty. Upon the first sale, con-veyance or other transfer of the boat by the original retail pur-chaser, any remaining unexpired Limited Warranty coverage shall be transferred to the second owner and shall remain in effect for the remainder of the applicable warranty period(s) set forth in Sections 2.1, 2.2, 2.3 and 2.4 hereof (which war-ranty periods begin to run from the date of the original retail purchase of the boat, or the first use of the boat, whichever first occurs, as applicable), upon delivery of the warranty transfer card and payment of the applicable warranty transfer fee to Hydra-Sports. With respect to the ten (10) year Limited War-ranty (granted only to the original retail purchaser) on the Struc-tural Components set forth in Section 2.1 hereof, if the sale, conveyance or other transfer of the boat by the original retail purchaser to another person or entity occurs within three (3) years of the date of the original retail purchase of the boat by the original retail purchaser, then the Limited Warranty on the Structural Components shall be transferred to the second owner and shall continue in effect for the remainder of the ten (10) year period. If the sale, transfer or conveyance of the boat by the original retail purchaser occurs more than three (3) years after the date of the original retail purchase of the boat, then the Limited Warranty on Structural Components (as well as all other warranties) shall be void as of the date of transfer and shall not be transferable to the second owner.

Only one (1) transfer under the provisions of this Section 6 (from the original retail purchaser to the second owner), within the applicable time period, may be made. In the event of a sale or transfer of the boat or trailer by a second owner to a subsequent purchaser, all coverage under this Limited War-ranty shall immediately be terminated and the Limited War-ranty shall become null and void. No transfer of this Limited Warranty will operate to extend the warranty periods set forth in Section 2 hereof. In order to effectuate the transfer of the Limited Warranty, the original retail purchaser and the new owner must properly fill out the warranty transfer card found in the back of the Owner’s Manual and deliver the completed card, together with a check made payable to “Hydra-Sports Boat Company.” in the amount of the warranty transfer fee, via U.S. Mail, postage prepaid, to Hydra-Sports at the ad-dress shown on the warranty transfer card. The card and check for the warranty transfer must be post-marked within the time period specified above in this Section 6 in order for the warranty transfer from the original retail purchaser to the sec-ond owner to be effective. Hydra-Sports reserves the right to reject or refuse to honor a warranty transfer for a Hydra-Sports boat that has been damaged, neglected, used in violation of the terms of the Limited Warranty set forth herein, or otherwise previously excluded from warranty coverage.

7.WarrantyClaims. In order to maintain warranty service under this Limited Warranty, the owner must return the defective boat or component part to an authorized Hydra-Sports dealer’s service department, or to Hydra-Sports’ factory at the below address, within the applicable warranty period. For questions regarding warranty service or to obtain information regarding

warranty service or to obtain information regarding the nearest authorized Hydra-Sports dealer, please contact Hydra-Sports at the following address or telephone number:

Hydra-Sports Boat Company Attention: Warranty/Customer Service Department 100 Cherokee Cove Drive Vonore, Tennessee 37885 1-423-884-2221

Subject to the terms of this Limited Warranty, any covered boat or component part with a material defect in materials or workmanship that is returned to an authorized Hydra-Sports dealer’s service department or Hydra-Sports’ factory during the appropriate warranty period will be repaired or replaced, at Hydra-Sports’ sole discretion, without charge to the owner for parts and labor. This provision is subject to the following terms and conditions:

(a) Hydra-Sports shall be obligated only to repair or replace those items that prove defective, in Hydra-Sports’ sole dis-cretion, upon examination by a Hydra-Sports authorized dealer service department or Hydra-Sports’ own personnel, as applicable;

(b) Hydra-Sports warrants its repairs or replacements only for the remainder of the applicable warranty period;

(c) Hydra-Sports shall, in its sole discretion, fulfill its obligation to repair or replace any defective item at its factory or au-thorized dealer’s service department;

(d) The owner shall be responsible for all costs associated with the transportation of the boat, towing bills, trailer or compo-nent part(s) to the authorized Hydra-Sports service depart-ment and for any return transportation.

8. No Modification of Warranty. No oral or written information, advice or communication of any nature to or from Hydra-Sports or its representatives, employees, dealers, agents, distributors or suppliers shall create a warranty or in any manner increase or modify the scope of this Limited Warranty in any man-ner whatsoever.


For the first purchase of a specific Hydra-Sports boat, the boat must be registered. You should be aware that under federal law, comple-tion of the registration process is a requirement and should be completed as follows: 1. Dealer must complete the warranty registration at date of sale. 2. Dealer must secure buyer’s signature! 3. Dealer must notify Hydra-Sports, via electronic registration that the boat has been purchased, and all required information must be submitted. As boat owner, you should ensure that the dealer has complied with this requirement. This is the method of providing information that will allow Hydra-Sports to notify you in case of any mandatory recalls or other issues requiring your attention. If the Hydra-Sports boat is subsequently sold by the original purchaser, Hydra-Sports offers a transferable warranty to the second owner. In accordance with the Hydra-Sports Limited Warranty, the remaining warranty against structural defects in the hull and deck will be trans-ferred to the new owner when the following has been accomplished and verified within fourteen (14) days of the sale date, provided that the transfer to the new owner occurs within three (3) years of the date of the original retail purchase of the boat: • Receipt of the completed form below. • Copy of the sales invoice. • Payment of $450. Upon verification, the remaining warranty will transfer, retroactive to the sale date. Forward form and payment to:

Hydra-Sports Boat Company, LLC100 Cherokee Cove Drive

Vonore TN 37885

WarrantyRegistrationTransfer (forward this copy to Hydra-Sports)

Boat Serial Number __________________________________________________________________________ Model No. _________________________________________________________________________________ Engine Make _______________________________________________________________________________ Serial No. _________________________________________________________________________________ Engine Make _______________________________________________________________________________ Serial No. _________________________________________________________________________________ Engine Make ________________________________________________________________________________ Serial No. __________________________________________________________________________________ Engine Make ________________________________________________________________________________ Serial No. __________________________________________________________________________________

Please Print Previous Owner _____________________________________________________________________________ New Owner’s Name ________________________________________________________________________ Street Address ______________________________________________________________________________ City _______________________________________________________________________________________ State ___________________________________________ Zip Code ________________________________ Home Phone (___________) __________________________________________________________________ Business Phone (__________) __________________________________________________________________ Date of Purchase ____________________________________________________________________________ Second Owner’s Signature ____________________________________________________________________ MUST BE SIGNED! Be sure to enclose payment and a copy of the purchase receipt within fourteen (14) days of the sale date.

WARRANTY REGISTRATION & TRANSFER

4 4 4

S E R V I C E L O G4 4 4

Function Date Date Date Date

Inspect seacock strainer

Inspect battery connections & hold-downs

Inspect throttle & shift cables for wear

Inspect fuel system for leaks

As required Date Date Date Date

General cleaning

Annual maintenance performed

Check all safety equipment

Storage & Winterization Date Date Date Date

Fuel system treatment

General power package preparation

Other winterization preparation

Re-activating the boat

2011 Hydra-Sports Owners Manual • Service Log • Page 21-1

I N D E x4 4 4

12/24 Volt Trolling Motor System ..........................7-1120-Volt AC Electrical System ................................7-312-Volt DC Boat System .........................................7-112-Volt Receptacle .................................................6-1180CC ...................................................................5-4202DC ...................................................................5-62100CC .................................................................5-72100WA ................................................................5-52300CC .................................................................5-92300DC .................................................................5-82300VX ............................................................... 5-1024-Volt Trolling Motor System ...............................7-12500CC ............................................................... 5-112500VX ............................................................... 5-123000CC ............................................................... 5-133000VX ............................................................... 5-143400CC ............................................................... 5-163600VX ............................................................... 5-174200VSF .............................................................. 5-19

AAC/DC Battery Charger ........................................7-2Accessibility, PFD ..................................................1-3Accessory Switches ................................................6-1Accident Reports ...................................................1-9After Break-In ...................................................... 11-1After Each Use .................................................... 16-1Air Conditioning System ........................................8-1AM/FM Stereo .....................................................6-1Anchor Lights Switch, Navigation ..........................6-3Anchoring .............................................................1-8Annual Maintenance ............................................ 17-1

BBasic Maneuvering ............................................... 11-3Basic Measurements............................................. 5-22Battery Charger, AC/DC .......................................7-2Battery Charging ....................................................7-2Battery Connections and Hold-Downs, Inspect ..... 15-1Battery Fully Charged, Check ............................... 15-3Battery Switch .......................................................7-2Battery/Batteries ....................................................7-1Bay Bolt 19 ............................................................5-2Bay Bolt 23 ............................................................5-3Before Each Use (After Starting the Engine) ......... 15-3Before Each Use (Prior to Starting the Engine) ...... 15-1Before Starting ..................................................... 11-1

Bilge Pump Switch .................................................6-1Bilge Pump ............................................................8-1Bilge ......................................................................8-1Binnacle, Shift/Throttle Control .............................6-3Boating Safety ........................................................1-2Boating Terminology..............................................4-1Bow Thruster Control ............................................6-1Box, Fish ...............................................................8-2Breakers, Circuit ....................................................6-2Buoys and Other Markings, Reading ......................3-2

CCabin Finishes, Interior ........................................ 14-2Care and Maintenance ......................................... 12-1Carpet (Cleaning) ................................................ 14-1Cautions, Dangers, Warnings & ................................iiCavitation ..............................................................8-3CD Player ..............................................................6-1Charging, Battery ...................................................7-2Charts, Nautical .....................................................1-6Chrome, Stainless Steel and .................................. 13-1Circuit Breakers .....................................................6-2Cleaning and Maintenance, General ..................... 14-3Cleaning and Storage, General ............................. 16-1Cleaning the Boat ................................................ 14-1Cold Water Survival ...............................................1-7Common Sense Approach ......................................2-1Communications ...................................................1-8Compass ................................................................6-2Connections and Hold-Downs, Inspect Battery ..... 15-1Control, Bow Thruster ...........................................6-1Control, Shift/Throttle (Binnacle) ..........................6-3Control, Washer Wiper ..........................................6-5Corrosion Prevention ........................................... 13-1Corrosion, Galvanic ............................................. 13-1Corrosion, Salt Water ........................................... 13-1Courtesy Lights Switch(es) .....................................6-2Courtesy .............................................................. 11-2Cradle, Storage .................................................... 12-2Crossing ................................................................3-1

DDangers, Warnings & Cautions .................................iiDistress Signals, Visual ...........................................1-4Docked, Remaining ............................................. 11-4Docking and Tie-Up ............................................ 11-3Documentation, Registration, Numbering and ........1-4

2011 Hydra-Sports Owners Manual • Index • Page 22-1

DVD Connection ...................................................6-1

EElectrical System, The ............................................7-1Emergencies ........................................................ 11-2Emergency Safety Stop Switch, Engine ...................6-2Enclosed Head (Cleaning) .................................... 14-2Encountering Vessel, Rules When ..........................3-1Engine Alarm System/Warning Lights ...................6-2Engine Emergency Safety Stop Switch ....................6-2Engine Synchronizing Switch .................................6-2Engine Temperature Gauge ....................................6-3Engines .................................................................8-2Equipment, Recommended ....................................1-4Equipment, Required .............................................1-3Equipment, Safety ..................................................1-3Extinguishers, Fire .................................................1-3Eyes, Using Lifting ............................................... 12-2

FFilling Fresh Water Tank ........................................8-2Fire Extinguisher(s) .............................................. 17-1Fire Extinguishers ..................................................1-3First Hours of Operation ...................................... 11-1First Time Operation ........................................... 11-3Fish Box ................................................................8-2Fishing Vessel Right-of-Way ...................................3-2Float Plan ..............................................................1-6Flotation Devices, Personal (PFD) ..........................1-3Fresh Water Pump .................................................8-3Fresh Water System ...............................................8-2Fuel Gauge ............................................................6-3Fuel System for Leaks, Inspect .....................15-2, 15-3Fuel System Treatment ........................................ 18-1Fuel System ...........................................................9-1Fuel Tank ..............................................................9-1Fueling, Using Care When .....................................9-1

GGalvanic Corrosion .............................................. 13-1Gas Deck Fill .........................................................9-1Gas Tank Vent .......................................................9-1Gauge, Engine Temperature ...................................6-3Gauge, Fuel ...........................................................6-3Gauge, Power Trim ................................................6-3Gauge, Water Pressure ...........................................6-5Gauges & Switches, Instrument ..............................6-1Gears, Shifting ..................................................... 11-2General Cleaning and Maintenance ...................... 14-3General Cleaning and Storage .............................. 16-1General Power Package Preparation ..................... 18-1General Precautions ...............................................1-2General Prudential Rule, The .................................3-2Guide to Individual Models ....................................5-1

Guide to Troubleshooting .................................... 19-1

HHard Top (Cleaning) ............................................ 14-2Head, Enclosed (Cleaning) ................................... 14-2High Speed Operation .......................................... 11-3Hints, Operational ............................................... 11-2Hold-Downs, Inspect Battery Connections and ..... 15-1Holding Tanks .......................................................8-4Horn .....................................................................6-3Hull (Cleaning) .................................................... 14-1Hypothermia .........................................................1-7

IIgnition Key Slot ....................................................6-3Immersion Suits .....................................................1-7Individual Models, Guide to ...................................5-1Inflatable Life Rafts ...............................................1-8Inspections .......................................................... 16-1Instrument Gauges & Switches ...............................6-1Insurance ...............................................................1-4Interior Cabin Finishes ......................................... 14-2iPod .......................................................................6-1

KKey Slot, Ignition ...................................................6-3

LLabels, Warning Plates and ....................................1-6Law Enforcement ..................................................1-8License, Operator’s ................................................1-4Life Rafts, Inflatable ...............................................1-8Lifting Eyes, Using ............................................... 12-2Lifting Slings, Using ............................................. 12-2Lifting the Boat .................................................... 12-2Lights Switch(es), Courtesy ....................................6-2Lights Switch, Navigation/Anchor ........................6-3Lights Switch, Underwater .....................................6-4Limited Warranty Statement ................................ 20-1Livewell System .....................................................8-3Locations, More................................................... 5-20

MMaintenance, Care and ........................................ 12-1Maintenance, General Cleaning and ..................... 14-3Maneuvering, Basic .............................................. 11-3Marine Growth .................................................... 13-1Marine Sanitation Device .......................................8-4Markings, Reading Buoys and Other ......................3-2Marpol Treaty ........................................................1-9Measurements, Basic ............................................ 5-22Meeting .................................................................3-1

2011 Hydra-Sports Owners Manual •Index • Page 22-2

Models, Guide to Individual ...................................5-1More Locations ................................................... 5-20

NNautical Charts ......................................................1-6Navigation/Anchor Lights Switch ..........................6-3New Boat Break-In .............................................. 11-1Numbering and Documentation, Registration .........1-4

OOpen Water, Rules of .............................................3-1Operational Hints ................................................ 11-2Operator’s License .................................................1-4Operator’s Responsibilities .....................................1-6Other Special Situations .........................................3-2Overload Protection ...............................................7-2Overtaking .............................................................3-2

PPersonal Flotation Devices (PFD) ..........................1-3PFD Accessibility ..................................................1-3Plan, Float .............................................................1-6Plates and Labels, Warning ....................................1-6Portable Toilet .......................................................8-4Power Package Preparation, General .................... 18-1Power Switch .........................................................6-3Power Trim Gauge .................................................6-3Precautions, General ..............................................1-2Prevention, Corrosion .......................................... 13-1Propeller ................................................................8-3Protection, Overload ..............................................7-2Pump Switch, Bilge ................................................6-1Pump, Bilge ...........................................................8-1

RRadio, VHF ...........................................................6-4Rafts, Inflatable Life ...............................................1-8Re-Activating the Boat After Storage .................... 18-2Reading Buoys and Other Markings .......................3-2Receptacle, 12-Volt .................................................6-1Recommended Equipment .....................................1-4Refrigerator............................................................8-3Registration & Transfer, Warranty ........................ 20-5Registration, Numbering and Documentation .........1-4Remaining Docked .............................................. 11-4Remote Control .....................................................6-1Reports, Accident ..................................................1-9Required Equipment ..............................................1-3Responsibilities, Operator’s ....................................1-6Right-of-Way, Fishing Vessel ..................................3-2Right-of-Way, Sailing Vessel ...................................3-2Rule, The General Prudential .................................3-2Rules of the Open Water ........................................3-1

Rules When Encountering Vessels ..........................3-1

SSafety Afloat ..........................................................1-4Safety Checks & Services ..................................... 10-1Safety Equipment ...................................................1-3Safety Knowledge ..................................................1-1Safety Stop Switch, Engine Emergency ...................6-2Safety, Boating .......................................................1-2Safety, Skiing and Wakeboarding ............................1-5Sailing Vessel Right-of-Way ....................................3-2Salt Water Corrosion ............................................ 13-1Sanitizing Fresh Water System ...............................8-2Seacock Strainer, Inspect ...................................... 15-1Seacocks ................................................................8-4Shift/Throttle Control (Binnacle) ...........................6-3Shifting Gears ...................................................... 11-2Shore Power ..........................................................7-3Shower ..................................................................6-4Skiing and Wakeboarding Safety ............................1-5Slings, Using Lifting ............................................. 12-2Slot, Ignition Key ...................................................6-3Sound Producing Devices.......................................1-3Special Situations, Other ........................................3-2Speedometer ..........................................................6-4Stainless Steel and Chrome .................................. 13-1Starting and Basic Operation ................................ 11-1Starting Fresh Water System ..................................8-2Starting the Engine .............................................. 11-1Staying Afloat ........................................................1-7Steering and Sailing Rules/Sound Signals ...............3-1Steering System .....................................................8-4Stereo, AM/FM.....................................................6-1Stopping .............................................................. 11-2Storage & Winterization ....................................... 18-1Storage Cradle ..................................................... 12-2Stove .....................................................................8-4Strainer, Inspect Seacock ...................................... 15-1Suits, Immersion ....................................................1-7Survival, Cold Water ..............................................1-7Switch(es), Courtesy Lights ....................................6-2Switch, Battery ......................................................7-2Switch, Bilge Pump ................................................6-1Switch, Engine Emergency Safety Stop ...................6-2Switch, Engine Synchronizing ................................6-2Switch, Navigation/Anchor Lights .........................6-3Switch, Power ........................................................6-3Switch, Trim Tab ...................................................6-4Switch, Underwater Lights .....................................6-4Switch, Wash Down ..............................................6-5Switches, Accessory ...............................................6-1Switches, Instrument Gauges & ..............................6-1Synchronizing Switch, Engine ................................6-2Systems, Comfort & Convenience ...........................8-1


TTable of Contents .....................................................vTachometer............................................................6-4Temperature Gauge, Engine ...................................6-3Terminology, Boating .............................................4-1Throttle and Shift Cables, Inspect ......................... 15-2Throttle Control (Binnacle) Shift ............................6-3Tie-Up, Docking and............................................ 11-3Toilet .....................................................................8-4Transfer, Warranty Registration & ........................ 20-5Treaty, Marpol .......................................................1-9Trim Tab Switch ....................................................6-4Trolling Motor .......................................................7-2TV .........................................................................6-1

UUnderwater Lights Switch ......................................6-4Underway ............................................................ 11-2Unusual Operating Conditions ............................. 11-3Upholstery (Cleaning) .......................................... 14-1Using Care When Fueling ......................................9-1Using Lifting Eyes ............................................... 12-2Using Lifting Slings .............................................. 12-2

VValves (Gas System) ...............................................9-1Ventilation .............................................................8-3VHF Radio ............................................................6-4Visual Distress Signals............................................1-4Voltmeter ...............................................................6-5

WWakeboarding Safety, Skiing and ............................1-5Warning Lights, Engine Alarm System ...................6-2Warning Plates and Labels .....................................1-6Warnings & Cautions, Dangers .................................iiWarranty Registration & Transfer ......................... 20-5Warranty Statement ............................................. 20-1Wash Down Switch ...............................................6-5Washdown, Raw Water Cockpit .............................8-5Washer/Wiper Control ..........................................6-5Water Heater .........................................................8-5Water Pressure Gauge ............................................6-5Weather .................................................................1-7Welcome Aboard .......................................................iWindlass Up/Down ...............................................6-5Windshield (Cleaning) ......................................... 14-1Winterization Preparations, Other ........................ 18-1Winterization, Storage & ...................................... 18-1Wiper Control, Washer ..........................................6-5


Documents

2011 Hydra-Sports Owner's Manual (1)