88

Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

  • Upload
    others

  • View
    7

  • Download
    0

Embed Size (px)

Citation preview

Page 1: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves
Page 2: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

2 www.LifesourceVitamins.com I 1-800-567-8122

28 Years and counting…

At LifeSource Vitamins we are passionate about living healthier lives and funding organizations that spread the love and hope only Jesus Christ can offer. Our core beliefs have never changed. We believe in commitment to health, giving back, and most importantly honoring God. By committing ourselves to a greater cause, we’ve been able to be a part of Christian outreach throughout the world while also providing customers with superior, whole food-based multivitamins and nutritional supplements.

In 1992, we started with one product, today we carry over 450. God has blessed this company more than we could have ever imagined. We work with a team of doctors, pharmacists and nutritionists to create high-quality, natural supplements designed to work together at the cellular level.

To control costs, we advertise minimally. Most of our customers come to us by word of mouth, and some have been with us from the very beginning when we only sold one product, our LifeSource Vitamins Multi-Vitamin & Mineral Tablets. The greatest compliment we get from our customers is, “This is the only vitamin where I notice a difference when I take it and an even bigger difference when I forget to take it.”

We invite you to join us and make LifeSource Vitamins your natural health source. When you buy from LifeSource Vitamins, our profits are donated to Christ centered organizations like these below:

• CampusCrusadeforChrist(CRU) • TheJesusFilmProject • Samaritan’sPurse • CompassionInternational • TheTimTebowFoundation

Give us a try. We offer great customer service and products that can help improve your life as well as others.

Vitamins & Supplements for a cause!

Bruce Brightman, Founder

Page 3: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

3www.LifesourceVitamins.com I 1-800-567-8122

5-HTP 60 Veg Caps - $19.99

•Enhancessleep•Relievessymptomsofseasonalaffectivedisorder•Relievesanxiety•Cognitiveenhancement

SUPPLEMENT FACTS

Serving Size: 1 Veg Capsule Servings per Container: 60

Amt/Serving DV%5-HTP(5-hydroxytryptophan)(Griffonia) 100mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: RiceFlourandCellulose(capsule) Not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients.

7-Keto / DHEA 90 Veg Caps - $19.99

•Weightmanagement•DHEAmetabolite•SafelypromotesThermogenesis•Abetter,saferformofDHEA•Vegetarianformula

SUPPLEMENT FACTS

ServingSize:3VegCaps ServingsPerContainer:30 Amt/Serving DV%*7-KETO®(DHEAAcetate7-one) 75mg †

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenot established.

Other Ingredients:RiceFlour,VegetablePolysaccharide(capsule)andMagnesiumStearate(vegetablesource).

Contains no: sugar, salt, yeast, wheat, gluten, soy, milk, egg, shellfish or preservatives. Vegetarian Formula.

Warning:Pleasekeepoutofthereachofchildren.

Acai Plus 32 oz / 32 Day Supply - $19.99

OurAcaiPluscontainsonlythefinestqualityingredients.TheAcaiPalmTreesblossominthelushrainforeststhatare fed by the mighty Amazon River. The synergy of thenutrient rich soil and tropical climate guarantee nearlyperfect conditions for these plants to thrive. The dark purple berriesoftheAcaiplant(EuterpeOleracea)containupto33timestheantioxidantcontentasredwinegrapes.Theseamazingberries have traditionally been used to increase energy, stamina, vitality, and to promote overall healthy living. The amazing acai fruit is considered nature’s perfect food. Some commonly reported benefits of Acai Juice include the following:

•Greaterenergy/stamina•Improveddigestion•Improvedmentalfocus•Bettersleep•Allnutrientscomefromoneberry•Acaihasmoreproteinsthenan

average egg

•Alsocontainsblueberry,raspberry, andpomegranatejuice.

•Acaihasessentialmineralssuchas iron,potassium, phosphorus and calcium.

•AcaihasallnaturalVitaminB1,B2, B3, C & E

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished.

INGREDIENTS:ReconstitutedAcaijuicefromwholeEuterpeOleraceafruit,Tripled Filtered Water,Blueberryjuiceconcentrate,Raspberryjuiceconcentrate,Pomegranatejuiceconcentrate, Citric Acid, Natural Flavor.

Acetyl-L-Carnitine 100 Veg Caps - $29.99

Common uses for supplemental Acetyl-L Carnitine:•Toenhancecognition.•Supportsthemetabolismoffoodintoenergy.•Maybeeffectiveinthetreatmentofdementia.•Reduceseverityofdepressivesymptomsintheelderly.

SUPPLEMENT FACTSServing Size: 2 Veg Capsule Servings per Container: 50 Amt/Serving DV%*Acetyl-L-Carnitine(fromAcetyl-L-CarnitineHCI) 1000mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValue not establishedOther Ingredients:Cellulose(capsule),MagnesiumStearate(vegetablesource)andStearicAcid(vegetablesource)Not manufactured with yeast, wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients.

Acid Reducer withEnzymes 60 Chewables - $16.99

Our Acid Reducer with Enzymes has a soothing influence on the smoothmuscle,esophagealmucosa(mucusmembranes)andbloodvesselsofthegastrointestinalsystem(GI)bybufferingthe hydrochloric acid secretions that cause the irritation experiencedbythosewithGERDoracidreflux.LifeSource’sAcidReducerwithEnzymesdoesnottreatGERDoracidrefluxdisease, but does relieve the symptoms.

•Heartburn•AcidReducing•SourStomach•Indigestion•GERD-AcidReflux

SUPPLEMENT FACTS

Serving Size: 2 Chewable Tablets Servings per Container: 30

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Amt/Serving DV%*Calories <5Total Carbohydrate 1 g < 1%Sugars 0 gXylitol 1g†Calcium(fromCalciumCarbonate) 560mg 56%Enzyme Blend 204 mgAmylase(fromAspergillusoryzae) 7,000DUProtease(fromAspergillusoryzae)42,000HUTProtease(fromAspergillusoryzae) 8,000PCProtease

Amt/Serving DV%*

(fromBacillussubtilis) 1,500PCProtease(fromAspergillusniger) 100SAPUGlucoamylase(fromAspergillusniger) 10AGUInvertase(fromSaccharomycescerevisiae) 800SUDiastase(fromAspergillusoryzae)3,000DPLipase(fromCandidarugosa,AspergillusnigerandRhizopusoryzae) 1,000FIP

Other Ingredients: NaturalFlavors,Cellulose,Maltodextrin,CitricAcid,MagnesiumStearate(vegetablesource)andBeetPowder

7-Keto Fitness 60 Veg Capsules - $39.99

7-Keto is an improved non-androgenic form of DHEA.7-KetoFitnessisamorepotentformofDHEA(dehydroepiandrosterone)thatmayimproveleanbodymass and enhance thermogenesis.

•7-KetoFitnessshowninclinicalresearchstudiestobesafeand effective for weight and fat loss.

•ContainsstandardizedgreenteaextractrichinEGCG.•ChromeMate®brandChromiumPolynicotinateforits

synergistic support

SUPPLEMENT FACTS

Serving Size: 1 Vegetarian Capsule Servings per Container: 60

Amt/Serving DV%*Chromium(aspolynicotinate) 100mcg 286%7-Keto®(3-acetyl-7-oxo-dehydroepiandrosterone) 100mg †GreenTeaLeafExtract(Camelliasinensis)(Standardizedto50%[50mg] Epigallocatechingallate) 100mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients:Vegetariancapsule(cellulose,water),riceflour,cellulose,vegetablestearin, magnesium stearate and silica Contains no sugar, dairy, wheat, gluten, corn, soy, preservatives, artificial colors or flavors.

NEW

Page 4: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

4 www.LifesourceVitamins.com I 1-800-567-8122

Allergy Support 90 Tablets - $32.99

This is the ideal product for seasonal airborne allergens. Containing MSM for glutathione production, as well as a proprietaryblendofbotanicalextractsandberries,thisproduct supports normal respiratory function during allergy season and year round.•Reduceand/orpreventsymptomsofseasonalallergies

and hay fever•NosideeffectsoftraditionalAntihistamines•Improveresistancetoallergens•Supportahealthyimmunesystem

SUPPLEMENT FACTS

Serving Size: 3 Tablets Servings per Container: 30

Amt/Serving DV%*VitaminC(asascorbicacid) 100mg 167%ProprietaryHerbalBlend(fromAller-7™)Phyllanthusemblica,Terminaliachebula,Terminaliabellerica,Albizialebbeck,Zingiberofficinale,Piperlongum,andPipernigrum 660mg †Quercetin 500mg †MSM(fromOptiMSM™) 1,300mg †Stingingnettles(Urticadioica)freeze-driedleaf(standardizedtocontain1%[2mg]silicicacid) 200mg †Bromelain(2400GDUs/g)(pineapple[Ananascomosusstem]enzyme) 25mg †ProprietaryBerryBlend(fromOptiBerry™)Wild blueberry, strawberry, cranberry, wild bilberry, elderberryandraspberry 25mg †Feverfew(Tanacetumparthenium)leaf 25mg †Turmeric(Curcumalonga)rhizome 50mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Cellulose, stearic acid, cellulose gum, dicalcium phosphate, silica, magnesium stearate and pharmaceutical glaze. Contains No sugar, salt, dairy, yeast, wheat, corn, soy, preservatives, artificial colors or flavors. Ginger(Zingiberofficinale)rhizome35mg†

Antibiotics, first used in the 1940’s, are certainly one of the great advances in modern medicine. While antibiotics are appropriate and effective cures, they are also outrageously over-prescribed. Many types of bacteria have become antibiotic- resistant due to over-prescription. Antibiotic are only effective against bacteria, they are useless against viruses, fungi, worms and parasites. Over use of antibiotics can depress your immune system, stimulate allergies and damage your kidneys and liver.

LifeSource’s All Natural Antibiotic can assist in the treatment of: dental infections, eye infections, ear infections, intestinal infections,pneumonia,sinusinfections,athlete’sfoot,candida/yeastinfectionsandmanymore.Ina2008study,antibioticsideeffects led to greater than 140,000 emergency room admissions per year in the United States. Roughly 50 percent of emergency visits were due to reactions to antibiotics in the penicillin class of drugs, and the other 50 percent were due to a wide variety of antibiotics used to treat many different types of infections.

•Strengthensimmunesystem.•Fightoffinfectionsbeforetheytakehold.•Eliminatetoughinfectionsaftertheyhavealreadysetin.•Safeandeffective-whilebeingmildonthesystem.•Non-toxic,non-caustic,non-allergenic.•Noriskyside-effects.•Nonegativeinteractionswithothermedications.

SUPPLEMENT FACTSServing Size:2Capsules ServingsPerContainer:45 

Amt/Serving DV%*Echinaceaextract 300mg †Garlicextract(odorless) 200mg †BurdockRootpowder 150mg †RedCloverBlossomspowder 100mg †Turmericextract 100mg †Molkosan 100mg †GanodermMycelium 100mg †Oliveleafextract 75mg †

Amt/Serving DV%*Barberry 50mg †AstragalusRoot 50mg †Grapefruitseedoilextract 50mg †NeemOil 50mg †PauD’Arco 40mg †GoldenSealpowder 25mg †CaprylicAcid 20mg †

All Natural Antibiotic90 Capsules - $19.99

180 Capsules - $34.99(SAVE $5)

Aloe Vera Gels 100 Softgels - $12.99

Aloe Vera offers a variety of nutrients, including vitamins, minerals, enzymes and amino acids. Aloe Vera’s constituent mucopolysaccharides are thought to be its active components. Scientific studies have indicated that Aloe can help to support the body’s own healing processes. In addition, Aloe Vera has been shown to support a healthy digestive system.

SUPPLEMENT FACTSServing Size: 2 Softgels Servings per Container: 50 Amt/Serving DV%*Calories 5Calories from Fat 5Total Fat 0.5 <1%Trans Fat 0 0%AloeVeraExtract(Aloebarbadensis)(InnerLeaf)(200:1Concentrate)(Equivalentto20,000mgofpureAloeVeraGel) 100mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:OrganicExtraVirginOliveOil,SoftgelCapsule(bovinegelatin,water,glycerin)andSilicaNot manufactured with yeast, wheat, gluten, soy, corn, milk, egg, fish or shellfish ingredients, NON-GMO

Alfalfa 250 Tablets - $8.99

Alfalfa supplements are a natural source of protein,enzymes, vitamins, amino acids and minerals. Nutritionalsupport for the digestive, skeletal, glandular andurinary systems.

SUPPLEMENT FACTS

ServingSize:1Tablet ServingsPerContainer:250 Amt/Serving DV%*Alfalfa(8.5Grains) 550mg †

*Dailyvaluebasedona2,000caloriediet.†Dailyvalue no established.

Adrenal Rx 90 Veg Caps - $21.99

•IncreaseResistancetoPhysical,Mental,andEnvironmentalStress

•DefendagainstDiseasesandDisordersCausedbyStress•AllowstheBodytoRespondtoStress•PreventAdrenalOverstimulation•NormalizeStressHormoneLevels

SUPPLEMENT FACTS

Serving Size: 1 Veggie Capsule Servings per Container: 90 Amt/Serving DV%*EleutheroRoot(Organic) 158mg †AshwagandhaRoot(Organic) 158mg †SchizandraBerry(Organic) 40mg †CordycepsMushroom(Organic) 50mg †AmericanGinsengRoot 25mg †RhodiolaRootExtract(5%Rosavins) 25mg †RedChineseGinsengRoot 20mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients:ModifiedVegetableCellulose(vegetariancapsule)

NEW

For years we have known about the many benefits of using Aloe Vera on the skin – to treat rashes, cuts, bruises, sunburn and so on. But many are unaware of the incredible health benefits from drinkingthenectaroftheAloeVeraPlant.•SoothessymptomsofIrritableBowelSyndrome•NaturalAnti-Inflammatory•CollagenandElasticRepairofSkin•RegulateWeight&EnergyLevels

SUPPLEMENT FACTSServing Size: 1 Ounce Servings per Container: 32 Amt/Serving DV%*AloeVera(fromAloeVera200:1Concentrate,Aloe Vera 10:1 Concentrate IASCApproved‡) 29,000mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: AloeVeraJuice,Potassiumsorbate,sodiumbenzoate Contains no sugar, starch, yeast, wheat, corn, soy, artificial color or flavor Suggested usage:Drinkoneounce1-3timesdaily ‡ = International Aloe Science Council. Inc. Certified and Approved Raw Material

Aloe Vera Juice (Concentrate)

32 fl oz - $10.991 Gallon (128 fl oz.) - $29.99

NEW & IMPROVED

Page 5: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

5www.LifesourceVitamins.com I 1-800-567-8122

Ultra Aminos 120 Capsules – $15.99

Peoplewithlimiteddietsorpoordigestionmaynotgetenough essential amino acids from their diet. In contrast to proteins or peptide-bound amino acids, our Ultra Amino blend at LifeSource Vitamins contains all 9 essential amino acids in their superior free-form state and in the proportions recommended by the National Academy of Sciences to optimize protein synthesis and tissue repair for adults age 19 and over. Amino acids are the building blocks of protein and makeup3/4ofthebody’ssolidmaterial.Theyarefoundinmuscle tissue, organs, blood and skin. Amino acids also make hormones, enzymes, and vitamins and are essential for a healthy immune system and proper neurological functions.

SUPPLEMENT FACTS

Serving Size: 4 Capsules Servings per Container: 30

*PercentDailyValuesarebasedon2,000caloriediet.**Subjecttonaturalvariability†DailyValue not established. Other Ingredients:Gelatin(capsule),Cellulose,StearicAcid(vegetablesource),MagnesiumStearate(vegetablesource),andSilica.Containsmilkandsoy. Not manufactured with wheat, gluten, egg, fish, shellfish or tree nut ingredients.

Amt/Serving DV%*Calories 15Protein 3g 6%Vitamin B-6(fromPyridoxineHCI) 13mg 650%Blend of peptide-bound Amino Acid sources(WheyProteinIsolate,SoyProteinIsolate,SodiumCaseinate,Gelatin)plusFree-FormAminoAcids(L-Glutamine,L-Arginine,L-Ornithine) 3g(3,000mg) †TYPICAL AMINO ACID PROFILE (example)(per serving) **Essential Amino AcidsMg per 4 Capsule ServingL-Isoleucine 115 mgL-Leucine 205 mgL-Lysine 185mgL-Methionine 35 mg

Amt/Serving DV%*L-Phenylalanine 72mgL-Threonine 141 mgL-Tryptophan 37 mgL-Valine 141 mgNon-Essential Amino AcidsL-Alanine 135 mgL-Arginine 306 mgL-Aspartic Acid 246 mgL-Cysteine 38mgL-Glutamic Acid 454 mgL-Glutamine 200 mgGlycine 167 mgL-Histidine 37 mgL-Hydroxyproline 44mgL-Ornithine 24 mgL-Proline 179mgL-Serine 106 mgL-Tyrosine 66 mg

Antioxidant Supreme 90 Capsules – $16.99

Every cell in our body produces tens of thousands of freeradicals on a daily basis. From a long-term perspective,theoxidationthatinevitablyresultscanhaveadevastatingeffect on the integrity of our healthy cells. LifeSource’sAntioxidantSupremearecomprisedofthemostpowerfuloxidationquenchingnutrientsavailabletoday.

Counteringtheeffectsofoxidationprovidesuswithgreater amounts of energy, increased stamina, and abetter state of overall health. Our distinctive blend of thesehighly effective free radical fighters can play a substantialroleinwardingoffsomeoflife’smostdamagingtoxins.

SUPPLEMENT FACTS

ServingSize:3Capsules ServingsPerContainer:30

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished.

Amt/Serving DV%*SuperoxideDismutase 1000mg †AloeVeraExtract200:1 25mg †GrapeSeedExtract95% 30mg †BetaCarotene 5000IU †

Amt/Serving DV%*AlphaLipoicAcid 30mg †L-Cysteine 15mg †RosemaryLeafExtract 25mg †SeleniumChelate 100mcg †

Arthrigone Cream 4 oz. - $9.99

LifeSource’s Arthrigone Cream has been designed byhealth care professionals as a homeopathic formula forthereliefofsymptomsofpaininjointsassociatedwithminor arthritis symptoms. It may also be helpful for minormuscularpainassociatedwithover-exertion,especiallyinback and neck. Working without contraindications or sideeffects, this cream stimulates your body’s natural healingresponse to relieve symptoms.•Reliefofarthritisrelatedjointpain•MusclepainassociatedwithoverexertionAlso See Our Glucosamine, MSM & Arnica Organic Cream on page 23

With 32 ingredients, including: Glucosamine, Chondroitin, SharkCartilage,EPAfishoilandmanyothers;thisproductwill produce results! We have a two-part approach. First, we attack the pain. After the pain subsides, the rebuilding processbegins.LifeSource’sProprietaryBlendhelpstorebuildyourjoints,tissuesandtendons,whilerelievingthepainthroughproperjointlubrication.Complete,well-rounded nutrition including vitamins & minerals speeds up the healing process without robbing other areas of the body to meet nutritional needs. It is the synergy of the ingredients in this product that make it work so effectively!

SUPPLEMENT FACTS

ServingSize:4Tablets. ServingsPerContainer:25 Amt/Serving DV%*Glucosamine 300mg †Chondroitin 300mg †SharkCartilage 250mg †Cat’sClaw 300mg †Boswellia 40mg †BorageOil 50mg †PrimeRoseOil 50mg †Yucca 400mg †Alfalfa 400mg †WhiteWillowBark 400mg †Horsetail 200mg †Ginger 200mg †EPA(FishOil) 100mg †Vitamin A 5,000 IU 100%Vitamin C 200 mg 333%VitaminD 200IU 50%Vitamin E 75 IU 250%

Amt/Serving DV%*Vitamin B-6 25 mg 1250%Niacinamide 250 mg 1250%Niacin 25 mg 120%PantothenicAcid 100mg 1000%Magnesium 100 mg 20%Selenium 100 mcg 100%Copper 300 mg 150%CitrusBio- 100mg †FlavonoidComplexBromelain 100mg †GrapeSeedExtract 2,000mcg †DevilsClaw 400mg †Calcium Lactate 200 mg 20%Licorice 150mg †Zinc(Gluconate) 15mg 100%Boron 100mcg †Quercetin 25mg †

Arthritis Relief & Joint Rebuilder

100 Tablets – $24.99 200 Tablets - $44.99

(SAVE $5)

Get the benefits of Aspirin without the side effects! LifeSource’sProprietaryBlendincludesawidearrayofherbs and dietary enzymes that contain anti-inflammatory properties. This product supports healthy blood circulation, is effective in pain management & relieves tension headaches.

A Safer Alternative!SUPPLEMENT FACTSServing Size: 2 Capsules Servings per Container: 45

Amt/Serving DV%*WhiteWillowBarkExt.15% 450 mg. *Feverfew 120 mg. *CherryFlex 100mg. *NettleExtract 100mg. *Codonopsis root 100 mg. *Bonaset 100 mg. *JamaicanDogwood 100mg. *Malic Acid 100 mg. *SambucusNigra 85mg. *Quercetin 75 mg. *

Amt/Serving DV%*Thymus Vulgaris 60 mg. *ChamomileFlowerPowder 60mg. *PauD’Arco 50mg. *MagnesiumOxide 50mg. 13%Alfalfa 10 mg. *Cramp Bark 10 mg. *Fo-Ti 5 mg. *Capsicum 5 mg. *Bromelain 5 mg. *Papain 5mg. *

Aspirin (AllNatural)90 Capsules – $13.99

180 Capsules – $23.99(SAVE $4)

=LifeSourceProprietaryBlend

AlphaLipoicAcidisanextremelyimportantantioxidantthatdestroys many of the free-radicals that are harmful to the human body. Alpha Lipoic Acid is both water & fat soluble.•AidsisslowingDegenerativeDiseasessuchas: Diabetes,MultipleSclerosis,Parkinson’sandAlzheimer’s

•HIV/AIDStreatment•FightsAgainstFreeRadicals•SupportsHealthyLiver•ReducesSkinDamage&Wrinkles•ReducesOxidativeStress

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:60 Amt/Serving DV%*AlphaLipoicAcid 250mg †

*DailyValueNotEstablished Other Ingredients: RiceFlour,VegetablePolysaccharide(capsule),MagnesiumStearate (vegetablesource)andSilica. Not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients

Alpha Lipoic Acid60 Veg Capsules - $18.99

120 Veg Capsules - $32.99 (SAVE $5)

Page 6: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

6 www.LifesourceVitamins.com I 1-800-567-8122

Ashwagandha 90 Capsules - $16.99

MedicalresearchershavebeenstudyingAshwagandha(WinterCherry)foryears,therehavebeenmorethan200studiesonthehealingbenefitsofthisbotanical.Somekeyexamplesofthe potential healing effects of Ashwagandha are:•BrainHealth•Alzheimer’sSupport•PromotesGracefulAging•ThyroidBenefits•MenopausalSupport•MemorySupport•Protects&StrengthenstheImmuneSystemSUPPLEMENT FACTSServing Size: 1 Vegetarian Capsule Servings per Container: 90

Amt/Serving DV%*AshwagandhaExtract(Withaniasomnifera)(Root)(Standardizedtomin.2.5%TotalWithanolides-11mg) 450mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Cellulose(capsule),RiceFlourandMagnesiumStearate(vegetablecource)

Astaxanthin 4mg 60 Softgels - $18.99ScientificstudieshavedemonstratedthatAstaxanthincanhelpto support a healthy inflammatory response, enhance immune function, and provide neurological support. Recent research indicatesthatAstaxanthinmayevenhelptosupporttheskin’sstructureduringexposuretosunlight.•Eyeproblemssuchasage-relatedmaculardegeneration(AMD).•Alzheimer’sdisease.•Parkinson’sdisease.•Improvingrecoveryafterstroke.•Protectingagainstcancer.•Reducingcholesterollevels.•Reducingskindamagefromultraviolet(UV)light.

SUPPLEMENT FACTSServing Size: 1 Softgel Servings per Container: 60

Amt/Serving DV%*Zanthin®NaturalAstaxanthin(fromHaematococcuspluvialisextract) 4mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablishe.Other Ingredients: VegetarianSoftgelCapsule(modifiedcornstarch,carrageenan,glycerin,water),ExtraVirginOliveOil,MixedTocopherolsandRosemaryLeafExtract.MixedTocopherolsfrom soy. Not manufactured with wheat, gluten, milk, egg, fish, or shellfish ingredients.

B-12 Complex 2 fl oz - $9.99

Vitamin B-12’s primary functions are in the formation of red blood cells and the maintenance of a healthy nervous system. B12isnecessaryfortherapidsynthesisofDNAduringcelldivision. This is especially important in tissues where cells are dividing rapidly, particularly the bone marrow tissues responsible for red blood cell formation. If B-12 deficiency occurs,DNAproductionisdisruptedandabnormalcellscalled megaloblasts occur. This results in anemia. Symptoms includeexcessivetiredness,breathlessness,listlessness,pallor, and poor resistance to infection. Other symptoms can include a smooth, sore tongue and menstrual disorders.

Anemia may also be due to folic acid deficiency, folic acid also being necessary for DNAsynthesis.Fortunately,oralsupplementationwithvitaminB-12issafe,efficientandinexpensive.LifeSource’sB-12providesthenecessaryamountofthevitamintohelp from becoming B-12 deficient. Sublingual B-12 gives your body the vitamin B-12 nutrients it needs to naturally give you:•Increasedenergy•Reduceddailystressandirritability•Restoredmentalclarity•Helpwithmemoryloss

SUPPLEMENT FACTSServingSize:¼tsp(approx.1mL) ServingsperContainer:59 Amt/Serving DV%*VitaminC(asAscorbicAcid) 20mg 22%Thiamin(fromThiaminHCI)(VitaminB1) .6mg 50%Riboflavin(VitaminB2) 1.7mg 131%Niacin(asNiacinamide)(Flush-Free) 20mg 125%VitaminB6(fromPyridoxineHCI) 2mg 118%Folate 333mcg(200mcgfolicacid) 83%VitaminB12(asCyanocobalamin) 1mg(1,000mcg) 41667%PantothenicAcid(fromCalciumPantothenate) 30mg 600%SteviaExtract(Leaf) 2mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:De-ionizedWater,Glycerin,Xylitol,MalicAcid,NaturalFlavors,PotassiumSorbate(aspreservative),GingerRoot,GrapefruitFibersandCinnamonBarkOilNotmanufactured with wheat, gluten, soy, milk, egg, fish or shellfish ingredients

Astaxanthin Extra Strength 10mg 60 Softgels - $34.99

Zanthin®NaturalAstaxanthinPatentedandGuaranteedStrength.ScientificstudieshavedemonstratedthatAstaxanthincan help to support a healthy inflammatory response, enhance immune function, and provide neurological support. Recent researchindicatesthatAstaxanthinmayevenhelptosupporttheskin’sstructureduringexposureto sunlight.

SUPPLEMENT FACTS

Serving Size: 1 Softgel Servings per Container: 60 Amt/Serving DV%*

Calories 5 NaturalAstaxanthin(fromHaematococcuspluvialisextract) 10mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: SafflowerOil,SoftgelCapsule(gelatin,water,glycerin)andVitaminE (asnaturald-alphatocopherol).VitaminEfromSoy. Not manufactured with wheat, gluten, milk, egg, fish, shellfish or tree nut ingredients.

Vitamin B6 100 Tablets - $7.99

Vitamin B6 is involved in the process of making serotonin and also norepinephrine, both of which are chemicals that transmit signals to your brain. Vitamin B6 is also involved in the formation of myelin, which is a protein layer that forms around your nerve cells.

•CardiovascularDisease•CognitiveFunction•HelpsreducePremenstrualSyndrome•CanhelpwithNauseaandVomitinginPregnancy

SUPPLEMENT FACTSServing Size: 1 Tablet Servings per Container: 100 Amt/Serving DV%*VitaminB-6(pyridoxineHCI) 100mg 5882%*

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished Other Ingredients: Dicalciumphosphate,cellulose,vegetablestearin,cellulosegum,magnesium stearate and silica Contains No sugar, salt, dairy, yeast, wheat, gluten, corn, soy, preservatives, artificial colors or flavors Suggested usage: Take 1 tablet daily

Astragalus Root Extract 90 Capsules - $15.99

Used for centuries to help keep immune function optimal by restoring, strengthening and increasing vitality. Stimulates deep immunity and is best for immune deficiency where one gets sick easily or is prone to viral and bacterial infections. Helps keep white blood cell counts in the normal range for those in chemotherapy.

Supplement Facts

Serving Size: 1 Veggie Capsule Servings per Container: 90 Amt/Serving DV%Organic Astragalus Root (Astragalusmembranaceus) 470mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Modified Vegetable Cellulose

NEW

Ashwagandha Powder(Organic) 1 lb. - $19.99Ashwagandha,anexoticIndianherb,hasremarkablestress-relievingproperties comparable to those drugs used to treat depression and anxiety.Inadditiontoitsexcellentprotectiveeffectsonthenervoussystem, Ashwagandha may be a promising alternative treatment for a variety of degenerative diseases. Ashwagandha has powerful antioxidantpropertiesthatseekanddestroythefreeradicalsthathavebeen implicated in aging and numerous disease states. LifeSource 100%USDAOrganicAshwagandhaPowderhelpskeepyoucalmandrelaxedbyinteractingwiththestresshormone,cortisol,producingcalming effects on nerves while supporting adrenal gland function.SUPPLEMENT FACTSServingSize:2g(1Teaspoon). ServingsperContainer:225

NEW

Amt/Serving DV%Calories 8Total Fat 0 g 0%Cholesterol 0 mg 0%Sodium 0 mg 0%Total Carbohydrates < 2 g < 2%DietaryFiber <2g <2%Sugars 0 g 0%Protein 0g 0%

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Ingredients:100%OrganicAshwagandhaPowder.Suggested usage: Take 1 teaspoon daily

Page 7: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

7www.LifesourceVitamins.com I 1-800-567-8122

B-50 Complex 100 Capsules - $13.99

B-50 Caps provide a full compliment of B-Vitamins plus Choline and Inositol. These vitamins work to support energy production, maintain healthy homocysteine metabolism, and promote the health of the nervous system.SUPPLEMENT FACTSServingSize:1Capsule ServingsPerContainer:100

Amt/Serving DV%*VitaminB-1(Thiamine) 50mg. 3333%VitaminB-2(Riboflavin) 50mg. 2941%VitaminB-6(PyridoxineHCI) 50mg. 2500%VitaminB-12(Cyanocobalamin) 50mcg. 833%Biotin 50 mcg. 17%Niacin(VitaminB3)(asNiacinamide) 50mg. 250%Choline Bitartrate 25 mg. *PantothenicAcid(d-CalPant.) 50mg. 500%Folic Acid 400 mcg. 100%ParaAminobenzoicAcid 25mg. *Inositol 25 mg. *

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished.

B-100 Complex 100 Capsules - $18.99

B-Vitaminsarewatersoluble,andwiththeexceptionofB-12,havelimitedstorageinthe body and thus require daily replenishment. B-100 Caps provide a full compliment of B-Vitamins plus Choline and Insoitol.

SUPPLEMENT FACTSServingSize:1Capsule ServingsPerContainer:100 Amt/Serving DV%*Thiamin(fromThiaminHCI)(VitaminB-1) 100mg. 6.667%Riboflavin(VitaminB-2) 100mg. 5.882%Niacin(VitaminB-3)(asNiacinamide) 100mg. 500%VitaminB-6(fromPyridoxineHCI) 100mg. 5,000%Folate(asFolicAcid) 400mcg. 100%VitaminB-12(asCyanocobalamin) 100mcg. 1.667%Biotin 100 mcg. 33PantothenicAcid(fromCalciumPantothenate) 100mg. 1,000%Choline(fromCholineBitartrate) 10mg. †Inositol 10mg. †PABA 10mg. †

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenot established.

Methyl-B-12 5000mcg 60 Lozenges - $22.99

SUPPLEMENT FACTS

Serving Size: 1 Lozenge Servings per Container: 60 Amt/Serving DV%*VitaminB-12(asMethylcobalamin) 5,000mcg 208,333%

Other Ingredients: Xylitol, Cellulose, Modified Cellulose Gum, Silica, Natural Raspberry Flavor, Stearic Acid, Natural Strawberry Flavor,CitricAcid,CalciumStearate,GrapeExtract(Fruit),GrapeseedExtract,WildBlueberry(Fruit),WildBlueberryExtract,RaspberryExtract(Fruit),RaspberrySeedExtract,Cranberry(Fruit),Prune,TartCherry(Fruit),WildBlueberry(Fruit),WildBilberryExtract,Strawberry(Fruit) Contains Noartificialcolors,flavorsorpreservatives;nowheat,gluten, milk, eggs, peanuts, tree nuts, soy, crustacean shellfish or fish. Suitable for vegans. Suggested usage: Take 1 lozenge daily

Methyl-B-12 1000mcg 100 Lozenges - $16.99

Methylcobalamin is a form of bio-active Vitamin B12 that is well absorbed and crosses the blood brain barrier more effectively than other forms of B12. This makes it suitable forgeneral/systemicwideB12deficiency,andmoreuniquelyforbrain/nervedisorders.ItistheformofvitaminB12activein the central nervous system. It is essential for cell growth and replication. The body relies on the efficient conversion of carbohydrates and fatty acids to glucose, the body’s fuel. VitaminB12playsamajorroleinthatconversion.

SUPPLEMENT FACTS Amt/Serving DV%*Vitamin B-12 1,000 mcg 16,667%Suggested usage: Take 1 lozenge daily

Liquid Methyl B-122,500 mcg

2 fl oz. - $15.99

•Maintainingnormalenergylevels•Healthyneurologicalfunctioning,includingmental

alertness and clarity•Supportingnormalhomocysteinelevelsforhealthy

cardiac function•Helpingtoeaseoccasionalstressandsleeplessness•Maintaininghealthycellgrowthandrepair•Promotingnormalimmunefunction•Supportingnormalmetabolismofcarbohydratesandfats

SUPPLEMENT FACTSServing Size: 1 ml Servings per Container: 59 Amt/Serving DV%*Calories 5 Total Carbohydrates 0 g Sugars 0 g VitaminB-12(asMethylcobalamin) 2,500IU 41,667%

Other Ingredients:VegetableglycerinUSP,ReverseOsmosisPurifiedWater, Montmorency whole cherry fruit concentrate, Organic cherry flavoring,citricacid,RebaudiosideAextract(Stevia),citrusextract Contains no Sugar, Starch, Salt, Wheat, Gluten, Yeast, Milk or Soy Derivatives

CoenzymeBComplexcontainsvitaminsinthesuperior,“active” form. These methyl forms of B vitamins are absorbed and utilized more efficiently by the body and are also most effective when taken together. For those that are seeking the most support from their B vitamins.

SUPPLEMENT FACTS

Serving Size: 2 Capsules Servings per Container: 60

Superior Methyl B Complex 120 Capsules - $23.99

Amt/Serving DV%*Thiamin(vitaminB1)(asthiaminemononitrate,thiaminehydrochloride, thiamincocarboxylasechloride) 50mg 4167%Riboflavin(vitaminB2) (riboflavin,riboflavin5’phosphate) 50mg 3846%Niacin(vitaminB3)(asinositolhexanicotinate) 100mg 625%VitaminB6(aspyridoxinehydrochloride,pyridoxal5’phosphate,pyridoxine alpha-ketoglutarate) 80mg 4706%Folate(fromQuartrefolic®5-methyltetrahydrofolate glucosaminesalt) 400mcgDFE(240mcg5-MTHF) 100%VitaminB12(ascobolamin,Methylcobalamin) 500mcg 20833%Biotin 200 mcg 667%PantothenicAcid(D-calciumpantothenate) 50mg 1000%Choline(bitartrate) 40mg 7%PABA(para-aminobenzoicacid) 50mg †Inositol(frominositolhexanicontinate) 27mg †CoenzymeQ10 1mg †AlphaLipoicAcid 200mcg †

NEW

Barley Grass Powder (Organic) 1 lb. - $19.99Barley Grass contains very large amounts of vitamins, minerals, essential and non-essential amino acids, high amountsofantioxidantsandenzymesandotherbeneficialnutrients.Thesebeneficialnutrientsinclude:SuperoxideDismutase(SOD),B9(FolicAcid),B5(PantothenicAcid),VitaminA(Carotenoids),includingBetaCarotene,B1,B2,B6,B12,C,Calcium,Iron,Magnesium,Manganese,Potassium,Sodium and Zinc. LifeSource’sUSDAOrganicBarleyGrassPowder,certifiedand rich with the fiber, protein, minerals, chlorophyll andantioxidantsthatmakeupacompletenutritionalsupplement.

SUPPLEMENT FACTS

ServingSize:5g(1Tablespoon) ServingsperContainer:90

Amt/Serving DV%*Calories 17.5 Energy 73.2 KJ TotalFat .18g .28%

Amt/Serving DV%*Sodium 9.9 mg .42%TotalCarbohydrates 2.81g .94%Protein 1.11g 2.21%

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Ingredients: 100%OrganicBarleyGrassPowder. Suggested usage: Take 1 tablespoon daily

NEW

Page 8: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

8 www.LifesourceVitamins.com I 1-800-567-8122

Ultra Beta Glucan 90 Veg Caps – $17.99

Naturally boosts the immune system by optimizing its response to diseases and infections. But because the body doesn’t produce beta glucans naturally, the only way to get the compound is through outside sources. Beta Glucan is a powerful immune stimulator, activating the macrophages in the immune system. Studies have found that this product not only has a positive effect on the macrophages, but also on B lymphocytes, natural killer cells, and suppressor T cells. Inaddition,BetaGlucanisaneffectiveantioxidantandfreeradical scavenger. Maitake mushroom has the active ingredient beta glucan. These mushrooms have been used in Japan for centuries to promote longevity and overall well-being.

SUPPLEMENT FACTS

ServingSize:1VegCap ServingsPerContainer:90

Amt/Serving DV%*Beta-1,3/1,6-D-GlucanPowder(fromSaccharomycescerevisiae) 100mg* †MaitakeMushrooms(Grifolafrondosa) 160mg* †

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished.

Beta-Sitosterol 90 Capsules - $14.99

Beta-Sitosterol is a unique dietary supplement rich in plant sterols. Scientific studies have shown that plant sterols can help lower cholesterol levels. LifeSource’s formula provides high potency botanicals to address the challenges of prostate health that can lead to an enlarged prostate.•CardiovascularHealth•HealthyUrinaryFlow•HealthyProstateFunction•ProvidesCholesterolLoweringBenefits

SUPPLEMENT FACTS

Serving Size: 1 Capsule Servings per Container: 90

Amt/Serving DV%*

Beta-SitosterolComplex(providinganaverageof 225mgofbeta-sitosterol) 500mg †

Other Ingredients:Gelatin(bovine),microcrystallinecelluloseandvegetable magnesium stearate

Bee Pollen 500mg 100 Capsules - $6.99

•Relieveallergies•Strengthentheimmunesystem•Increasestamina,mentalclarityandalertness•Provideantioxidantsandworkasananti-microbialand

anti-bacterial agent

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:100

Amt/Serving DV%*BeePollen 500mg †

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished.

BCAA 5,000 Powder 11.65 oz – $39.99

OurAll-NewBCAAPowderoptimizesproteinsynthesisandtissuerepairforadults18andover.BranchedChainAminoAcidsstimulate the building of protein and muscle and reduces muscle breakdown,andalsoaccountsfornearly1/3rdoftheaminoacidsin muscle protein. LifeSourceVitaminsBCAAPowderispackedwith5,000mgofL-Leucine, L-Isoleucine, and L-Valine. We’re also added L-Glutamine to help build, repair, and maintain muscle tissue.•Trainharder,longer,andstrongerwithoutfatigue.•Idealforbothhighintensitytrainingaswellasendurancetraining.•Increasestestosteroneinthepost-trainingperiod,andalsobuilds

muscle by improving the body’s testosterone to cortisol ratio.SUPPLEMENT FACTSServingSize:1Scoop ServingsPerContainer:30 Amt/Serving DV%*Calories 4Potassium 34g 1%Vitamin B-1 1.5 mg 100%Niacin 20 mg 100%PantothenicAcid 10mg 100%Branched Chain Amino Acids 5 grams **Leucine 2,500 mg **Isoleucine 1,250 mg **Valine 1,250 mg **Glutamine 3 grams **

Biotin 5,000 mcg 60 Veg Caps - $9.99

Biotin is a water-soluble vitamin necessary for normal growth and body function. Biotin promotes healthy immune system function and plays a critical role in skin health.

SUPPLEMENT FACTS

ServingSize:1VegCap ServingsPerContainer:60

Amt/Serving DV%*Biotin5.0mg (5,000mcg) 16,667%

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenot established.

Bilberry Extract 60 Veg Capsules - $18.99

•Promoteshealthyeyefunctionandvision•Reducesfreeradicaldamagetotheretina•Improvesnightvision•Soothessore,tiredeyes

SUPPLEMENT FACTS

ServingSize1Capsule ServingsPerContainer60

Amt/Serving DV%*BilberryExtract(berry)(25%anthocyanins) 100mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenot established. Other Ingredients: Cellulose, Vegetarian capsule (Cellulose),silica,MagnesiumStearate(VegetableSource) Contains Noartificialcolors,flavorsorpreservatives;nowheat,gluten,milk, eggs, peanuts, tree nuts, crustacean shellfish or fish Suitable for vegans.

Beet Root Powder Organic 10 oz. - $22.99

•Beneficialforpurifying&strengtheningtheblood•Improvesbloodcirculationandregulatesbloodpressurelevels•Effectiveinencouraginggooddigestion

SUPPLEMENT FACTS

ServingSize:1Scoop(7gofOrganicBeetRootPowder)ServingsPerContainer:40

*PercentDailyValuesarebasedona2,000caloriediet. Ingredients: RawOrganicBeetPowder

Amt/Serving DV%*Calories 23Calories from Fat 0Total FatSaturated Fat 0Trans Fat 0 0%Cholesterol 0 mg 0%Sodium 38mg 1%Total Carbohydrate 5 gDietaryFiber 0gSugars 3 g

Amt/Serving DV%*Other Carbohydrates 2 g 1%Protein 1g 2%Vitamin A 11 IU 0%Vitamin C 6 mg 10%Calcium 9 mg 1%Folate 49 mcg 12%Magnesium 11 mg 3%Phosphorus 26mg 3%Potassium 173mg 5%

Beta Carotene 25,000 IU 90 Softgels - $6.99

•AntioxidantSupport

•ConvertstoVitaminAasneeded

SUPPLEMENT FACTS

ServingSize:1Softgel ServingsPerContainer:90

Amt/Serving DV%*

VitaminA(BetaCarotene) 25,000IU 500%

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished.

Page 9: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

9www.LifesourceVitamins.com I 1-800-567-8122

Bronchial Support 8 oz - $17.99

LifeSource’s unique Bronchial Support formula is designed toloosenphlegm(mucus)&clearthebronchialtubes.Italso temporarily relieves bronchial congestion and coughing associated with bronchitis and the common cold. Also great for increasing circulation and strengthening the immune system.

SUPPLEMENT FACTS

ServingSize:1Teaspoon ServingsperContainer:48

Amt/Serving DV%*Proprietary BlendProprietaryBlend:BeeHoney,RosemaryExtract,HorseradishExtract,OnionExtract,Watercress,MentholandEucalyptus 1,000mg †VitaminA(asAcetate) 4,000IU 80%VitaminD3(ascholecalciferol) 400IU 100%Magnesium(asMagnesiumChloride) 6mg <1%Zinc(asZincLactate) 3mg 20%

Other Ingredients: CornSyrup,Methylparaben,PropyleneGlycol,Glycerine,SodiumBenzoate,PotassiumSorbate,CitricAcidandPurifiedWater Suggested usage: 2 to 4 teaspoons two times daily

Black Cohosh Extract 120 Capsules - $12.99

Relief of many menopausal symptoms and menstrualdysfunctions

•Hotflashes•Headaches•Mood•Cramps

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:120

Amt/Serving DV%*BlackCohosh(Cimicifugaracemosa)(root)(Standardizedtocontain 2.5% Triterpene glycosides 40 mg *ChasteberryFruitPowder 100mg *DongQuai(Angelicasinensis)(rootpowder) 100mg *

*PercentDailyValuesarebasedon2,000caloriediet.+DailyValuenot established

Suggested Use: As an herbal dietary supplement, take 2 Capsules daily, preferably at separate times(1inthemorning,1intheevening).

Free of: milk, wheat, corn, yeast, sugar, salt, soy

Other Ingredients: WhiteRicePowder,MagnesiumStearate

Warnings: If you are taking a birth control pill, are pregnant, lactating or are considering becoming pregnant, seek the advice of your physician prior to using this product.

Blood Pressure Support 90 Veg Caps - $26.99

EmergingevidenceindicatestheroleofGrapeSeedExtract(GSE)supportingcardiovascularhealthmayextendbeyonditsimportantantioxidantfunctions.ScientificstudiesshowtheproprietaryGSEfoundinLifeSource’sBloodPressureSupport,MegaNatural®- BP™containsflavonoidsthatcansupporthealthyarterialfunction already within the healthy range through a number of mechanisms. In addition, we have included standardized Hawthorn Extractasasynergist.HawthornExtractprovidespowerfulantioxidantflavonoids,includingstandardizedVitexinthat,alongwith other components in Hawthorn, have also been found to support healthy range blood pressure and blood flow.

•Cardiovascularsupport•Helpsmaintainbloodpressurealreadywithinthehealthyrange

SUPPLEMENT FACTS

Serving Size: 1 Veg Cap Servings per Container: 90

Amt/Serving DV%*MegaNatural®-BP™(GrapeSeedExtract)(Vitisvinifera) 150mg* *(Standardizedtomin.90%Polyphenols)HawthornExtract(Leaf&Flower)(Crataeguslaevigata) 300mg *(Standardizedtomin.1.8%Vitexin)*PercentDailyValuesarebased

*PercentDailyValuesarebasedon2,000caloriediet.+DailyValuenotestablished. Other Ingredients:Cellulose(capsule),Rice,Flour,MagnesiumStearate(vegetablesource)and Silica. Contains no: sugar, salt, yeast, wheat, gluten, soy, milk, egg, shellfish or preservatives. Vegetarian/VeganProduct.

Helps balance and maintain healthy blood sugar levels. Chromium and Fenugreek improve glucose tolerance and balance blood-sugar levels. Gymnema to improves insulin productioninthepancreas,(aswellasinsulin’sabilitytolowerblood-sugarlevels).Bittermelonimprovesthebody’sabilitytouse blood sugar and improves glucose tolerances. Vanadium mimics the actions of insulin, improving glucose tolerance by restoring receptor sensitivity to insulin.

SUPPLEMENT FACTS

ServingSize:2Capsules ServingsPerContainer:45

Blood Sugar Control

90 Capsules - $15.99 180 Capsules - $28.99

(SAVE $3)

Amt/Serving DV%*Vitamin C Buffered 250 mg 417%Zinc(L-Monomethionine) 30mg 200%GymnemaSylvestre 750mg †Alamime(CrystallineAmino Acid) 100mg †

Amt/Serving DV%*Glutamine(CrystallineAmino Acid) 100mg †Chromium 400mcg †Vanadium(vanadyl)sulfate 7mg †BitterMelonExtract 50mg †Fenugreek 100mg †Black (Cumin) Seed Oil 90 Veg Caps - $13.99

LifeSourceVitaminsBlack(Cumin)SeedOil.

Purepressedwithoutchemicalextractions,

and available in our new Liquid Vegetable

Capsules for quick absorption in your system.

•ReliefofAllergiesandAsthma

•BoostingofImmuneSystem

•Anti-inflammatory

•Anti-microbial

•DigestiveAid

SUPPLEMENT FACTS

Serving Size: 1 Vegetable Capsule Servings per Container: 90

Amt/Serving DV%*BlackCuminSeedOil(Nigellasativa) 500mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Vegetable cellulose and d-alpha tocopheryl acetate

Bitter Melon 90 Veg Caps - $16.99

Bitter Melon supports a healthy pancreas, balanced blood sugar levels in the normal range, and it helps to maintain normal blood glucose metabolism. Further, it has an affinity for the blood and brings these cleansing, purifying qualities into the entire circulatory system.

SUPPLEMENT FACTS

Serving Size: 1 Veggie Cap Servings per Container: 90

Amt/Serving DV%*BitterMelonFruitExtract(5%Charantin) 500mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Modified Vegetable Cellulose

NEW

Page 10: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

10 www.LifesourceVitamins.com I 1-800-567-8122

Essential for healthy teeth, gums & bones, helps heal wounds, scar tissue, & fractures, prevents scurvy, builds resistance to infection, aids in the prevention & treatment of the common cold, gives strength to blood vessels, aids in the absorption of iron.

Vitamin C is required for the synthesis of collagen, the intercellular “cement” which holds tissues together. It is also one ofthemajorantioxidantnutrients.Itpreventstheconversionofnitrates(fromtobaccosmoke,smog,bacon,lunchmeats,&somevegetables)intocancer-causingsubstances.

Vitamin C w/RoseHips500mg

100 Tablets - $7.99 250 Tablets - $16.99

SUPPLEMENT FACTS

Serving Size: 1 Tablet Servings per Container: 250

Amt/Serving DV%*VitaminC(asAscorbicAcidwithRoseHips) 500mg 833%

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Cellulose, vegetable stearin, cellulose gum, magnesium stearate and silica. Contains No sugar, salt, dairy, yeast, wheat, gluten, corn, soy, preservatives, artificial colors or flavors

Vitamin C 1,000 mg100 Tablet - $8.99

200 Tablets - $14.99(SAVE $3)

Superior C 500 mg 180 Veg Caps - $26.99This buffered, non-acidic Vitamin C supplement is superior as it alsocontainsAlphaLipoicAcid,anantioxidantknowntohelpregenerate Vitamin C in the body. Studies suggest that Alpha Lipoic Acid may enhance the body’s utilization of Vitamin C. The addition of Bioflavonoids as synergists helps to create a wellabsorbed, highly effective Vitamin C supplement. The metabolics allows our Superior C 500 mg to work by:•IncreasingviabilityofVitaminC•IncreasingtheactivitytwicethatofconventionalVitaminCto

utilize Vitamin C for health and healing•Storesincellsandtissuestwiceaslonggivingthebodymore

time to absorb Vitamin C for health and healingAbsorbedapproximately4timestherateofnormalVitaminC!SUPPLEMENT FACTSServingSize:1VegCapsules ServingsPerContainer:180 Amt/Serving DV%*VitaminC(fromThreonicAcidEnhancedBufferedCalciumAscorbate) 500mg 556%Calcium(fromBufferedCalciumAscorbate) 60mg 6%TransportC-Plus(TrademarkedblendofThreonicAcidenhancedbufferedCalciumAscorbateandAlphaLipoicAcid 650mg †AlphaLipoicAcid 40mg †CitrusBioflavonoids(37%totalbioflavonoidsasHesperidin) 100mg †AcerolaPowder 25mg †RoseHipsPowder(Rosacanina)(Seed) 25mg †Rutin 25mg †Suggested Usage: As a dietary supplement, take 1 Vcap® 1 to 3 times daily, preferably with meals.

Other Ingredients: Cellulose(capsule),CellulosePowder,StearicAcid(vegetablesource),MagnesiumStearate(vegetablesource)andSilica.Vegetarian/VeganProduct.

Vitamin C Chewable 100 Lozenges - $13.99

•GreatTasting&Greatforyou!Kidslovethem!•SweetenedwithXylitol•NaturalOrangeJuiceFlavor

SUPPLEMENT FACTSServingSize:1Lozenge ServingsPerContainer:100

Amt/Serving DV%*Calories 5Total Carbohydrate 1g <1%*Sugars 1g †Sodium 40mg 2%VitaminC(fromSodiumAscorbateandasAscorbicAcid) 500mg 833%Acerola 5mg †CitrusBioflavonoidComplex 5mg †OrangeJuicePowder 100mg †

Vitamin C Gummies 250 mg 90 Gummies - $16.99

LifeSource Vitamins Vitamin C Gummies are perfect for those adults and children who want a different and fun way to take their vitamins. If you don’t like swallowing pills, these are for you. They taste great and are a great way to ensure you are getting an adequate intake of these key nutrients your body needs.

SUPPLEMENT FACTSServing Size: 2 Gummies Servings per Container: 45 Amt/Serving DV%*Calories 20Total Carbohydrates 5g 2%Sugars 3g †VitaminC(ascorbicacid) 250mg 417%Sodium 20mg 1%

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValue not established. Other Ingredients: Glucose syrup, sugar, water, pectin, sodium citrate,naturalflavorsandnaturalcolors(annatto) Allergen Warning: May contain tree nuts

CBD Balm Lavender(FullSpectrum) 1 oz. - $24.99This combination of natural ingredients harnesses the power offull-spectrumCBDfortopical,all-naturalpainreliefandwellness.Enjoydailyaspartofyourself-careroutine.Applytopicallyasneeded,gentlymassageintotheskinandrelax.•Canrelievediscomfortintheneck,back,shoulders,wrists,

hands and knees•Helpsmusclesrecoverfromsoreness,aches,crampsand

nerve pain•Moisturizetheskintotreatchappedlipsanddryskin

Ingredients:FullSpectrumCBDOilextract(500mg),TocopherolVitaminE,Beeswax,AvocadoOil,LavenderEssentialOil,HempSeedOil,JojobaOilandCoconutOil

Vitamin C Crystals Buffered 4.4 oz - $11.99

100% Calcium Ascorbate – Non AcidicLifeSource Vitamin C Crystals are a scientifically advanced form of vitamin C!•AbletoenhancetheabsorptionandutilizationofvitaminC.*•Addedcalciumascorbatetocreatenon-acidic(buffered),

“GI friendly” delivery system.Vitamin C is a water-soluble vitamin that has many important functionsinthebodyincludingantioxidantactivity,supportof normal, healthy collagen, synthesis of neurotransmitters such as serotonin, carnitine production and the support of normal, healthy immune function.

Our Vitamin C Crystals are a scientifically advanced form of vitamin C which binds ascorbic acid to lipid metabolites such as fatty acids, esters and fatty alcohols to enhance digestion, absorp-tion, cellular uptake and retention as well as utilization of essential vitamin C in the body. This increased cellular uptake and retention of vitamin C results in enhanced vitamin C functions.

SUPPLEMENT FACTS

ServingSize:1/4teaspoon ServingsPerContainer:105

Amt/Serving DV%*VitaminC(ascalciumascorbate) 1,000mg 1,777Calcium(ascalciumascorbate) 110mg 12

*Dailyvaluesarebasedon2,000caloriediet.

Calcium Ascorbate Crystals are a non-acidic form of powdered Vitamin C and are gentler on the stomach and teeth than non-buffered Vitamin C.

CBD Oil(FullSpectrum) 1 fl. oz. - $39.99Cannabidiol(CBD)isacompoundfoundintheflowersandleavesof the hemp plant. This compound, alongside hemp’s other abundant healing compounds, has become popularized for its natural therapeutic qualities. LifeSourceVitaminsCBDOilisFullSpectrum,meaningitcontainsall the plants natural Cannabinoids, Terpenes, and Flavonoids. Full Spectrum delivers the full synergistic effect! In other words, our FullSpectrumCBDismuchmoreeffectiveatanydose.

SUPPLEMENT FACTSServing Size: 0.5 ml Servings per Container: 60 Amt/Serving DV%*HempOilExtract(CBD) 8.3mg †TotalFat .5g .8%SaturatedFat .5g †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients:HempOilExtract,Medium-ChainTriglyceride(MCT)Oil,OrganicFlavoringContains Less Than .3% THC

NEW

NEW

Page 11: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

11www.LifesourceVitamins.com I 1-800-567-8122

Coral Calcium Advanced 100 Veg Caps - $19.99

Coral Calcium is an alkalizing mineral power house that has beenshowntohelpbalancethePhlevelofthebody,creatingan environment where the body can heal itself, the God given way, Our new formula contains higher levels of Coral Calcium andMagnesium.We’vealsoaddedVitaminDtohelpyourbodyabsorb the calcium.

SUPPLEMENT FACTS

Serving Size: 2 Veg Capsules Servings per Container: 50

Amt/Serving DV%*VitaminD(asErgocalciferol)10mcg (400IU) 50%Calcium(fromfossilizedCoralCalcium) 500g 38%Magnesium(fromMagnesiumOxide, CitrateandAspartate) 250g 60%FossilizedCoralCalcium 1,430mg †

*PercentDailyValuesarebasedon2,000caloriediet. Other Ingredients:Cellulose(capsule),SilicaandMagnesiumStearate(vegetablesource) Not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients

Ultra Bone Builder 120 Capsules – $19.99

Bone health continues to be a key concern for people of all ages. Building good bone density begins when you are young by providing the nutrients that will lay the foundation for good bone health later in life. Calcium is not only required for optimal bone health, it is also necessary for nerve impulse transmission and normal muscle contractions. More recent research suggests that other benefits may include weight management, colon health and the maintenance of healthy blood pressure. Not all Calcium MCHAiscreatedequal!DonotfindthecheapestversionofCalcium MCHA, in which you may be buying bone meal with low absorption potential. Bone meal is not the same as Calcium MCHA.

At LifeSource Vitamins our goal is results, nothing else matters with regards to supplements. This is a great dosage for long and steady usage to gradually help with your bone strength.

SUPPLEMENT FACTSServing Size: 4 Capsules Servings per Container: 30 Amt/Serving DV%*Calories 5Protein(fromMCHAandAminoAcidChelates) 1g 2%VitaminC(fromMagnesiumAscorbate) 133mg 148%VitaminD3(asCholecalciferol) 667IU 83%VitaminK2(asMenaquinone-4)MK-4 67mg 56%Thiamin(VitaminB1)(fromThiaminHCI) 3mg 250%Calcium(fromMCHA) 667mg 51%Phosphorus(fromMCHA) 287mg 23%Magnesium(fromMagnesiumOxideandAscorbate) 400mg 95%Zinc(fromZincAminoAcidChelate) 7mg 64%Copper(fromCopperAminoAcidChelate) .7mg 78%Manganese(fromManganeseAminoAcidChelate) 2mg 87%HorsetailHerb(Equisetumarvense)(AerialParts) 67mg †Boron(fromBoronAminoAcidChelate) 467mcg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: BovineGelatin(capsule),MagnesiumStearate(vegetablesource),Silica,Glucosamine.PotassiumSulfateComplex,StearicAcid(vegetablesource)andcellulose Containsshellfish(crab,shrimp,lobster,crayfish)

Liquid Cal/Mag Blueberry Flavor 16 fl oz. - $14.99

LifeSourceVitaminsLiquidCal/Magprovides500mgofCalciumfrom Calcium Citrate, a superior form of Calcium and also contains400IUofVitaminD,whichincreasestheabsorptionofCalcium while providing 250mg of Magnesium from Magnesium Citrate per serving.•HealthyBones&Teeth•MuscleActivities&Health•BloodPressureSupport•WeightSupport•Great-TastingBlueberryFlavorisBack!!!AdequateCalciumandVitaminD,aspartofahealthydiet,throughout life, along with physical activity may reduce the risk of osteoporosis later in life.

SUPPLEMENT FACTSServingSize:1Tbsp ServingsPerContainer:32

Amt/Serving DV%*Calories 40Total Carbohydrate 9 gXylitol 2g †VitaminD(asErgacalciferol) 400iu 100%Calcium(fromCalciumCitrate) 500mg 50%Magnesium(fromMagnesiumCitrate) 250mg 63%

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: De-ionizedWater,VegetableGlycerin,MalicAcid,XanthanGum,PotassiumSorbate(aspreservative),NaturalBlueberryFlavorandGrapeSkinExtract.ContainSoy Not manufactured withwheat,gluten,milk,egg,fishorshellfishingredients)

Oyster Shell Calcium provides health benefits and can play an important role in the body by increasing the functionality of nerves, cells, muscle and bone.

SUPPLEMENT FACTS

ServingSize:2Tablets ServingsPerContainer:50

Amt/Serving DV%*

Calcium(fromOysterShellandCalciumCarbonate) 1000mg

Magnesium(fromMagnesiumOxide) 500mg

VitaminD(fromFishOil) 200IU

Oyster Calcium100 Tablets - $9.99

200 Tablets - $16.99(SAVE $3)

SUPPLEMENT FACTSServingSize:3VegCaps ServingsPerContainer:80

Amt/Serving DV%*VitaminD(asErgocalciferol-avegetariansource) 750IU 188%Calcium(fromCalciumCitrate) 450mg 45%Magnesium(fromMagnesiumOxide) 225mg 56%Zinc(fromZincAminoAcidChelate) 11mg 73%Copper(fromCopperAminoAcidChelate) 0.75mg 38%Manganese(fromManganeseAminoAcidChelate) 4 mg 200%

*Dailyvaluesarebasedona2,000CalorieDiet. Free of: sugar, salt, yeast, wheat, gluten, milk, egg, shellfish or preservatives Other ingredients:Cellulose(capsule),Cellulose,AscorbylPalmitateandSilica.

Calcium Citrate Plus 240 Veg Caps - $24.99

Liquid Cal/Mag Orange/VanillaFlavor

32 fl oz - $24.99

•500mgCalciumCitrateBlend•250mgMagnesiumCitrateBlend•1,000IUVitaminD3•1,000mgNaturalSilicaBlend•L-Lysine,Boron,IonicTraceMineralsandmuchmore•100%Vegetarian•NaturalOrange/VanillaFlavor

SUPPLEMENT FACTS

ServingSize:1tbsp.(2tablespoons=1floz) Servings per Container: 32

Amt/Serving DV%*Calories 4Total Carbohydrates 1Sugars 0Calcium(asCalciumlactategluconate,Calciumcitrate(Lithothamniumcorallioides)(wholeplant) 500mg. 50%Magnesium(asMagnesiumcitrate,Magnesiumgluconate,(Lithothamniumcorallioides)(wholeplant) 250mg 63%Manganese(asManganeseBisglycinatechelate) 2mg 100%Boron(asbororganicglycine) 2mg †L-Lysine 100mg †NaturalSilicaBlend(providing100mgofnaturalsilica)AloeVerajuice,Bambooextract(Bambusavulgaris)(stem),Horsetailextract(Equisetumarvense)(leaf) 1,000mg †SeaVegetarianDerivedIonicTraceMinerals 3mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Triple filtered water, Citric acid, Xanthan gum, Natural flavoring, Reb.A(Steviarebaudianaextract,Potassiumsorbate,Potassiumbenzoate(topreservefreshness) Contains No artificial colors, flavors or sweeteners. Gluten, Milk, Salt, Soy, Starch, Wheat and Yeast free

Page 12: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

12 www.LifesourceVitamins.com I 1-800-567-8122

Charcoal 100 Capsules - $8.99

•Detoxificationofthestomachandintestines•Bloating•Malodorousgas•HighCholesterol

SUPPLEMENT FACTS

ServingSize:2Capsules ServingsPerContainer:50

Amt/Serving DV%*Charcoal 520mg †

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished.

Chlorella (USDAOrganic) 200 Tablets - $19.99

Chlorella is a green single-celled microalgae that has naturallyoccurringchlorophyll,plusbeta-carotene,mixedcarotenoids, vitamin C, iron, and protein. The cell wall in this highquality,USDAOrganicChlorellahasbeenbrokendownto aid digestibility.

SUPPLEMENT FACTS

Serving Size: 6 Tablets Servings per Container: 33

Amt/Serving DV%*Calories 10Total Fat 0 gSodium 0 gTotal Carbohydrates < 1 g < 1%Chlorella 3,000mg †Protein 2g 4%Vitamin A 60%Vitamin C 130%Iron 35%

*PercentDailyValuesarebasedon2,000caloriediet.

†DailyValuenotestablished.

Ingredients: OrganicChlorella(BrokenCellWall)

Not manufactured with yeast, wheat, gluten, soy, milk, egg, fish, shellfish or tree

nut ingredients

Cat’s Claw 100 Veg Caps - $9.99

•Stimulatesimmunesystem•Reducesinflammation•Protectscells•Fightsfreeradicals

SUPPLEMENT FACTS

Serving Size: 2 Veg Capsules Servings per Container: 50

Amt/Serving DV%*Total Carbohydrates <1 g < 1%Cat’sClaw(Uncariatomentosa)(InnerBark) 1,000mg †

PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Cellulose(capsule)andStearicAcid(vegeta-blesource) Not manufactured with yeast, wheat, gluten, soy, milk, egg, fish, shellfish, or tree nut ingredients

Candida Cleanse 90 Veg Caps - $17.99

Candida albicans is a yeast that normally resides in the body in the digestive tract and vagina. Candida levels are kept in check by the immune system and beneficial probiotic bacteria in the body. If probiotic bacteria are killed by antibiotics or if the immune system becomes weakened, Candida yeast may grow unchecked.

LifeSource’s Candida Cleanse is a combination of herbal ingredients(PauD’Arco,BlackWalnutandOreganoOil),Biotin(aB-complexvitamin)andCaprylicAcid(anaturallyoccurringfattyacidderivedfromplantoils).Thesesynergistic ingredients help to support a healthy balance of intestinal bacteria. The beneficial bacteria that normally populate the gut assist in the digestion of food, produce certainvitaminsandpromotedetoxificationprocesses.

SUPPLEMENT FACTS

ServingSize:2VegCaps ServingsPerContainer:45

Amt/Serving DV%*Calories 10 *Calories from Fat 5Total Fat 0.5 g < 1%*Saturated Fat 0.5 g 3%Total Carbohydrate 1 g < 1%*Biotin 2 mg 667%Magnesium(fromMagnesiumCaprylate) 45mg 11%

Amt/Serving DV%*CaprylicAcid(fromMagnesiumCaprylate) 500mg †PauD’Arco(Tabebuiaimpetiginosa)(Bark) 300mg †Black Walnut(JuglansnigraL.)(Hull) 300mg †OreganoOil(Origanumvulgare)(min.1.75%Volatiles) 200mg †

*PercentDailyValuesarebasedon2,000caloriediet.+DailyValuenotestablished. Suggested Use: As a dietary supplement, take 2 Veg caps daily, preferably with meals. Free of: sugar, salt, yeast, wheat, gluten, corn, soy, milk, egg, preservatives or artificial colors Other Ingredients:Cellulose(capsule),Garlic(Alliumsativum)(Bulb),OliveLeafExtract(Oleaeuropaea),Cat’sClaw(Uncariatomentosa)(bark),Wormwood(Artemisiaabsinthium)(ArielParts),Silica,MagnesiumStearate(vegetablesource)andCellulose Powder

Cayenne 500 mg 100 Veg Caps - $9.99

Capsicum, also known as red pepper or chili pepper, is an herb. Many countries have a history of using cayenne pepper therapeutically. This powerful compound has many uses such ascleansinganddetoxifying,andcanbeusedtostimulatecirculation as well as neutralizing acidity.

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:100

Amt/Serving DV%*CayennePepper(capsicumfrutescens)(Fruit)(40,000heatunits) 500mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients:Cellulose(capsule) Not Manufactured with yeast, wheat, gluten, soy, milk, eggs, fish, shellfishortreenutingredients.ProducedinaGMPfacilitythatprocesses other ingredients containing these allergens Suggested usage: Take 1 capsule 2 to 4 times daily preferably after eating

Chitosan Advance 120 Veg Caps - $19.99

As a dietary supplement, Chitosan has been marketed for about 20 years in Europe and Japan as a “fat blocker”. Whencombinedwithasensibledietandmoderateexercise,Chitosan can work with your body to help eliminate unwanted fat. LifeSource’s Chitosan acts as a “fat blocker” by attaching to fat particles, Chitosan prevents fat from being absorbed through the intestinal tract. Instead, the fat bound to Chitosan passes safely through the body.

SUPPLEMENT FACTS

Serving Size: 3 Veg Capsules Servings per Container: 40

Amt/Serving DV%*Chromium(fromChromiumChelavite®) 300mcg 857%LipoSan ULTRA®Chitosan 1,500mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Cellulose(capsule),StearicAcid(vegetablesource)andSilica Not manufactured with wheat, gluten, soy, milk, egg, fish or tree nut ingredients

•Absorbsfat•InhibitsLDL(bad)

cholesterol•ImprovesHDL(good)

cholesterol•Promotesweightloss•Safedietaryfiber•Nocaloricvalue

•Purifyblood

•Assistinbuildingred

blood cells

•Helpwoundhealingand

tissue repair

•Internallydeodorize

•Aidincancerprevention

Page 13: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

13www.LifesourceVitamins.com I 1-800-567-8122

Chlorophyll Liquid 16 fl oz - $17.99

Chlorophyll is a unique substance found in all plant life. It is the pigment that gives plants their characteristic green color. Chlorophyll also absorbs light necessary for photosynthesis, which sustains plant life through the conversion of sunlight into chemical energy. Identified as sodium copper chlorophyllin, this water-solubleextractisderivedexclusivelyfromAlfalfathroughanaturalextractionprocess.LifeSourceVitamin’sTripleStrengthproduct delivers 94 servings - offering you a tremendous value.

•Purifyblood•Assistinbuildingredbloodcells•Helpwoundhealingandtissuerepair•Internallydeodorize

SUPPLEMENT FACTS

ServingSize:1teaspoonful,5ml ServingsPerContainer:94

Amt/Serving DV%*Calories 15 †Total Carbohydrate 3.5 g 1%*Copper(fromSodiumCopperChlorophyllin) 4mg 200%Sodium(fromSodiumCopperChlorophyllin) 6mg <1%Chlorophyll 100mg †[asSodiumCopperChlorophyllin-astanilized,water-solublefromaNaturalChlorophyllextractedfromAlfalfa(Medicagosativa)(Leaves)(USPGrade)]

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished. Other Ingredients:VegetableGlycerin,De-ionizedWater,Peppermint(Mentapiperita)Oiland PotassiumSorbate.

Choline Bitartrate 30 Capsules - $12.99

Choline Bitartrate has numerous benefits but is mostly known as abrainsupplement.PeopleuseCholineforimprovedmemoryand mental performance, but it has many other studied benefits.

SUPPLEMENT FACTS

Serving Size: 1 Capsule Servings per Container: 30

Amt/Serving DV%*CholineBitartrate 250mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Gelatin, Microcrystalline Cellulose, Magnesium Stearate Suggested usage: Take 1 capsule daily

Chromium Picolinate 100 Veg Caps - $9.99

ChromiumPicolinatemayenhanceinsulin’seffectinthebody, improving the uptake of glucose, thereby causing better blood circulation and maintenance of blood sugar levels.

SUPPLEMENT FACTS

Serving Size: 1 Veg Capsule Servings per Container: 100

Amt/Serving DV%*Chromium(fromChromiumPicolinate) 200mcg 571%

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: RiceFlourandCellulose(capsule) Not manufactured with Yeast, wheat, gluten, soy, corn, milk, egg, fish, shellfish or tree nut ingredients

LifeSource’sCholesterolSupport™isadietarysupplementspecifically formulated to support your body’s natural metabolism of cholesterol. In addition to this effective supplement, we recommend a diet low in saturated fats and regularaerobicexercise,walking,jogging,anythingaerobic.

SUPPLEMENT FACTS

ServingSize:3Tablets ServingsPerContainer:30

Amt/Serving DV%*Vitamin B6 20 mg 250%Folic Acid 400 mcg 100%Vitamin B12(ascyanocobalamin) 25mcg 417%PantothenicAcid 10mg 100%Chromium(aspolynicotinate) 200mcg 167%PlantSterols 800mg †Commiphora Mukul(GumGuggel25%Extract) 400mg †SoyBeanExtract(GlycineMax) 250mg †InositolHexanicotinate 200mg †OatBran 200mg †Phaseolamin 150mg †

Amt/Serving DV%*Cellulose(MicroCrystalline) 100mg †GarlicOdorlessExtract 100mg †Inositol 100mg †PsylliumHusk(Seed,Powdered) 100mg †Bromelain600GDU 50mg †Pantethine20% 50mg †Quercetin 30mg †ArtichokeExtract 25mg †Phosphatidylcholine 20mg †Policosanol 10mg †GrapeSeedExtract 5mg †Tocotrienols 5mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. SuggestedUsage:Take2to3TabletsDaily

Cholesterol Support90 Tablets - $19.99

180 Tablets - $34.99(SAVE $5)

Cider Vinegar Diet 180 Capsules - $13.99

AppleCiderVinegarDietcontainstheingredientsyourbody needs to help control weight and achieve that healthy, fit body you’ve always dreamed about. Chromium helps to promote sugar and fat metabolism while Glucomannan contains soluble fiber that promotes a feeling of fullness. Vitamin B6 supports energy metabolism. When used withyourdietandexerciseplan,LifeSource’sAppleCiderVinegar Dietputsyouontherighttrackinwinningtheweight loss challenge!

•Excellent,provenweightlossresults.•Apowerfulcombinationoftimetestedherbs.

SUPPLEMENT FACTS

Serving Size: 2 Capsules Servings per Container: 90

Amt/Serving DV%*VitaminB-6(PyridoxineHCI) 7mg. 412%Chromium(asAminoAcidChelate) 200mcg. 571%AppleCiderVinegar 500mg. +SoyLecithin 200mg. +Glucomannan(fromKonjacRoot) 100mg. +OrganicKelp(Laminariaspp.)(wholeplant) 20mg. +Grapefruit Fiber 30 mg.

*PercentDailyValuesarebasedon2,000caloriediet. +DailyValuenotestablished. Not manufactured with wheat, gluten, milk, egg, fish shellfish or tree nut ingredients Other Ingredients:BovineGelatin(capsule),SilicaandMagnesiumStearate(vegetable source).

Cinnamon Bark 120 Capsules - $12.99

•Digestiveaid•Supporthealthyserumlipidlevels•Potentantioxidanttosupportcardiovascularfunction

SUPPLEMENT FACTS

ServingSize:2Capsules ServingsPerContainer:60

Amt/Serving DV%*Calories 5Total Carbohydrate <1 g <1%*Cinnamon(Cinnamonumverum)(Bark) 1,000mg †(Ceylon)(TrueCinnamon)

*Dailyvaluebasedona2,000caloriediet.†Dailyvalue not established Other Ingredients: Gelatin(capsule),Silica,StearicAcidandMagnesium Stearate.

Page 14: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

14 www.LifesourceVitamins.com I 1-800-567-8122

Cod Liver Oil 100 Softgels - $9.99Cod Liver Oil is well-known for its naturally occurring Omega-3FattyAcids,EPAandDHAandhasalonghistoryor traditional use for the support of overall health and well-being.OurCodLiverOilisalsorichinVitaminAand D-3

SUPPLEMENT FACTSServingSize:1Softgel ServingsPerContainer:100

Amt/Serving DV%*Calories 5Calories from Fat 5Total Fat 0.5 g <1%Cholesterol 0 mg 0%VitaminA(fromCodLiverOiland RetinylPalmitate) 2,500IU 50%VitaminD3(fromCodLiverOiland Cholecalciferol) 270IU 68%CodLiverOil650mg†Typical Values of Omega-3 Fatty Acids:ElcosapentaenoicAcid(EPA) 30mg †DocosahexaenoicAcid(DHA) 30mg †

PercentDailyValuesarebasedon2,000caloriediet.†Dailyvaluenotestablished. Other Ingredients: SoftgelCapsule(gelatin,glycerin,water) Not manufactured with wheat, gluten, soy, milk, egg or shellfish ingredients. Containsfish(cod).CodLiverOilisaproductofNorway

Coconut Oil Softgels 60 Softgels - $12.99

Coconut Oil is a source of lauric acid, a medium chain triglyceride(MCT)thatpossesseshealthbenefits.Inthebody, lauric acid is converted into monolaurin, a compound that supports the body’s defenses. Coconut Oil Softgels are an easy and convenient means to consume this unique fatty acid. May support healthy triglyceride levels, brain health, and promote satiety.

SUPPLEMENT FACTS

Serving Size: 1 Softgel Servings per Container: 60

Amt/Serving DV%*OrganicVirginCoconutOil 1,000mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Capsule(modifiedcornstarch,glycerin,Irishmossextract,waterContainsNoartificialcolors,flavors,orpreservatives;nowheat,gluten,milk,eggs,peanuts,soy,crustaceanshellfishorfish.Vegetarian/VeganProduct

=LifeSourceProprietaryBlend

Coconut Oil (USDAOrganic) 12 oz. – $10.99

Use it for cooking and baking in place of less healthy cooking oils or add it to your favorite smoothie. Use it as a spread on your favorite breads and muffins or add a subtle hint of tropical sweetness to your popcorn.

Organic Virgin Coconut Oil Cold Pressed and Unrefined - 12 oz.

NUTRITIONAL FACTS

ServingSize:1Tbsp(15mL) ServingsPerContainer:24

Amt/Serving DV%*Calories 120Calories from Fat 120Total Fat 14 g 22 %Saturated Fat 12 g 60 %Trans Fat 0 gPolyunsaturatedFat <0.5gMonounsaturated Fat 1 g

*DailyValueNotEstablished. Ingredients: Organic Virgin Coconut Oil

CLA ConjugatedLinoleicAcid 90 Softgels - $19.99

Anaturalsourceofconjugatedlinoleicacid,showntoreduce fat and increase lean muscle mass

SUPPLEMENT FACTS

ServingSize:3Softgels ServingsPerContainer:30

Amt/Serving DV%*Calories 25 †CaloriesfromFat 25 †Total Fat 3 g 5%*Saturated Fat 0 g 0%*TransFat 0g †PolyunsaturatedFat 3g †Non-GMOSafflowerOil 3.0g(3,000mg) †ConjugatedLinoleicAcid(CLA) 2.4g(2,400mg) †

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished Not manufactured with yeast, wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients.ProducedinaGMPfacilitytheprocessesotheringredientscontainingthese allergens. Other Ingredients: SoftgetCapsule(gelatin,glycerin,water,naturalcolor).

Collagen Liquid (EnzymeHydrolyzedCollagen)

16 fl oz / 30 Day Supply - $44.99 PER BOTTLE

3 Bottles for $114.99 (SAVE $20)

Anincrediblemulti-functionliquidthathelpsrejuvenateandmaintains tendons, ligaments, skin, hair, nails, bones, teeth, en-ergy, blood vessels, arteries and probably most widely known for weight/fatloss!Collagenistheprimaryconnectivetissueproteinin your body. The word Collagen is derived from kolla, the Greek word for glue. As we age, every year we lose 1% of our collagen content, collagen we need to keep us looking young as well as keeping us healthy and strong. Collagen is the most abundant protein found in our body. LifeSource’s Collagen does not contain aloe vera, as other brands do, due to the fact that ours is Enzy-matically hydrolyzed. It does not need the acid to hydrolyze, as other brands do. Ours is all natural, and results driven.

NUTRITION FACTS

Serving Size: 1 Tablespoon Servings per Container: 30

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Ingredients: EnzymeHydrolyzedConcentratedPureBovineCollagenProtein,PurifiedWater,Fructose,CitricAcid,Glycerin,NaturalOrangeFlavor,PhosphoricAcid,SodiumBenzoateandPotassiumSorbate(topreservefreshness),SteviaRebaudianaLeafExtract

Amt/Serving DV%*Calories 36Total Fat 0Cholesterol 0Total Carbohydrate 3 g 1%Protein 8g 16%L-Citrulline 500mg †EachTablespoon(15ml)contains8gramsofEnzymeHydrolyzedBovineCollagenProtein

Amino Acid Composition of LifeSourceCollagen™:L-Alanine 1667mg †L-Arginine 1333mg †L-AsparticAcid 1045mg †L-Cystine 10mg †

Amt/Serving DV%*L-GlutamicAcid 1727mg †Glycine 4167mg †L-Histidine 118mg †L-Hydroxylysine 181mg †L-Hydroxyproline 2197mg †L-Isoleucine 272mg †L-Lysine 697mg †L-Methionine 136mg †L-Phenylalanine 379mg †L-Proline 2477mg †L-Serine 636mg †L-Threonine 300mg †L-Tyrosine 152mg †L-Valine 515mg †

ContainsBromelainandPapain,Enzymesthatbreakdownaminoacids and help stimulate growth of collagen in the body.

SUPPLEMENT FACTSServingSize:2Tablets ServingsPerContainer:45

Amt/Serving DV%*Collagen 1000mg. †SilicaComplex 100mg. †Papain 50mg. †Bromelain 50mg. †

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished. Suggested usage: Take 2 tablets 3 times daily.

Collagen Tablets90 Tablets - $19.99

180 Tablets - $34.99(SAVE $5)

Page 15: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

15www.LifesourceVitamins.com I 1-800-567-8122

Collagen Peptides Powder

•FromGrass-FedBeef•Helpssupportnormaljointfunction,fightsagainstarthritis.•Preservesleanbodymassfopeopletryingtoloseweight

& build mass. Supports cartilage, tendons, musles, bones, teethandjointhealth.

•Helpsreducetheappearance&causesofwrinkles.•Promotesbettersleeping.•Providesproteinenergy,whichisutilizedandnotstored

as fat.•Thehighestbioavailabilityofanycollagenonthemarket.•Overalltoningforbodybuildersandweightlossindividuals.•Promotesagreatersenseofwellness.•Immediateimprovementsinskin,hairandnailtexture

and appearance.•Helpslessensnackcravings.•Studieshaveshowntohelpslowtheagingprocess.•Providesincreasedstamina,andturnsupyourmetabolism•Supportsrapidmusclerepairandmusclegrowth

enhancement naturally for weight loss and building muscle. Crucial for body builders and anyone trying to lose weight.

SUPPLEMENT FACTS

ServingSize:10Grams(1heapingscoop) ServingsperContainer:about45

Amt/Serving DV%*Calories 35Total Fat 0 g 0%Total Carbohydrates 0 g 0%Protein 9g 18%CollagenPeptideComplex(fromHydrolyzedCollagenTypeI&III)(bovine) 10g †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Suggested usage: 1 serving daily to supplement the diet with protein

1 LB. - $39.993 Pack Special for $99.99 (SAVE $20)

Collagen Cream 4 oz. - $12.99

•BoostingNaturalCollagenProduction•DelaySignsOfAging•RejuvenateDullLifelessSkin•ProvidesSolubleCollagen,ElastinProteinHydrolysate

and Vitamin E

Colloidal Minerals (liquid) 32 oz. - $19.99

Why are we eating more, yet consuming less? It’s not asecret our soils have been depleted of essential, trace andrare minerals so vital to health and life. Eighty years ago in1936theUnitedStatesDepartmentofAgricultureissuedU.S.SenateDocument264,stating“thatvirtuallyallsoilsin the United States were mineral deficient. Scientists atthe 1992 Earth Summit in Brazil submitted documentationthat soils world-wide were depleted of minerals. TheUnited States soils rated as one of the most serious with85%ofessentialmineralsdepleted.Mineralsmakeupfourpercent of the body’s total weight. They’re found in bodyfluidsandtissuesworkinginconjunctionwithvitamins,enzymes, hormones, and other substances. Minerals playan important role in numerous biological functions.

SUPPLEMENT FACTS

ServingSize:2Tablespoons/1fl.oz. ServingsPerContainer:32

Amt/Serving DV%*Calories 10Total Carbohydrate 2 g <1%*Sugars 2g †LiquidColloidalMinerals 30ml* †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished. Other Ingredients: PurifiedWater,Fructose,CitricAcid,NaturalRaspberryFlavors,FulvicAcid,NaturalVegetableExtract,PotassiumSorbate(aspreservative),PotassiumBenzoate(aspreservative)andSteviaExtract(Leaf).Notmanufacturedwithyeast,wheat,gluten,soy,milk,egg,fish,shellfishortreenutingredients.ProducedinaGMPfacilitythatprocessesother ingredients containing these allergens.

Colon Cleanse 180 Capsules - $15.99

Cleansing,alsocalleddetoxification,isourbody’snormalprocess of elimination through our colon, liver, kidney,lungs, lymph and skin. An effective colon cleanse canoften result in:•Increasedenergylevelandafeelingofimprovedhealth•Healthierbowelmovements(eliminatesconstipationproblems,andpreventsdiseaseofthecolon)

•Weightloss•Improvedlookandstrengthofhair,skin,andnails•Eliminationoffattywastes,mucus,andothertoxicbuildups•Decreasedcholesterol

SUPPLEMENT FACTS

Serving Size: 2 Capsules Servings per Container: 90

Amt/Serving DV%*Calories 5Total Carbohydrates 1.2 g < 1%DietaryFiber 1g 4%SolubleFiber .9g †

Amt/Serving DV%*InsolubleFiber .1g †PsylliumHuskPowder(Husk/Seed) 1,400mg †ApplePectinPowder 100mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Gelatin(capsule),MagnesiumStearate(vegetablesource),StearicAcid(vegetablesource)andSilica Not manufactured with yeast, wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients. Non-GMO

Congest-Eeze 60 Liquid Capsules - $26.99

Congest Eeze is a great respiratory remedy for acute colds, flu, sinus infections, asthma, bronchitis, pneumonia, smokers’lung,Pneumocystis,andgenerallungcongestion.It is very similar our1 fl. oz. liquid formula Respir-Ease butadds Oregano Oil to increase antimicrobial action. It is apowerfullungmacrophage(whitebloodcell)stimulantto help the lung powerfully address viral and bacterial conditions. It helps clear the lungs of congestion in order to resolvelingeringmucusthatwantstobeexpelled.

SUPPLEMENT FACTS

Serving Size: 1 Liquid Capsule Servings per Container: 60

Amt/Serving DV%*FreshOshaRoot,FreshYerbaSantaLeaf,GarlicBulb(Organic),MulleinLeaf, ThymeHerb(Organic),LicoriceRoot(Organic),OregonGrapeRoot, EchinaceapurpureaFloweringTops(Organic),LomatiumRoot, WildCherryBark,GingerRoot(Organic),OreganoOil 700mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Non-GMO Soy Lecithin, Modified Vegetable Cellulose, Medium Chain Triglycerides

NEW

DRIVEN BY FAITH-POWERED

BY GODBRACELETS AVAILABLE

IN VARIOUS COLORS AND SIzES

Page 16: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

16 www.LifesourceVitamins.com I 1-800-567-8122

Ubiquinol 50 mg 60 Softgels - $29.99

Ubiquinone is converted within our body into Ubiquinol, the potentanti-oxidantportionofCoQ10.However,asweage,our ability to make this conversion reduces significantly. Ubiquinol is already in its reduced form as a potent anti-oxidant.Ubiquinolinhibitsproteinandlipidoxidationincellmembranes,andhelpstominimizeoxidativeinjurytoDNA.ThereiseveryindicationthattheUbiquinoneformhasbenefits other than those of Ubiquinol. To take full advantage of the benefits of CoQ10, the dosage should include both forms and then according to age as to which one you take the most. Also, as demonstrated, Ubiquinol does not require the high amount needed by Ubiquinone to gain the same therapeutic effect for certain conditions.

SUPPLEMENT FACTS

ServingSize:1Softgel ServingsPerContainer:60

Amt/Serving DV%*Ubiquinol(KanekaQH™)(ReducedFormCoQ10) 50mg †

Cortisol Support 90 Veg Caps - $24.99

Cortisol is nicknamed the “stress hormone” for its role in the fight or flight response, a physiological mechanism that releases hormones like adrenalin and cortisol to prioritize important body functions under stressful circumstances. Combats Adrenal Fatigue – Allows Adrenals time to Rest and Reset.

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:90

Amt/Serving DV%*VitaminC(fromCalciumAscorbate) 33mg 37%PantothenicAcid(fromCalciumPantothenate) 10mg 200%Calcium(fromCalciumCarbonateandAscorbate) 12mg 1%Magnesium(fromMagnesiumOxide) 8mg 2%Chromium(fromChromiumChelavite®AAC) 20mcg 57%Relora®(aproprietaryblendofapatentedextractfromMagnoliaofficinalisbarkandaproprietaryextractfromPhellodendronamurensebark) 200mg †GreenTeaExtract(Camelliasinensis)(Leaf)(min.50%EGCg) 90mg †AshwagandhaExtract(Withaniasomnifera)(Root) 20mg †HolyBasilExtract(Ocimumtenuiflorum)(Leaf) 20mg †ReishiMushroomPowder(Ganodermalucidum) 20mg †RhodiolaExtract(Rhodiolarosea)(Root) 20mg †BanabaExtract(Lagerstroemiaspeciose)(Leaf) 4mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Cellulose(capsule),MagnesiumStearate(vegetablesource)andsilicia Not manufactured with wheat, gluten, milk, egg, fish. Shellfish or tree nut ingredients

Cranberry Concentrate 100 Capsules - $14.99

Cranberries are packed with polyphenols, tannins, andother phytonutrients that have been researched for theirrole in urinary tract health. Our Cranberry Caps are alsorich in Vitamin C.

SUPPLEMENT FACTS

ServingSize:2Capsules ServingsPerContainer:50

Amt/Serving DV%*Calories 5Total Carbohydrate 1.1 g <1%*DietaryFiber 560mg 2%*Sugars 630mg †VitaminC(asAscorbicAcid) 20mg 33%CranberryConcentrate(fruit) 1.4g † (1400mgof8:1Concentrate)

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished. Not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients.

CoQ10 100 mg softgels 50 Softgels- $31.99

SUPPLEMENT FACTS

ServingSize:1Softgel ServingsPerContainer:50

Amt/Serving DV%*VitaminE(fromMixedTocopherols)(soyfree) 30IU 100%CoenzymeQ10 100mg †

*PercentDailyValuesarebasedon2,000caloriediet. +DailyValuenotestablished. Other Ingredients: Softgelcapsule(bovinegelatin,water,glycerin,organiccaramelcolor),OrganicExtraVirginOliveOil,Sunflower Lecithin and Silica Not manufactured with wheat, gluten, soy, corn, milk, egg, fish or shellfish ingredients. Non-GMO

CoQ10 400 mg softgels 30 Softgels - $39.99

SUPPLEMENT FACTS

ServingSize:1Softgel ServingsPerContainer:30

Amt/Serving DV%*Calories 7Calories from Fat 5Total Fat 0.5 g <1%*TransFat 0g †Vitamin E 30IU 100%(asd-alphaTocopherol)CoenzymeQ10(CoQ10) 400mg †SoyLecithin 35mg †

*Dailyvaluesarebasedon2,000caloriediet. †Dailyvaluenotestablished.

CoQ10 50 mg 100 Softgels - $25.99

CoenzymeQ10(CoQ10)isavitamin-likecompoundthatplays a central role in cellular energy production. CoQ10 is found throughout the body, but is especially concentrated in the heart, liver and kidney and production has been found to decline with age. CoQ10 works with Vitamin E as a potent free radical scavenger in cell membranes, as well as within blood vessels. Years of scientific research have shown that CoQ10 helps to maintain a healthy heart and vascular system.NUTRITION FACTS

ServingSize:1Softgel ServingsPerContainer:100 Amt/Serving DV%*VitaminE(fromd-alphaTocopherol) 30IU 100%Selenium(fromL-Selenomethionine) 70mcg 100%CoenzymeQ10 50mg †

*PercentDailyValuesarebasedon2,000caloriediet.+DailyValuenot established. Other Ingredients: Rice Bran Oil, Softgel Capsule (gelatin,glycerin,water,carob),BeeswaxandSoyLecithinNotmanufactured with wheat, gluten, milk, egg, fish or shellfish ingredients

For anyone who has had a UTI, you know how tough it is!CranberriesandD-Mannoseareloadedwithsomanybeneficial compounds directly related to Urinary Track and overallhealth.D-Mannose,asugarknowntomaintainUThealthandsupporturinarytract(UT)healthaltogether,andcranberry, an ingredient that supports the UT lining in your Urinary Tract.

SUPPLEMENT FACTS

Serving Size: 2 Veggie Caps Servings per Container: 30

Cranberry & D-Mannose 60 Veg Caps - $19.99

Amt/Serving DV%*Calories 7 Total Carbohydrates 2 g Sugars 1 g VitaminC(asAscorbicAcid) 30mg. 50%D-Mannose 1000mg †CranberryFruit37:1(min.4%Proanthocyanidins) 400mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Modified Vegetable Cellulose

NEW

Page 17: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

17www.LifesourceVitamins.com I 1-800-567-8122

Curcumin Extract 60 Veg Capsules - $23.99120 Veg Capsules - $41.99

(SAVE $6)

LifeSourceVitaminsCurcuminExtractisthemajorcomponent of Turmeric, shown to help with arthritis, heartburn, stomach pain, diarrhea, intestinal gas, liver problems, and gallbladder disorders. It can also be used for headaches and colds. A potent yet safe anti-inflammatory

Preventandreverse:•InhibitsInflammation•BrainandImmuneSystemHealth•Digestive,JointandPancreaticHealth•AntioxidantSupport

SUPPLEMENT FACTSServingSize:1VegCapsule ServingsPerContainer:60 Amt/Serving DV%*TumericRootExtract 665mg *(Curcumalonga)(StandardizedtoMin.95.0%Curcuminoids(630mg)(containingCurcumin,DemethoxycurcuminandBisdemethoxycurcumin)}DemethoxycurcuminandBisdemethoxycurcumin)

*PercentDailyValuesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Free of: yeast, wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients. Other Ingredients:Cellulose(capsule),SilicaandMagnesiumStearate(vegetablesource)

Vitamin D-3 1,000 IU 180 Softgels - $9.99

OurVitaminD-3softgelssupplythiskeyvitamininahighlyab-sorbableliquidsoftgelform.VitaminDisnormallyobtainedfromthe diet or produced by the skin from the ultraviolet energy of the sun. However, it is not abundant in food. As more people avoid sunexposure,vitaminDsupplementationbecomesevenmorenecessary to ensure that your body receives an adequate supply.

SUPPLEMENT FACTS

ServingSize:1Softgel ServingsPerContainer:180

Amt/Serving DV%*VitaminD-3(asCholecalciferol) 1,000IU †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvalue not established.

Vitamin D-35000 IU Softgels

120 Softgels - $12.99240 Softgels - $21.99

(SAVE $4)

OurVitaminD-3maintainshealthycalciumandphosphoruslevelsinthebodyforstrongbones;itincreasesmusclestrengthinolderadults;anditalsoplaysanactiveroleinahealthyimmuneresponse.VitaminD-3(cholecalciferol)istheoptimalformofvitaminD.ItistheformofvitaminDthatthebody manufactures in sunlight, and the form most efficient for the body’s needs.

•MaintainsBoneHealth•DecreasesriskofColon&ColorectalCancer•EnhancesImmunity•DecreasespainassociatedwithFibromyalgia•ReducesriskofBreastCancer

SUPPLEMENT FACTS

ServingSize:1SoftgelCapsule ServingsPerContainer:120

Amt/Serving DV%*VitaminD-3 5,000IU 1250%(asCholecalciferol)

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished. Other Ingredients:Softgel(gelatin,glycerinandwater),virginoliveoil.

CreatineMonohydrate Powder

100%Pure–PharmaceuticalGrade.5GramsofCreatinePerServing! Overall, researchers have found that Creatine will providethefollowingbenefits:Enhancedmusclemass/strength,promotegreatergainsinincreasingFFM(FatFreeMass,whichincludesmusclemass),increasedmuscleproteinsynthesis,increased muscle energy availability, increased power output (moresets/reps),enhancedrecoveryafterexercise,increasesmuscle fiber size, increases myosin, improves single-effort sprint performance and anything to do with performance for athletes.

8.8 oz - $12.99

Liquid Vitamin D-3 1,000 IU 1 fl. oz. - $13.99

•Maintainsbonehealth•Enhancesimmunity•Decreasesriskofbreast,colon&colorectolcancer•Eachdropis1000IU’s.Youcontrolthedose• 925 Servings Per bottle

SUPPLEMENT FACTS

ServingSize:1Drop ServingsPerContainer:925

Amt/Serving DV%*VitaminD3(Cholecalciferol) 1,000IU 250%

*Dailyvaluesarebasedon2,000caloriediet.

†Dailyvaluenotestablished.

Other ingredients:glycerin,water,hydroxylecithin.

Vitamin D3 Gummies 90 Gummies - $14.99

If you can’t get enough sunlight, or if you are worried about exposingyourskin,thenLifeSourceVitaminD3Gummiesarea great way to get this critical nutrient. You can’t get enough D3inyourdiet,sotakingaD3supplementhelpsyourbodymaintain proper bone structure. Many people are deficient in VitaminD3.Our2,000IUGummiescanhelpenhanceyourimmunity and maintain strong bones and healthy teeth.

SUPPLEMENT FACTS

Serving Size: 2 Gummies Servings per Container: 45

Amt/Serving DV%*Calories 15Total Carbohydrate 4 g 1%Sugars 3g †VitaminD3(ascholecalciferol) 2,000IU 500%Sodium 10 mg <1%

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Glucose syrup, sugar, water, pectin, citric acid, sodium citrate, natural flavors,naturalcolor(annattoandelderberryjuice),coconutoilandcamaubawax Allergen Warning:ContainsTreeNuts(CoconutOil)

HAVE QUESTIONS?IT CAN BE OVERWHELMING

WE KNOW. CALL US, WE WILL WALK YOU THROUGH

WHAT SUPPLEMENTS WILL TRULY HELP YOU AND WHICH

ONES YOU REALLY DON’T NEED. IT’S WHAT WE DO!

800.567.8122

Page 18: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

18 www.LifesourceVitamins.com I 1-800-567-8122

Deer Antler Sprayw/IGF-1

LifeSourceVitaminsDeerAntlerIGF-1isasafeandeffectiveoral supplement for increasing the body’s levels of IGF-1 naturally. For centuries, ancient Chinese medicine used the power of deer antler velvet to improve vitality and overall function. Unbeknownst to them, the deer antler velvet they were taking was loaded with IGF-1 and other important nutrients. In recent studies, deer antler velvet has been found tobearichsourceofinsulinlikegrowthfactors(IGF-1).BytakingourDeerAntlerIGF-1,youareincreasingyourbody’slevels of IGF-1 slowly and naturally, not bombarding your system,resultinginimprovedmusclerepair,betterjointhealth and overall well-being. As an athlete, this means quicker recovery from the intensive training sessions, less jointpainandastrengthenedimmunesystemandsomuchmore. Several studies have shown when taken over time:

•IncreaseLeanMuscleMass•ReduceBodyFat%withIncreasedMetabolism•ImprovesMuscleRecoveryafterIntenseTraining•BoostEnduranceThreshold•IncreaseEnergy,Vitality&StaminaLevels•IncreaseProteinSynthesis•IncreasesAthleticPerformanceandStrength•ImprovesAerobicCapacities•IncreasesImmuneSystem•ImprovesTissueRegenerationforHealthierJoints•EnhancesSexualDriveandFunction

SUPPLEMENT FACTS

ServingSize:3Sprays ServingsperContainer:Approx.60

Amt/Serving DV%*Niacin 20 mg 100%ProprietaryBlend 200mg †DeerAntlerVelvetExtract,L-Arginine,Epimedium(HorneyGoatWeed),Tribulus,EurycomaLongifolia(TongkatAli)

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: PurifiedWater,Natural&ArtificialFlavors,Xylitol,CitricAcid,Stevia, PotassiumSorbate(aspreservative) Suggested usage: Spray three times under tongue twice daily 20 minutes before a meal

2 fl. oz - $29.99 / 3 for $74.97

(SAVE $15)

Diet & Energy 90 Capsules - $14.99

MetabolicDietandAdrenalSupportLifeSource’sDiet&Energyisanallnaturalweightlosssupplement that is safe to use with no long term sideeffects.LifeSourceVitamin’sDiet/Energycombinesacomprehensive array of nutrients and dietary ingredientsthat provide your body with a natural source of energy.ThisformuladoesnotcontainEphedra(MaHuang).Instead, we use ingredients such as Guarana and GreenTea to provide a natural source of caffeine and BitterOrange to support thermogenic processes in the body.

SUPPLEMENT FACTSServing Size: 2 Capsules Servings per Container: 45

Amt/Serving DV%*VitaminE(d-alphaTocopherolsSuccinate) 15IU 50%VitaminB1(fromThiamineHCI) 10mg 670%VitaminB2(Riboflavin) 10mg 590%VitaminB3(Niacin) 25mg 125%VitaminB5(fromCalciumPantothenate) 10mg 100%VitaminB6(fromPyridoxineHCI) 10mg 500%VitaminB12(fromCyanocobalamin) 100mcg 1670%Iodine(fromKelp) 225mcg 150%Chromium(asChromiumChelavite) 200mcg 166%Potassium(fromPotassiumAspartate) 55mg 2%Guarana(seedextract) 280mg *GreenTeaExtract(LeafExtract) 200mg *BitterOrangeExtract 180mg *Eleuthero(SiberianGinsengRoot) 150mg *PanaxGinseng(Root) 150mg *Gotu-Kola(WholePlant) 100mg *Licorice(Root) 100mg *Cayenne(Fruit) 50mg *Alpha Lipoic Acid 25 mg *CoQ10 10 mg *Octacosanol(fromSpinach) 30mcg *

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

D-Mannose 120 Veg Caps - $24.99

Clinical studies have demonstrated that when taken regularity, D-Mannosecanhelptomaintainahealthyurinarytract.BecauseinsubstantialamountsofD-Mannoseareusedbythebody, it does not interfere with healthy blood sugar regulation.

SUPPLEMENT FACTS

Serving Size: 3 Veg Capsules Servings per Container: 40

Amt/Serving DV%*Calories 5Total Carbohydrates 1.5 g <1%Sugars 1.5g †D-Mannose 1,500mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValue not established. Other Ingredients: Cellulose(capsule),RiceFlour,StearicAcid(vegetablesource),MagnesiumStearate(vegetablesource)andSilica. Non-GMO Not manufactured with yeast, wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients.

VArIETy Of COlOrS ANd SIzES TO CHOOSE frOm.20 oz: $7.49 • 28 oz: $7.99

Page 19: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

19www.LifesourceVitamins.com I 1-800-567-8122

Elderberry Syrup 4 fl oz - $17.99

Elderberry has been reported to have beneficial

effects when used with antibiotics to treat sinus

infection. The elder flowers are classically used for colds,

flu, and to reduce high fever, as they contain strong

diaphoretic and cooling activity.

SUPPLEMENT FACTS

ServingSize:2Teaspoons(10ml)

Servings per Container: 12

Amt/Serving DV%*

Calories 30

Total Carbohydrates 6 g 2%

ElderberryFruit(Organic) 6,400mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Vegetable glycerin, deionized water Contains no salt, wheat, gluten, yeast, corn, soy, preservatives, artificial colors or flavors, glucose or fructose Suggested usage: Adults: Take 2 Teaspoons once daily

Children: Take 1 Teaspoon once daily

Vitamin E-400100 Softgels - $11.99

200 Softgels - $20.99(SAVE $3)

Vitamin E is key for strong immunity and healthy skin and eyes. Benefits include balancing cholesterol, fighting free radicals, preventing disease development, repairing damaged skin and much more.

SUPPLEMENT FACTS

ServingSize:1Softgels ServingsPerContainer:100

Amt/Serving DV%*Vitamin E 400 IU 500%

(d-alphatocopherol,plusbeta,delta,andgammatocopherols)

Dong Quai 90 Veg Caps - $13.99

DongQuaiisafamousChineseherbusedformanymenstrual irregularities. It is used in menopause to lessen the negative symptoms of hot flashes, mood swings, and irritability.Itisalsousedinpremenstrual(PMS)disordersto decrease the discomfort of cramps, slow onset, dull ache, mood swings, bloating and irritability.

SUPPLEMENT FACTS

Serving Size: 2 Capsules Servings per Container: 45

Amt/Serving DV%*OrganicDongQuaiRoot(Angelicasinensis 1,000mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Modified Vegetable Cellulose

NEW

Echinacea & Goldenseal is an acute formula, to be used when either one feels like they are about to come down withacold/flu(takeeverycoupleofhours),orifcold/flusymptomsarealreadypresent(takeatleast3timesperdayuntilsymptomssubside).

Echinaceastimulatesinnateimmunityandexcitesphago-cytosis of the white blood cells in general circulation while Goldenseal and Yerba Mansa stimulate immunity in the respiratory tract to act more vigorously. It will help keep control over undesirable microorganisms.

SUPPLEMENT FACTS

Serving Size: 1 Liquid Capsules Servings per Container: 60

Echinacea- Goldenseal 60 Liquid Capsules - $25.99

Amt/Serving DV%*EchinaceapurpureaHerb(Organic),GoldensealRoot(Organic),EchinaceaangustifoliaRoot(Organic),OregonGrapeRoot,FreshYerbaMansaRoot(Organic),MyrrhGum,Fresh WildIndigoRoot 1,000mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Non-GMO Soy Lecithin, Medium Chain Triglycerides, Modified Vegetable Cellulose

NEW

Elderberry Plus 90 Veg Caps - $17.99

ElderberryPlusisauniqueformulathatcombinesbothElderberry and Elderflower with Umckaloabo Root. It helps strengthen the immune system and provides immediate andeffectiveimmunesupport.ElderberryPluscanbeusedas a preventative to increase resistance to illness and help rebuild a strong immune response or it can be taken when already ill to reduce symptoms and shorten the duration of the illness.

SUPPLEMENT FACTS

Serving Size: 2 Capsules Servings per Container: 45

Amt/Serving DV%*OrganicElderberryFruit 750mg †WildcraftedElderberryFlower 100mg †SelectivelyImportedPelargonium sidoidesRoot(Umckaloabo) 100mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Modified Vegetable Cellulose

NEW

Echinacea 1,000 mg 100 Capsules - $8.99

Echinacea herbal medicines are traditionally used for treatment of inflammatory and viral diseases such as cold, cough and upper respiratory infections. Recent studies show that they can also beusedasantioxidantsorfreeradicalterminatorstopreventcardiovascular disease, arthritis and aging.

SUPPLEMENT FACTS

Serving Size: 2 Capsules Servings per Container: 50

Amt/Serving DV%*Echinacea(Echinaceaangustifolia) 1,000mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished.

•OneoftheMostEffectiveHerbsfortheFlu•PowerfulAntioxidant•CanReduceOxidationofLDLCholesterol,aContributingFactorofHeartDisease

•IncludesVitaminC&ZincforCompleteImmuneSupport

SUPPLEMENT FACTS

Serving Size: 2 Gummies Servings per Container: 45 Amt/Serving DV%*Calories 15 Total Carbohydrates 4 g Sugars 3 g VitaminC(ascorbicacid) 90mg 150%Zinc(citrate) 7.5mg 50%Sodium 25 mg 1%ElderberryFruit(Sambucusnigra) 100mg †

Elderberry Plus Gummies 90 Gummies - $16.99

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Organic tapioca syrup, raw cane sugar, water, pectin, sodium citrate, naturalflavors,citricacid,coconutoilandcarnaubawax

NEW

Page 20: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

20 www.LifesourceVitamins.com I 1-800-567-8122

Electrolyte Balance 100 Veg Capsules - $13.99

LifeSource Vitamins Electrolyte Formula is loaded with nutrientsdesigned for a perfect balance of 6 electrolytes plus support mineralsandBioPerine®(blackpepperfruitextract)thatworktogether to provide complete hydration without worrying about having an upset stomach that you find with powders, so you can feel and perform your best in life.

SUPPLEMENT FACTS

Serving Size: 1 Vegetable Capsule Servings per Container: 100

Amt/Serving DV%*VitaminD(cholecalciferol) 400IU 100%Calcium(carbonate) 25mg 3%Phosphorous(sodiumphosphate) 37mg 4%Magnesium(oxide) 50mg 13%Chloride(sodium/potassiumchloride) 271mg 8%Sodium(sodiumchloride/phosphate) 202mg 8%Potassium(chloride) 99mg 3%Boron(aminoate) 500mcg †BioPerrine®(blackpepperfruitextract)5mg

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Vegetable cellulose, vegetable magnesium stearate, and rice flour

Super DigestiveEnzymes

90 Capsules - $16.99180 Capsules - $30.99

(SAVE $3)

It is estimated that more than 100 million people in America are affected by some form of digestive disease. That’s more than half of the U.S. population! LifeSource’s Super Enzyme formula, based on its high potency and complete profile, has quickly become a favorite among our customers. Scientificallyengineeredwithanextensiveblendofessentialenzymes, papain, pancreatin, bromelain and more, this is a highly effective product that can greatly assist in the digestion of foods.

SUPPLEMENT FACTS

Serving Size: 1 Capsule Servings per Container: 90

Amt/Serving DV%*Calcium(fromCalciumCarbonate)36mg 3%BetaineHCI 200mg †OxBileExtract(Min.45%TotalChoicAcids) 100mg †PapayaFruitPowder 45mg †EnzymeBlend 200mg †Pancreatin 10X Supplying: †Amylase 37,000USPUnits †

Amt/Serving DV%*

Protease 37,000USPUnits †

Lipase 2,960USPUnits †

Bromelain(fromPineapple) 120GDU †

Papain(fromPapaya) 100,000PU †

Cellulase 10CU †

AcidStableProtease

(Aspergillopepsin) 50SAPU †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Gelatin(capsule),Microcrystalline,Cellulose,MagnesiumStearate(vegetablesource)andSiliconDioxide.Containssulfites. Not manufactured with wheat, gluten, soy, milk, eggs, fish, shellfish or tree nut ingredients

Kids & TeensChewable Enzymes

•Broadspectrumdigestiveenzymeformulation•Naturalberry-flavored•Supportsoptimaldigestionofmeals•ShowntobeactivethroughouttheentirepHrangeofthe

digestive system•Notdegradedbytheacidinthestomach•GreatforKids,Teens,orAdults!

SUPPLEMENT FACTS

Serving Size: 2 Chewables Servings per Container: 45

90 Chewables - $19.99

Amt/Serving DV%*Total Carbohydrates 1 g < 1%Sugars <1g †BioCore Kids® Vegetarian Enzymes 144mg †Amylase(from AspergillusOryzae) 3,500DU †Protease(from AspergillusOryzae) 21,000HUT †Protease(from AspergillusOryzae) 4,000PC †Lactase(fromAspergillus Oryzae) 1,000ALU †

Amt/Serving DV%*Glucoamylase(from Aspergillusniger) 5AGU †Protease(fromAspergillus niger) 50SAPU †Invertase(fromSaccharomycescerevisiae) 400SU †Lipase(fromCanadarugosa,AspergillusnigerandRhizopusOryzae) 500FIP †Diastase(fromAspergillus Oryzae) 1,500DP †Protease(fromAspergillus Oryzae) 2AP †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Fructose,NaturalFlavors,RiceMaltodextrin,CitricAcid,MagnesiumStearate(vegetablesource)andBeetPowder Not manufactured with wheat, soy, milk, egg, fish, shellfish or tree nut ingredients

Advanced PapayaEnzymes

Healthy digestion allows our bodies to receive nutrients from food. Enzymes support the breakdown of food, making nutrients more bioavailable to our bodies. This product contains 100% natural plant enzymes, making it an ideal supplement for both vegetarians and non-vegetarians alike. BytakingourAdvancedPapayaEnzyme,youwillsupportyour body’s natural ability to utilize carbohydrates and proteins from food.

SUPPLEMENT FACTS

Serving Size: 2 Tablets Servings per Container: 45

Amt/Serving DV%*Calories 5Total Carbohydrates 1 g <1%Sugars 1 gPapain 200mg †NaturalPapaya 10mg †Bromelain 10mg †PlantEnzymeBlend(supplyingamylase,protease,lipase) 10mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Fructose,Sorbitol,StearicAcid(vegetablesource),CalciumStearate(vegetablesource),NaturalTropicalFruitFlavor,CitricAcid,Silica,BeetRootFiber Contains noartificialcolors,flavorsorpreservatives;nowheat,gluten,milk,eggs,peanuts,tree nuts, soy, crustacean shellfish or fish

90 Chewable Tablets - $8.99

Esiak 750 mg 120 Capsules - $16.99

•Cleansethebloodandnormalizeenzymes•Nourishesandstimulatesthebrainandnervoussystem•Expelmucusclearingthelungs•Enhanceimmunesystem

SUPPLEMENT FACTS

Serving Size: 1 Capsule Servings per Container: 120

Amt/Serving DV%*OjibwaTea-Esiak 750mg. *Proprietary Blend of BurdockRootExtract4:1,SheepSorrelHerb4:1, SlipperyElmBarkExtract4:1,TurkishRhubarbRootExtract4:1,Watercress Herb, Blessed Thistle Herb, Red Clover Blossom and Kelp

*Dailyvaluenotestablished

LifesourceVitamins.com• Health Articles, Conditions & Cures,

and videos featuring LifeSource Founder, Bruce Brightman

• Detailed Product Information on Over 450+ LifeSource Vitamin Products

• Easy to Use Search Engine to Find Exactly What You Need

• Weekly Sales & Promotions

Page 21: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

21www.LifesourceVitamins.com I 1-800-567-8122

Evening Primrose Oil 100 Softgels - $9.99

•Premenstrualtension•Bloodpressure•Cholesterol•Internaltreatmentofeczemaandacne

SUPPLEMENT FACTS

ServingSize:3Softgels ServingsPerContainer:33

Amt/Serving DV%*EveningPrimroseOil 1.5g †GammaLinolenicAcid(GLA) 1355mg †Cis-LinoleicAcid(Omega6) 1095mg †

Feverfew 90 Capsules - $11.99

•Migrainesandheadaches•Rheumatoidarthritis(easesinflammation)•EasesTinnitus(ringingintheears)

SUPPLEMENT FACTS

ServingSize:2Capsules ServingsPerContainer:45

Amt/Serving DV%*FeverFew 1000mg †

*Dailyvaluesarebasedon2,000caloriediet. †Dailyvaluenotestablished.

Ultra Fiber Gummies 60 Gummies- $14.99

TheaverageAmericanconsumeslessthan1/3therecommendeddietaryfiberintake.TheAmericanDieteticAssociation and the American Cancer Society recommend25-35 grams of total dietary fiber per day, which is morethan double what the average American gets. Even forthose individuals with a healthy diet, there are somedays when it might be difficult to meet the recommendedamount. Ultra Fiber Gummies provides 5 grams of dietaryfiber per serving and is a convenient way to help you meetyour daily intake for dietary fiber. *All Natural Orange &MixedBerryFlavor*Colorsarederivedfromthefruitweuse: No synthetic dyes! *Gluten Free-Vegetarian Formula

SUPPLEMENT FACTS

Serving Size: 3 Gummies Servings per Container: 20

Amt/Serving DV%*Calories 20TotalCarbohydrates 8g 3%DietaryFiber 5g 20%Sugars 3g †Sodium 10 mg <1%

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Chicory root fiber, sugar, water, pectin, natural flavors, citric acid, sodium citrate,naturalcolor(annattoandelderberryjuice),coconutoilandcarnaubawax. Allergen Warning: ContainsTreeNuts(CoconutOil)

ClearFiber™ Powder Net Wt. 5 oz. (142g) - $12.99

•Nogrit•Noflavor•Nothickening•Mixeseasily

Soluble fiber found in beans and fruits have many health benefits. Studies show soluble fiber helps support healthy cholesterol and triglyceride levels as well as normal, healthy bloodsugarlevels.*ClearFiber™provides3gramsofsolublefiber per serving and is a convenient way to ensure you meetyourdailyintakefordietaryfiber.ClearFiber™usesthepatented SunFiber® derived from partially hydrolyzed guar gum. SunFiber® has been used in numerous clinical studies demonstrating its many health benefits.

SUPPLEMENT FACTS

ServingSize:1Tablespoon ServingsPerContainer:35

Amt/Serving DV%*Calories 20 †Total Carbohydrates 4 g 1DietaryFiber 3g 12SolubleFiber 3g †Sodium 20 mg 1

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished

Ingredients: PartiallyHydrolyzedGuarGum(naturalfiber).Containsno:sugar,salt,dairy,yeast, wheat, gluten, corn, soy, preservatives, artificial colors or flavors.

Fibroid Formula 90 Tablets - $12.99

LifeSource’s Fibroid Formula is uniquely designed for women to decrease the symptoms of menstruation, symptoms associated with endometriosis and other types of cystic fibroids associated with the uterus and ovaries.

SUPPLEMENT FACTS

Serving Size: 2 Tablets Servings per Container: 45

Amt/Serving DV%*Shepherd’sPurse 400mg †Cat’sClaw 400mg †PauD’Arco 400mg †DongQuai 100mg †Echinacea 100mg †AstragalusRoot 100mg †Anamu 100mg †GoldenSeal 25mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Flax Seed Oil 100 Softgels - $12.99

Flaxoilisanaturalreservoirfortheomega-3fattyacidalpha-linolenicacid(ALA).ALAisconsideredanessentialfatty acid because the body cannot make it from otherfatsandmustobtainitfromthediet.Flaxoilhasbeenshown to support cardiovascular health and to promotethe maintenance of healthy skin.

SUPPLEMENT FACTS

ServingSize:3Softgels ServingsPerContainer:33

Amt/Serving DV%*Calories 25Calories from Fat 25Total Fat 3 g 5%*Saturated Fat <0.5 g 2%*TransFat 0g †PolyunsaturatedFat 2g †MonounsaturatedFat 0.5g †OrganicFlaxSeedOil 3g(3,000mg) †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:SoftgelCapsule(gelatin,water,glycerin,organiccaramelcolor) Not manufactured with yeast, wheat, gluten, soy, corn, milk, eggs, fish or shellfish ingredients Each serving may also have the following naturally occurring amounts of polyunsaturated fats and monounsaturated fats:LinolenicAcid(Omega-3):55%,LinoleicAcid(Omega-6):14%,OleicAcid(Omega-9):19%,Other(Saturated):12% NON-GMO

Fenugreek 90 Veg Caps - $10.99

Fenugreek has been shown to reduce blood glucose levels by slowing absorption of sugars in the stomach and stimulating insulin production. Fenugreek helps stimulate milk production in lactating women. Research has shown it can increase milk production within 24 to 72 hours of consumption. It can also stimulate uterinecontractionsandinducelabor;thereforeitisnotrecommended during pregnancy.

SUPPLEMENT FACTS

Serving Size: 1 Capsule Servings per Container: 90

Amt/Serving DV%*Organic Fenugreek Seed (Trigonellafoenum-graecum)FullSpectrum 575mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Modified Vegetable Cellulose

NEW

Page 22: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

22 www.LifesourceVitamins.com I 1-800-567-8122

Organic Flax Oil 16 fl oz - $19.99

Our Organic product is cold-pressed and comes fresh to you inourheat,light,andoxygen-protectedbottlestoensurethebestqualityproduct.OurOrganicFlaxisgrowninNorthAmerica.•Omega3:7650mg•Omega6:2410mg•Omega9:2120mg

SUPPLEMENT FACTS

ServingSize:1Tablespoon(15mL) ServingsperContainer:31

Amt/Serving DV%*Calories 130Calories from Fat 130Total Fat 14 g 22%SaturatedFat 1.5g 8%PolyunsaturatedFat 10g †MonounsaturatedFat 2.5g †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Ingredients: OrganicFlaxOil,AntioxidantBlend(Organic,Rosemary,MixedTocopherols, AscorbylPalmitate,CitricAcid)

Methyl Folate 90 Tablets - $15.99

5-Methylfolate is the biologically active form of folate. Methylfolate is required to support cardiovascular and cognitive health, as well as the production of new cells and maintain healthy homocysteine levels.

SUPPLEMENT FACTS

Serving Size: 1 Tablet Servings per Container: 90

Amt/Serving DV%*Folate(from800mcgQuatrefolic® 667 mcg 167%5-methyl-tetrahydrofolate(400mcg5-MTHF)glucosamine)

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Cellulose,Silica,StearicAcid(vegetablesource),CalciumStearate (vegetablesource) Contains noArtificialcolors,flavors,orpreservatives;nowheat,gluten,milk,eggs,peanuts,tree nuts, soy, crustacean shellfish or fish. Suitable for vegans.

Folic Acid with Vitamin B-12 250 Tablets - $8.99

•Helpfulinpreventingneuraltubebirthdefects•Helpsthebodymakehealthynewcells•Importantforproduction,repairandfunctioningofDNA

SUPPLEMENT FACTS

ServingSize:1Tablet ServingsPerContainer:250

Amt/Serving DV%*FolicAcid 800mcg 333%VitaminB-12(asCyanocobalamin) 25mcg 1042%

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvalue not established.

Free of: yeast, wheat, soy, milk, gluten, sugar or salt. Other Ingredients: Cellulose, stearic acid, magnesium stearate.

GABA w/Vit B6 500 mg 100 Capsules - $12.99

GABA is a non-protein amino acid that functions as a neurotransmitter in the human brain. GABA is naturally produced in the body and its presence within the central nervoussystemmayhelppromoterelaxationandeasenervoustension.)

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:100

Amt/Serving DV%*Vitamin B-6 2 mg 100%GABA(GammaAminobutyricAcid) 500mg †

*Dailyvaluebasedona2,000caloriediet. †Dailyvaluenotestablished. NON-GMO

Garcinia Cambogia(Super Citrimax) 90 Capsules - $16.99

LifeSource Vitamins Garcinia cambogia uses the patented SuperCitriMax® in our formula and is a potent combination of ingredients that help to support a healthy body weight and properglucosemanagement.SuperCitriMax® is a proprietary blend(–)hydroxycitricacid(HCA)extract,naturallyderived from the Garcinia cambogia fruit that has clinically demonstrated its appetite and weight management support properties. This formula also provides Chromium, which has been shown to support proper glucose metabolism.

OurGarciniacambogia(HCA)isknownforitsappetitesuppressing qualities & can also help provide natural energy which is another plus for those who are decreasing their calories&increasingtheirexerciseinanefforttoloseweight.

•HelpsControlAppetite •HelpsConvertStoredFatintoEnergy

SUPPLEMENT FACTSServing Size: 2 Capsules Servings per Container: 45 Amt/Serving DV%*Chromium(aspolynicotinate) 200mcg 571%Garciniacambogiafruitextract(standardizedto60%(600mg) Hydroxycitricacid) 1,000mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients:Capsules(gelatin,water),cellulose,silicaandmagnesiumstearate Contains no sugar, salt, dairy, yeast, wheat, corn, soy, preservatives, artificial colors or flavors

Garlic (Odorless) 2000 mg

100 Softgels - $9.99200 Softgels - $16.99

(SAVE $3)

•Cholesterol-lowering•Anti-thrombotic•Mildbutbroad-spectrumantibiotic

SUPPLEMENT FACTS

ServingSize:2Softgels ServingsPerContainer:50

Amt/Serving DV%*Garlic(Odorless) 2000mg †(Extractfromtheequivalentof5g.ofwholeclovegarlic)

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenot established.

Ginger Root 100 Capsules - $9.99

Ginger Root has been used since antiquity to support digestive function and Ginger’s historical applications have been validated by modern research. Scientific studies have demonstrated that Ginger may help to maintain healthy GI flora, aid the digestion of dietary fats, and calm and sooth the digestive tract.

SUPPLEMENT FACTSServingSize:1Capsule ServingsPerContainer:100

Amt/Serving DV%*GingerRoot(Zingiberofficinale) 550mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients:Cellulose(capsule),MagnesiumStearate(vegetablesource)andSilica Not manufactured with yeast, wheat, gluten, soy, corn, milk, eggs, fish, shellfish or tree nut ingredients.

Ginkgo Biloba 60 Capsules - $9.99

•Supporthealthybrainandmemoryfunction•Improveconcentration•Antioxidantproperties

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:60

Amt/Serving DV%*GinkgoBiloba(LeafExtract24%) 320mg. *GinkgoBiloba(LeafPowder) 30mg. *

Page 23: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

23www.LifesourceVitamins.com I 1-800-567-8122

G.I. & Colon Support 90 Capsules - $16.99

LifeSource’s Gastro Intestinal and Colon Support takes care of your inner system so you’ll stay healthier longer. With LifeSource’s G.I. and Colon Support you’ve got what you need to maintain a well-functioning, efficient digestive system. LifeSource’s G.I. and Colon Support has been carefullyformulatedbyourpanelofnutritionalexpertsand is based on traditional techniques used by generations of naturopathic pioneers. G.I. Colon Support supports the naturopathic technique of colon cleansing.

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:90

Amt/Serving DV%*ProprietaryBlend: 750mg †BentonitePowder(organicclayanaturaldetoxifier),ConcentratedAloeVeraPowder,PsylliumPowderSeeds,CeleryPowder,PruneConcentrate,Mint,LactobacillusAcidophilus,FlaxSeedPowder,Anise,VitaminC.Magnesium,Papain(fromtropicalpapayafruit)andBromelainEnzymes(frompineapple).

*Dailyvaluebasedon2,000caloriediet.†Dailyvaluenotestablished.

Panax Ginseng 100 Capsules - $12.99

Ginseng is primarily promoted as an adaptogen, which means that it helps the body to cope with physical, mental and emotional stress.•Stimulatenervoussystem•Enhanceoxygenationofcellsandtissues•Reducefatigueandstress•Adaptogentohelpthebodycopewithphysical,mental&

emotional stress

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:100

Amt/Serving DV%*KoreanGinseng 650mg †

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished.

Glucosamine, MSM, &Arnica Cream - Organic 8 oz - $16.99

Joint Support FactorsIfyou’reoneofthe86millionAmericanadultsafflictedwithan“itis” such as arthritis or bursitis, or suffer from sore knees, hip pain or carpal tunnel, the pain can cause misery and keep you from living life to the fullest. LifeSource Vitamins Glucosamine, MSM & Arnica Liposomal Lotion is a soothing, fast-acting lotion specifically formulatedtosupportnormaljointfunction.Glucosaminesupportshealthy cartilage formation. This product’s active ingredients are packaged in Liposomes. Liposomes are very similar to the different layers of the skin barrier and combine well with cell membranes. Duetotheirmimickingability,thecoreingredientsoftheliposomecan merge more easily with the skin’s natural barrier layers, allowing the active ingredients to penetrate effectively.

Glucosamine,Chondroitin & MSM (Liquid)

16 fl. oz. / 32 Day Supply - $19.99

Withvirtuallyeverymovewemake,ourjointsareconstantlybeing stressed. As the years pass, these countless movements can take a tremendous toll on the integrity of our cartilage. LifeSource Vitamins Glucosamine and Chondroitin liquid providesafastandconvenientwaytoreplenishjointtissuesand promote normal movement while protecting our healthy cartilage from potential future damage. To increase its absorption and functionality, we’ve added MSM, and essential trace minerals.

SUPPLEMENT FACTS

ServingSize:1Tablespoon(15mL) ServingsperContainer:32

Amt/Serving DV%*Calories 15VitaminC(asAscorbicAcid) 125mg 10%Manganese(fromManganeseAAC*) 4mg 200%Sodium 95 mg 2%Potassium 5mg <1%GlucosamineHCl 750mg †ChondroitinSodiumSulfate(fromBovineCartilage) 600mg †MSM(Methylsulphonylmethane) 150mg †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished. Suggested Use: Asadietarysupplement,take1tablespoon(15mL)twicedaily. Contains shellfish derivative. Contains no starch, yeast, wheat, gluten, soy, milk, egg or artificial colors or flavors. Other Ingredients:De-ionizedWater,VegetableGlycerin,Fructose,MalicAcid,XanthanGum,CitricAcid,PotassiumSorbate,NaturalBeta-Carotene.Containsshellfish(crab,shrimp,lobster,crayfish) Not manufactured withwheat,gluten,milk,egg,fish,ortreenutingredients.ProducedinaGMPfacility that processes other ingredients containing these allergens.

Glucosamine Sulfate& MSM (Vegetarian) 120 Tablets - $26.99

Relief for those who are allergic to shellfish or who keep Kosher! LifeSource Vitamin’s unique and synergistic formula is suitable for vegetarians, because it contains only Glucosamine from a vegetarian source and not from shellfish. Joint pain and decreased mobility are common complaints among people with arthritis. Glucosamine has always been a popular and effective supplement for their relief. Unfortunately, the only waytogetglucosaminewasfromashellfishextract.Thisexcludedmanyfromitsbenefitsincludingvegetarians,peoplewith shellfish allergies or those with a kosher diet.

SUPPLEMENT FACTSServing Size: 1 Tablet Servings per Container: 120

Amt/Serving DV%*Potassium(fromglucosaminesulfatepotassiumchloride) 85mg †Glucosaminesulfate(from667mgofglucosaminesulfatepotassiumchloride) 500mg †MSM(methylsulfonylmethane) 500mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Other ingredients: Cellulose, modified cellulose, vegetable stearin, cellulose gum, magnesium stearate, silica and food glaze Shellfish free, Vegetarian and Vegan.

Glucosamine 1500 mg& Chondroitin 1200 mg

120 Tablets - $24.99240 Tablets - $44.99

(SAVE $5)

Joint Support FactorsGlucosamine and chondroitin sulfate are substances found naturally in the body. Glucosamine is a form of amino sugar that is believed to play a role in cartilage formation and repair. Chondroitin sulfate is part of a large protein molecule (proteoglycans)thatgivescartilageelasticity.GlucosamineandChondroitinworktogethertoreplenishjointtissues and promote normal movement while protecting our healthy cartilage from potential future damage.

SUPPLEMENT FACTS

ServingSize:2Tablets ServingsPerContainer:60

Amt/Serving DV%*GlucosamineSulfate 1500mg †ChondroitinSodiumSulfate 1200mg †

*Dailyvaluebasedon2,000caloriediet.†Dailyvaluenotestablished.

•OurOnlyCapsulewithGlucosamine,Chondroitin,and MSMTogetherinOneProduct

•ProvidesFast,EffectivePainRelief•NourishesCartilage,Ligaments,andTendons•EnhancesJointLubrication,FlexibilityandMobility

SUPPLEMENT FACTS

Serving Size: 2 Capsules Servings per Container: 60 Amt/Serving DV%*GlucosamineSulfate 750mg †ChondroitinSulfate 600mg †MSM 250mg †Devil’sClawRoot(5%Harpagosides) 50mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Modified Vegetable Cellulose, Omega 3 (FlaxSeed),NaturalSilica

Glucosamine Chondroitin Plus 120 Veg Caps - $24.99

NEW

Page 24: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

24 www.LifesourceVitamins.com I 1-800-567-8122

L- Glutathione 250 mg 60 Veg Caps - $24.99

ItiscalledtheMasterAntioxidant,becauseitcanregenerateitself after each fill-up of free radicals and go back to work. Free radicals are often the by-product of normal cellularmetabolicoxidationandtoxicoverload,leadingtoautoimmune diseases, several cancers, or heart attacks.•KillsFreeRadicals•ImmuneFunction•Anti-Aging•Anti-inflammation•HeavyMetalChelator–EnvironmentalDangers•DetoxificationofFreeRadicals•LiverHealth•CognitiveHealth–BrainHealth

SUPPLEMENT FACTS

Serving Size: 1 Veg Capsule Servings per Container: 60

Amt/Serving DV%*Setria™Glutathione(ReducedForm) 250mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Other Ingredients: RiceFlour,VegetablePolysaccharide(capsule),MagnesiumStearate (vegetablesource)andsilica

Not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients.

Gluten-ADE 60 Veg Capsules - $22.99

Gluten-ADEisacomprehensiveGlutenDigestiveEnzymeformula with acidophilus, prebiotics and probiotics. This formula containshighpotencyDPPIVenzymeactivityforoptimaldigestion of gluten peptides. Helps gluten intolerant and Celiac patients break down the protein in gluten that their bodies cannot process correctly.

SUPPLEMENT FACTS

Serving Size: 2 Vegetarian Capsules Servings per Container: 30

Amt/Serving DV%*GlutenEnzymeFormula 850mgStrongAcidProtease(Aspergillusoryzae/niger) 75,000HUTDPPzymeIVBlendProteaseFCC(aspergillusoryzae/niger) 120,000HUT †ProteaseFCC(Bacillussubtilis) 20,000PCProteaseUSP(Caricapapaya) 15,000USPAmylaseIFCC(Aspergillusoryzae) 10,695DUAmylaseIIFCC(bacillussubtilis) 6,150BAUGlucoamylaseFCC(Aspergillusniger) 15.5AGUCellulaseFCC(Trichodermareesei) 520CUFloraFit™LactobacillusacidophilusLa-14(500million) 3mgFiberAid® Arabinogalactans 10 mg FOS 10 mg

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Vegetariancapsule(cellulose,water),cellulose,magnesiumstearate and silica Contains No sugar, salt, yeast, wheat, gluten, soy, corn, preservatives, artificial colors or flavors Suggested usage: Take 2 capsules 10-15 minutes prior to meal

Green Coffee BeanExtract with 200mg Svetol®

What took LifeSource Vitamins so long to make Green Coffee BeanExtract?Thatiseasy,RESEARCH.Whatwefoundoutwasexactlywhywetookourtime.ThereisadifferenceinabsorptionwithGreenCoffeeBeanjustlikeanyothernutrient. After all of our research we found that Svetol was our unanimous choice and it is backed by science!

Why is Svetol so important and why do most Green Coffee BeanExtractsonthemarketnothaveSvetolinthem?Cost,simply put. Svetol®istheonlyplantextractofdecaffeinatedgreen coffee that helps you simultaneously lose weight and improve your body’s form. The slimming action of Svetol® refines your form. Scientifically proven, Svetol® is today’s exclusivesolutionforweightloss.

120 Capsules - $26.99

SUPPLEMENT FACTS

Serving Size: 2 Capsules Servings per Container: 60

Amt/Serving DV%*Svetol®

(CoffeaCanephoraRobustP.,Standardizedto50%totalPolyphenoisand45%ChlorogenicAcids) 200mg †GreenCoffeeBeanExtract(CoffeaCanephora,Standardizedto50%totalchlorogenicacids) 900mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Other Ingredients: VegetableCellulose(VeggieCapsule)Svetol®isaregisteredtrademarkofNaturex Directions: Take 2 capsules twice daily 30 minutes before meal

Grape Seed Extract 250 mg 90 Veg Caps - $29.99

HighinOligomericProanthocyanidins(OPC’sorPCO’s), apowerfulantioxidantwhichcanreducethedamagedoneby free radicals, strengthen and repair connective tissue,and promote enzyme activity.

SUPPLEMENT FACTS

Serving Size: 1 Veg Capsule Servings per Container: 90

Amt/Serving DV%*GrapeSeedExtract(vitisvinifera)(min.90%TotalPolyphenols) 250mg †AmlaExtract(Fruit)(Phyllanthusemblica) 60mg †RutinPowder(Sophorajaponica)(FlowerBud) 50mg

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Other Ingredients: RiceFlour,VegetablePolysaccharide(capsule),MagnesiumStearate(vegetablesource)andsilica

Not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients.

Green Tea Extract 100 Capsules - $12.99

Greenteaextractisoneofnature’smostpowerfulantioxidants.Thisallnaturalingredientisrecognizedforits beneficial health properties, as well as being a natural fat inhibitor.•GreenteaextractcontainsEGCG,apowerfulantioxidant

200 times more potent than vitamin E•Itsrichinbioflavonoid,andprotectsagainstdigestiveand

respiratory infections•Ithasthermogeniceffectsthataidsinweightlosswithoutcausingjittersorotherunwantedsideeffects

•Greenteaextracthelpsdecreasehormoneactivityandisan effective treatment for acne

SUPPLEMENT FACTS

ServingSize:1VegCapsule ServingsPerContainer:100

Amt/Serving DV%*VitaminC(asAscorbicAcid) 60mg 67%GreenTeaExtract 400mg †Extract(Leaf)(upto32mgofnaturallyoccurringcaffeine)(min.40%Catechins)

*PercentDailyValuesarebasedon2,000caloriediet.+DailyValuenotestablished. Other Ingredients:Cellulose(capsule)andMagnesiumStearate(vegetablesource) Not manufactured with wheat, gluten, soy, milk, egg, shellfish or tree nut ingredients

Gotu Kola (Organic) 90 Veg Caps - $13.99

Gotu Kola has been traditionally used as an energizing, cognitive stimulating herb for use in fatigue, confusion and general lethargy. It seems to have a stimulating effect on the thyroid and is indicated for low functional thyroid activity.

SUPPLEMENT FACTS

Serving Size: 1 Veggie Capsule Servings per Container: 90 Amt/Serving DV%*OrganicGotuKolaHerb(Centellaasiatica) 400mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Modified Vegetable Cellulose Suggested usage: Take 1 capsule, once or twice daily

NEW

Page 25: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

25www.LifesourceVitamins.com I 1-800-567-8122

Ultra Hair Skin &Nails Gummies

LifeSource Vitamins Ultra Hair, Skin and Nails combines

the most important vitamins and minerals for supporting

healthy hair skin and nails. Most diets today lack key

nutrients that naturally support beauty through health.

ThisproductcontainsvitaminsA,C,D,E,B-6,B-12as

wellasBiotin,FolicAcid,PantothenicAcid,Iodineand

Zinc. These nutrients provide the primary components for

supporting lustrous hair, glowing skin and flawless nails.

60 Gummies - $14.99

SUPPLEMENT FACTS

Serving Size: 2 Gummies Servings per Container: 30

Amt/Serving DV%*Calories 15Total Carbohydrates 4 g 1%Sugars 3g †VitaminA(retinylacetate) 4,000IU 80%VitaminC(ascorbicacid) 60mg 100%VitaminD(cholecalciferol) 400IU 100%VitaminE(dl-alpha-tocopherylacetate) 40IU 133%VitaminB6(pyridoxineHCI) 2mg 100%Folic Acid 400 mcg 100%VitaminB12(cyanocobalamin) 8mcg 133%Biotin 5,000 mcg 1,667%PantothenicAcid(calciumd-pantothenate) 10mg 100%Iodine(potassiumiodide) 80mcg 53%Zinc(citrate) 5mg 33%

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Other Ingredients: Malt syrup, sugar, glucose, pectin, citric acid, sodium citrate, natural flavors, coconutoil(containscarnaubawax),andblackcarrotjuiceconcentrateNaturalCherryFlavor

Heart / Vascular Support 90 Capsules - $22.99

LifeSource’s Heart and Vascular Support is augmented with vitamins and phytochemically-rich herbs to help maintain a healthy heart. Heart and Vascular Support contains a proprietary blend of nutrients and synergistic ingredients to promote cardiovascular health, circulatory function, and normal lipid levels. LifeSource’s Heart and Vascular Support is for those who desire to improve all aspects of healthy cardiovascular function. Heart and Vascular Support is designed to help with cholesterol health, vascular strength, homo-cysteine maintenance, and cardiac function.

SUPPLEMENT FACTS

ServingSize:3Capsules ServingsPerContainer:30 Amt/Serving DV%*VitaminE(asd-AlphaTocopherylAcetate) 600IU200%CalciumEDTA 1000mg †Ginkgo Biloba LeafPowderedExtract 100mg †Gotu Kola(Centellaasiastica) 100mg †Horse Chestnut(Aesculushippocastanum) 100mg †Butcher’s Broom(Ruscusaculeatus) 100mg †

Amt/Serving DV%*Diosmin 100mg †GrapeSeedPowderExtract100mg †Bromelain(2,400GDU) 100mg †Quercetin 100mg †OdorlessSuperGarlic 100mg †CayennePepper 100mg †CitrusFlavonoids 50mg †Witch Hazel(Hamamelisvirginiana) 30mg †Niacin(asFlushFreeniacin)20mg †

Ultra Hair, Skin & Nails 60 Tablets - $18.99

LifeSource Ultra Hair, Skin & Nails combines the most important vitamins and minerals for supporting healthy hair skin and nails. Most diets today are lack key nutrients that naturally support beauty through health. This amazing product includes optimum levels of Biotin, Beta Carotene, VitaminC,VitaminBComplex,Kelpandmanyothers.Thesenutrients provide the primary component for supporting lustrous hair, glowing skin and flawless nails. Healthy hair, skin and nails are the outward appearance of a proper diet.

SUPPLEMENT FACTS

ServingSize:1Tablet ServingsPerContainer:60.

Amt/Serving DV%*Vitamin A(50%asbeta-carotene,50%aspalmitate) 2,500IU 50%VitaminC(asascorbicacid) 80mg 133%VitaminD3(ascholecalciferol) 200IU 50%Vitamin E(asd-alphatocopherylsuccinate) 15IU 50%Thiamin(asthiaminmononitrate) 5mg 333%Riboflavin 5 mg 294%Niacin(asniacinamide) 10mg 50%VitaminB6(aspyridoxineHCI) 5mg 250%Folic Acid 200 mcg 50%VitaminB12(ascobalamin) 7.5mcg 125%Biotin 1,000 mcg 333%PantothenicAcid(asd-calciumpantothenate) 15mg 150%Calcium(asdi-calciumphosphatecalciumpantothenate) 135mg 13%Iron(fromferrousfumarate) 5mg 28%Phosphorous(fromdi-calciumphosphate) 100mg 10%

Amt/Serving DV%*Magnesium(frommagnesiumoxide) 50mg 13%Zinc(fromzincgluconate) 12.5mg 83%Selenium(fromselenomethionine) 100mcg 143%Copper(fromcoppergluconate) 1mg 50%Manganese(frommanganousgluconate) 0.5mg 25%Chromium(fromchromiumchloride) 100mcg 83%Molybdenum(fromsodiummolybdate) 25mcg 33%Potassium(frompotassium 25mg 1%MSM(methylsulfonylmethane) 125mg †L-methionine 50mg †Citrusbioflavonoidcomplex 50mg †Alphalipoicacid 50mg †Silica 40mg †Choline 25mg †Inositol 25mg †Grapeseedextract(Leucoselect©) 15mg †

UsinganexclusiveblendofAntioxidantJuices,suchasMaqui,Pomegranate,Blueberry,andAcai,yougetapowerfulcombination of nature’s most potent plant protectors. Stabilize Free Radicals before they can harm your skin and cause harm to cells both inside and outside your body.

SUPPLEMENT FACTSServing Size: 1 tbsp Servings per Container: 32 Amt/Serving DV%*Calories 4 Total Carbohydrates 1 g Sugars .25 g Added Sugars 0 g < 1%VitaminC(asascorbicacidandAcerolacherry) 60 mg 67%Biotin(asD-Biotin) 5,000mcg 16,667%Phytoceramideextract(tritiumvulgarseed) 30mg †Hydrate&RejuvenateBlend 5,500mg †100%pureAloeVeraJuice(innerleafgel),MaquiBerryJuice,BlackCurrantJuice,PomegranateJuice,BlueberryJuice,AcaiBerryJuice,SeaBuckthornJuice,OrganicBambooSilicaExtract(stemandleaf),WholeGrapeExtract(seed,skin&pulp),PomegranateFruitExtract,BlueberryFruitExtract,ChokeberryFruitExtract,MangosteenFruitExtract,CranberryFruitExtract,GojiBerryFruitExtract,AppleFruitandSkinExtract,BilberryFruitExtract,Resveratrol(as98%pureresveratrolfromnaturalfermentation),AcerolaCherryExtract,Astaxanthin(as Haematococcuspluvialisalgaeextract)

Ultra Hair Skin & Nails Liquid 16 Fl. Oz - $39.99

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:ReverseOsmosisPurifiedWater,Erythritol,NaturalFlavors,CitricAcid, RebA(SteviaLeaf)Extract,NaturalVegetableandFruitJuice(forcolor),PotassiumSorbate Contains noartificial colors, flavors or sweeteners, gluten, milk, salt, soy, starch, wheat or yeast Suggested usage: Take 1 tablespoon daily

NEW

Hawthorn is an all-around heart tonic for long-term use in cardiac pathology and for general preventative heart health. The powerful actions of Hawthorn has been used for several heart and cardiovascular conditions such as:•Treatangina•Lowerhighbloodpressure•Correctarrhythmia(irregularheartbeat)•Relievesymptomsofcongestiveheartfailure•Heartattackrecovery•Heartdiseaseprevention

SUPPLEMENT FACTSServing Size: 2 Capsules Servings per Container: 45 Amt/Serving DV%*Organic Hawthorn Berry (Crataeguslaevigataormonogyna) 1,000mg †

Hawthorn Berry (Organic) 90 Veg Caps - $12.99

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Modified Vegetable Cellulose

NEW

Page 26: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

26 www.LifesourceVitamins.com I 1-800-567-8122

Hemp Seed Oil 60 Liquid Caps - $9.99

Cold-pressed hemp seed oil has a dark green color and lendsits nutty flavor to a wide variety of foods. Hemp seed oil has avery high content of polyunsaturated fats, perfect for a healthylifestyle but also for the treatment of a variety of ailments as ithelps boost the immune system with a very rich Omega 3 & 6as well as Omega-9 essential fatty acid profile. Our hemp seedoil has not been genetically modified - Non GMO. The hempseed oil we offer is cold-pressed from raw whole hemp seeds todeliver the best possible quality and freshness.

•GreatforHeartHealth•HealthierHair,SkinandNails•BrainHealthandMemorySupport•BoostsaHealthierImmuneSystem•AMercuryFreeFattyAcidSupplement

SUPPLEMENT FACTSServing Size: 2 Liquid Capsules Servings per Container: 30 Amt/Serving DV%*Calories 10Calories from Fat 10Total fat 1 g 2%Hemp Seed Oil (Organic)ProvidingaTypicalProfileofthefollowing: 1,000mg. †Alpha-Linolenicacid(Omega-3) 14%MinimumLinoleicAcid(Omega-6) 44%MinimumOleicAcid(Omega-9) 8.5%MinimumPalmiticAcid 4.5%MinimumStearic Acid 2% Minimum

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Vegetablecellulose,organicorangeoil,andsilicondioxide

HGH FormulaTablets

90 Tablets - $19.99180 Tablets - $34.99

(SAVE $5)

HumanGrowthHormone(HGH)isahormoneproducedby the anterior pituitary gland in the brain. HGH promotestissue repair, cell regeneration in the bones, muscles andvital organs, and supports the immune system in combatinginfection and disease. As we age, our HGH levels declineto a fraction of the levels of our youth. Studies now indicatethat as much as 90-95% of our HGH levels have droppedbythetimeapersonreachestheageof80.Ithasbeendiscovered that as your pituitary gland produces lessand less HGH, the symptoms of many of our age-relatedproblems increase

Benefits Shown by lifeSource HGH Tablets•Increasesenergylevel•Improvessleep•Strengthensimmunesystem•Increasememory•Improvescholesterollevels•Lowersbloodpressure•Improveskidneyfunction•Supportsmentalclarity

•Increasesmusclemass&tone•Improvesskinandhair•Helpcreatestrongerbones•Increasestrength,energyand

endurance•Reduceswrinkles,andcreates•Improvessexdriveandperformance

tighter, smoother skinSUPPLEMENT FACTS

ServingSize:3Tablets ServingsPerContainer:30

Amt/Serving DV%*GlutamicAcid471mg †Proline 153mg †PituitaryGrowthHormones 150mg †Alanine 129mg †Isoleucine 129mg †

Amt/Serving DV%*Threonine 129mg †Serine 120mg †Phenylalanine87mg †ArginineHCL72mg †Valine 72mg †Tyronine 63mg †

Amt/Serving DV%*Histidine 48mg †Glycine 47mg †Methionine 45mg †Cystine 45mg †SoyProtein 27mg †Leucine 24mg †

Maximum HGH Powder 10.83 oz powder - $46.99

LifeSource’sMaximumHGHFormulaisanaminoacidcomplexspecificallyformulatedtoactasasecretagogueto stimulate the release of the body’s own Human Growth Hormone(HGH)naturally.

SUPPLEMENT FACTSServingSize:1Scoop ServingsPerContainer:30

Amt/Serving DV%*L-Ornthine 1,000mg †L-Arginine 1,000mg †L-Lysine 1,250mg †Glycine 1,000mg †L-Glutamine 6,000mg †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Hoodia Complex 90 Capsules - $19.99

In a nutshell, the best product on the market to help you lessenyourcaloric(calorie)intakewithoutfeelinghungryall of the time. A must for anyone who has tried every other weight loss program that never worked! Unlike any other formula available, this product has been developed to release hoodia into the system over a prolonged period of time. By taking 2 tablets daily, this helps maintain the benefits of hoodia around the clock, even while you sleep.

LifeSource’sHoodiaCapsareNOTdetoxifying,amphetamine,diuretic, or Ephedra weight loss pills, what Hoodia does is suppress your appetite, stopping you from thinking about food, thereby reducing your caloric intake. How does it do this? LifeSource’sHoodiacontainstheextractofHoodiaCactus.Thisis estimated to be up to 100,000 times as potent as glucose in sending a signal to the brain that the body is in a state of satiety, or in common terms: not hungry, and in clinical trials on obesesubjectsithasbeenproventoreducecalorificintakebyas much as 40%.

SUPPLEMENT FACTS

ServingSize:2Capsules ServingsPerContainer:45 Amt/Serving DV%*HoodiaCactusExtract20:1200mg †GreenTea60% 250mg †ColcusForskohuExtract10% 100mg †GarciniaCambogia 150mg †

Amt/Serving DV%*Glucomannan 400mg †GuaranaExtract40% 200mg †ChromiumPolynicotinate 1000mcg †ChickWeed 190mg †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Hyaluronic Acid 60 Veg Caps - $19.99

Hyaluronic acid, a key component of collagen, makes up much of the material in between cells and provides structure to variousorgans,suchastheeyes,jointsandskin.•Arthritisreliefandhealing•Tissuereconstruction•Improvedbonedensity•Increasedmentalalertness•Improvedmusclestrength

SUPPLEMENT FACTS

ServingSize:2VegCaps ServingsPerContainer:30

Amt/Serving DV%*Sodium(fromSodiumHyaluronate) 10mg <1%HyaluronicAcid(fromSodiumHyaluronate) 100mg †Lignisul®MSM(Methylsulphonylmethane) 900mg †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Holy Basil 60 Veg Caps - $15.99

Research shows that Holy Basil counteracts stress-induced changes in neurotransmitters and enzymes. It normalizes and brings balance to biochemicals in the body’s stress center such as cortisol, epinephrine and dopamine. Holy Basil is helpful for individuals with stress-related conditions, suchasanxiety,irritability,depression,irritablebowel,digestive disorders, hormonal fluctuations, adrenal fatigue, insomnia, and immune deficiency.

•UsedtoCounteractStressandCalmtheMind•DecreasestheStressHormone“Cortisol”•TraditionallyUsedforInflammation,Digestion,Asthma,

Arthritis, and Skin Conditions•StimulatesInsulinSecretionfromthePancreas

SUPPLEMENT FACTS

Serving Size: 1 Capsule Servings per Container: 60

Amt/Serving DV%*OrganicHolyBasilHerb 225mg †HolyBasilLeafExtract(2%UrsolicAcid) 225mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Modified Vegetable Cellulose

NEW

Page 27: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

27www.LifesourceVitamins.com I 1-800-567-8122

Immune Support 60 Softgels - $19.99

Immune Support is an herbal combination formulated for thesupport of a healthy Immune system.•GarlicExtractforOverallWellness•ImmunEnhancer™anon-digestiblesolublefiberfromLarch,

used as a prebiotic supplement for the support of healthy intestinal flora- a key component of normal immune function

•Elderberry,OliveleafExtractandOregonOiltocompletethiscomprehensive formula

•IdealforDailyMaintenanceofyourImmuneSystem!

SUPPLEMENT FACTS

Serving Size: 1 Softgel

Amt/Serving DV%*Calories 5Elderberry(Sambucusnigra)(Fruit/Berry)(50:1Concentrate)(Equivalentto2,500mg) 50mg †OliveLeafExtract(Oleaeuropaea)(min.18%Oleuropein) 40mg †GarlicExtract(Alliumsativum)(Bulb)40mg †

Amt/Serving DV%*OreganoOil(Origanumvulgare)(min.55%Carvacrol) 40mg †ImmunEnhancer™[ArabinogalactanfromLarchTree(Larixlaricina)] 10mg †RosemaryOil(Rosemarinusofficinalis)5mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: SoftgelCapsule(gelatin,glycerin,entericcoating,water,carob),Rice BranOil,BeeswaxandSoyLecithin Not manufactured with wheat, gluten, milk, egg, fish or shellfish ingredients

Iron Complex 100 Tablets - $10.99

Normally, the body gets sufficient amounts of iron from the foods you eat. It manages to self-regulate itself, storing amounts you will need by automatically absorbing more iron when the need is high, and less when levels are adequate. Nonetheless, iron deficiency is still a significant public health problem. It can occur during periods of rapid growth--infancy, adolescence, and pregnancy--which increase the body’s demand for this mineral. In addition, women who menstruate heavily tend to have lower iron levels.

SUPPLEMENT FACTS

Serving Size: 1 Tablet Servings per Container: 100

Amt/Serving DV%*VitaminC(asAscorbicAcid) 50mg 56%Folate 200mcg 83%VitaminB-12(asCyanocobalamin) 50mcg 2083%Iron(as158mgFerrochelIronBisglycinate) 27mg 150%DongQuai(Angelicasinensis)(root) 100mg †RedRaspberry(Rubusidaeus)(leaf) 100mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients.

Other Ingredients: Cellulose,StearicAcid(vegetablesource),CroscarmelloseSodium,Silica andMagnesiumStearate(vegetablesource)andVegetariancoating.

Vitamin K-2 w/D3 90 Chewable Tablets - $9.99

OurNewVitaminK2w/VitaminD3isnowinthemorebioavailable MK-7 form. This is a game-changer forheart health! Although Vitamin K is best known for itsrole in normal blood clotting function, recent researchhas revealed Vitamin K’s beneficial effects on bone andcardiovascular health. In bone tissue, Vitamin K is criticalfortheformationofhealthy,strongbonematrix.Infact,bone quality is dependent on the presence of adequateVitamin K. Vitamin K’s role in arterial health revolvesaround its ability to support proper calcium metabolismin vascular structures. Vitamin K2 is the most biologicallyactive form of vitamin K. It is also the most beneficial forbone integrity, as well as for the support of arterial health.

•SupportsBoneHealth•MostBiologicallyActiveForm•VegetarianFormula•SupportsaHealthyCardiovascularSystem*

SUPPLEMENT FACTS

Serving Size: 1 non-GMO Chewable Tablet Servings per Container: 90

Amt/Serving DV%*VitaminK-2(Mk7) 75mcg 94%VitaminD-3(cholecalciferol) 2,000IU 500%

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Other Ingredients:Dextrose,naturalcherryflavoring,vegetablestearicacid,vegetable magnesiumstearate,citricacidandsilicondioxide. Suggested usage: Take 1 tablet 1 to 3 times daily with meals.

Super Kelp 250 Tablets - $7.99

•Healthythyroidfunction•Metabolism•Properglandularfunction•Nervoussystemfunction•SupportsnaturalPHlevels

SUPPLEMENT FACTS

ServingSize:1Tablet/125mg ServingsPerContainer:250

Amt/Serving DV%*Kelp 125mg †Iodine 225mcg †

*Dailyvaluesarebasedon2,000caloriediet. †Dailyvaluenotestablished.

Inflacalm 60 Veg Caps - $21.99

Inflacalm helps calm inflammation, ease pain, and increase circulationtojointsandtissues.Itisindicatedforthoseseeking safe, drug-free relief from any inflammatory ailment whether it be acute or chronic.•CalmsInflammation,ReducesPain,andIncreases

Circulation to Joints and Tissues•Drug-FreeRelieffromAnyInflammatoryAilment,Acute

or Chronic•AlternativetoIbuprofentoHelpRelievePainand

Inflammation Without Gastrointestinal Side Effects•GingerRoot,HolyBasilLeaf,WhiteWillowBark,TurmericRoot,GreenTea,Rosemary,BoswelliaExtract

SUPPLEMENT FACTSServing Size: 1 Veggie Capsule Servings per Container: 60

Amt/Serving DV%*GingerRoot(5%Gingerol) 75mgHolyBasilLeaf(2%UrsolicAcid) 75mgWhiteWillowBark(25%Salacin) 75mgTurmericRoot(95%Curcumanoids) 50mg †GreenTea(95%Polyphenois,50%EGCG) 50mgRosemaryExtract(5%RosmarinicAcid) 50mgBoswelliaExtract(65%BoswellicAcid) 25mg

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Modified Vegetable Cellulose

NEW

Kava 90 Veg Caps - $19.99

Kavaissimplythebestanti-anxietyherbandisgreatinemotional stress and upheaval. It calms when one is in the middleofintensepersonaltrauma.Whilerelaxing,itdoesnot dull the senses but rather tends to focus the mind and sensory capacity.Kava is also used to help induce a deep restful sleep if used 30 minutes before bedtime. For those who sleep lightly, Kava helps bring one beyond the light sleep and beyond the active REM stage of dream stages that can be overactive and stressful. Kava does not usually make one sleepy if used in the daytime.Kavaalsoisagreatmusclerelaxerthatdoesnotsedatethemind. It helps body pain that is acute or chronic.•Anti-depressantthatElevatesMoodsandSensoryPerception•CanDiminishPainandDecreaseAdrenaline•Sedative,MuscleRelaxant,andPromotesREMSleep•CalmingEffectDuringEmotionalStressandUpheaval,•HasBeenUsedtoReplacePharmaceuticalDrugsSuchasValium,Zanax,LibriumandMore

SUPPLEMENT FACTSServing Size: 1 Veggie Cap Servings per Container: 90

Amt/Serving DV%*VanuatuKavaRoot(PiperMethysticum) 400mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients:ModifiedVegetableCellulose,Omega-3(FlaxSeed)

NEW

Page 28: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

28 www.LifesourceVitamins.com I 1-800-567-8122

Kidney Support 60 Veg Caps - $17.99

LifeSource Vitamins Kidney Support is a combination of 14 different ingredients designed to help optimize your kidney health.

Keeping your kidneys in good health is paramount. These body parts are often taken for granted or ignored unless there is a problem like kidney stones. Our kidneys function day in and day out without much fanfare, but they are so vitally important to our entire body and how our system functions.

•KidneyStones•UrinationSupport•ChronicFatigue•SkinIrritations•HealthyUricAcidLevels

SUPPLEMENT FACTS

Serving Size 2 Veg Caps Servings per Container 30 Amt/Serving DV%*VitaminB6(pyridoxineHCI) 5mg 250%CitricAcid 250mg †ChancaPiedra4:1Extract(Phyllanthusnirun)(stemandleaf) 250mg †Celery10:1Extract(seed) 200mg †TartCherry4:1Extract(fruit) 200mg †GreenCoffeeBean50%Extract 100mg †

Amt/Serving DV%*MilkThistle80%Extract(seed) 100mg †Cranberry4:1Extract(fruit) 100mg †Pomegranate40%Extract(fruit) 100mg †Amla4:1Extract(fruit) 25mg †Bromelain(2400GDU/g) 25mg †Yucca4:1Extract(root) 25mg †Devil’sClaw5%Extract(root) 25mg †Turmeric95%Extract(rhizome) 25mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

OtherIngredients:Hydroxypropylmethylcellulose,vegetablemagnesiumstearateand silicondioxide

L-Arginine 100 Capsules - $11.99

L-Arginine is considered the most potent free form Amino Acid ever discovered, due to its powerful health properties, and is referred to by scientists as the “Miracle Molecule”. L-Arginine isconvertedtonitricoxidewhichaidsintherelaxationofblood vessels. The effect is better blood circulation in the body,especiallyintheextremities.L-Arginineisacomponentof collagen, enzymes, hormones, skin and connective tissues. It reduces accumulation of compounds such as ammonia and plasmalactate,whichareby-productsofphysicalexercise.It inhibits platelet aggregation and can also decrease blood pressure. L-Arginine has been found to play a supporting role in cardiovascular, immune and nervous systems and has been validated by hundreds of studies

•BuildMuscleMass•EnhanceImmuneFunction•ImproveBloodPressure•IncreaseMemory•SpeedWoundHealing•IncreaseLibido

SUPPLEMENT FACTS

ServingSize:2Capsules ServingsPerContainer:50

Amt/Serving DV%*L-Arginine(Free-Form) 1.0g(1,000mg) *

*Dailyvaluebasedon2,000caloriediet.†Dailyvaluenotestablished.

Other ingredients:Gelatin(capsule),MagnesiumStearate(vegetablesource)andSilica.

Contains no sugar, salt, starch, yeast, wheat, gluten, corn, soy, milk, egg, shellfish or preservatives.TheL-ArginineusedinthisproductisPharmaceuticalGrade(USP).

L-Carnitine Liquid 16 fl. oz. / 32 day supply $22.99

LifeSource’sL-CarnitineLiquidprovidesalloftheextensivebenefits of Carnitine in a highly absorbable liquid form. L-Carnitine Liquid is a non-essential amino acid that helps to maintain overall good health by facilitating the transfer of fatty acid groups. Our L-Carnitine 2X Liquid provides double (1g)thepotencyofsomecompetingbrandsperservingsize.Liquid L-Carnitine is a convenient way to get a potent dose of pure L-Carnitine. Clinical research reveals muscle levels of L-Carnitine are markedly increased after supplementation. L-Carnitine plays a critical metabolic role. It is essential for the transport of fat into the body’s fat burning factories. Clinical research has also shown L-Carnitine supports athletic performance in endurance athletes. So if you take L-Carnitine tomaximizelevelsortosupportathleticperformance,youcanbe sure you are getting quality.•Studiesshowntosupportathleticperformanceinendurance

athletes.•Essentialforthetransportoffatintothebody’sfatburning

factories.•100%PureL-Carnitine•L-Carnitineplaysacrucialroleincardiovascularmetabolism

SUPPLEMENT FACTSServingSize:1Tablespoon(15mL) ServingsPerContainer:32 Amt/Serving DV%*Calories 15Total Carbohydrates 4 g 1%*VitaminB-6(asPyridoxineHCl) 2mg 100%PantothenicAcid(fromD-CalciumPantothenate) 10mg 100%L-Carnitine(Carnipure®)(Free-FormBase) 1.0g(1,000mg) †SteviaExtract(Leaf) 16mg †

*PercentDailyValuesarebasedona2,000CalorieDiet.†Valuesnotestablished.Other ingredients: De-ionizedWater,VegetableGlycerin,MalicAcid,CitricAcid,Natural Flavors,PotassiumSorbate(aspreservative),andLemon(Citruslimon)oil.

Non-GMO

Not manufactured with wheat, gluten, soy, milk, egg, fish or shellfish ingredients.

L-Glutamine Powder 200 Servings - $44.99

LifeSource L-Glutamine is 100 percent pure pharmaceuticalgrade L-Glutamine. The highest quality glutamine available today! Glutamine is the most common free form amino acid in thebody.Intenseexercisedramaticallyincreasestheneedforglutamine. While L-Glutamine builds, repairs, and maintains muscletissue,itisalsoamajorsourceofenergyfortheentirebody in particular the brain!•AssistingMuscleGrowth•ImprovesAthleticPerformance

•HelpswithDiabetesandBlood Sugar

•MetabolismandGrowth•BrainFunction•Essential

Neurotransmitter

L-Lysine 100 Capsules - $9.99

L-Lysine plays a particularly important role in the immunesystem. It is involved in the development of antibodiesand has important antiviral properties.•ImmuneSystem•IncreasedCalciumAbsorption•TreatingColdSores•HelpswithShingles•FightsHairLoss

SUPPLEMENT FACTSServing Size: 1 Capsule Servings per Container: 100

Amt/Serving DV%*L-Lysine(fromL-LysineHydrochloride) 500mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Gelatin(capsule),StearicAcid(vegetablesource),Cellulose,RiceFlourandMagnesiumStearate(vegetablesource). Not manufactured with wheat, gluten, soy, milk, eggs, fish, shellfish or tree nut ingredients.

L-Theanine 60 Veg Caps - $22.99

L-Theanineisapowerfulstressandanxietyreliever.Iteffectively reduces both mental and physical stress. L-Theanine has been shown to improve attention and concentration.•Alleviatesdepression•IncreasesGABAinthebody•Supportsconcentrationandmentalperformance•Helpsfocusattentiononcriticaltasks•Improveslearning,memoryandreactiontimes

SUPPLEMENT FACTSServing Size: 1 Veg Capsule Servings per Container: 60

Amt/Serving DV%*L-Theanine 200mg †Inositol 100mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:VegetablePolysaccharide(capsule),MagnesiumStearate(vegetablesource)andSilicia. Not Manufactured with wheat, gluten, soy, milk, eggs, fish, shellfish or tree nut ingredients.

Page 29: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

29www.LifesourceVitamins.com I 1-800-567-8122

L-Tryptophan 60 Veg Caps - $19.99

Tryptophan possesses a remarkable array of applications for maintaining good health. This can be traced to the fact that Tryptophan is an essential amino acid that is necessary for life and growth, so it cannot be replaced by any vitamin, mineral, herb, or prescription chemical, and it cannot be made by your own body.•MoodLiftingEffects•SerotoninLevels–TheHappinessHormone•Insomnia-EncourageaHealthySleepPattern•PlaysaRoleintheMetabolismandProductionofEnergy

SUPPLEMENT FACTS

Serving Size: 2 Veg Capsules Servings per Container: 30

Amt/Serving DV%*L-Tryptophan(Free-Form) 1,000mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Cellulose(capsule),CellulosePowderandStearicAcid(vegetablesource). Non-GMO Not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredient

Lecithin 1200 mg 100 Softgels - $9.99

Lecithinisthepopularnameforacompoundmixtureknownas phosphatides. Our lecithin supplement provides three forms of phosphatides to support memory function and learning. In addition, lecithin promotes health of the liver and the reproductive system.

SUPPLEMENT FACTS

Serving Size: 1 Softgel Servings per Container: 100

Amt/Serving DV%*Lecithin(fromsoy) 1,200mg †Typical AnalysisPhosphatidylCholine(fromsoy) 180mgPhosphatidylInositol(fromsoy) 102mg †PhosphatidylEthanolamine(fromsoy) 144mg

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Capsule(gelatin),Glycerin,SoybeanOil,Water

Liver Health & Support90 Capsules - $22.99180 Capsules - $37.99

(SAVE $8)

LifeSource’s Liver Health is a proprietary blend of herbs and nutrients designed to support healthy liver function. ThisformulacontainsMilkThistleExtract,whichhasbeenshown in clinical and non-clinical studies to support the liver, as measured by standard liver enzyme laboratory tests. In addition, LifeSource’s “Liver Health contains N-Acetyl Cysteine and Methionine, two amino acids known to enhance the productionofglutathioneintheliver.Glutathione,amajorcellularantioxidantplaysanessentialroleinliverdetoxificationmechanisms. Also included in this Liver Health are other herbs (Schisandra,Bupleurum,andScute)thathavebeendevelopedby our team of doctors, pharmacists and nutritionists.

SUPPLEMENT FACTSServing Size: 3 Capsules Servings per Container: 30 Amt/Serving DV%*Calories 10Total Carbohydrate 1 g <1%*DietaryFiber <1g 3%*MilkThistleExtract(Silybummarianum)(Fruit/Seeds)(Standardizedto240mgSilymarinFlavonoids-equivalent80%) 300mg †Herbal-EnzymeBlend:Artichoke(Cynarascolymus)(Leaf),Beet(Betavulgaris)(root),Raspberry(Rubusidaeus)(Leaf),Pancreatin(PancreaticEnzymes) 90mg †Setria™L-Glutathione(Reduced) 100mg †N-AcetylCysteine(NAC)100mg†GrapeSeed(StandardizedExtract)(Vitisvinifera)(StandardizedforPolyphenols) 100mg †DandelionRoot(Taraxacumofficinale) 100mg †L-Carnitine(fromL-CarnitineTartrate) 50mg †ScuteRoot(Sculellariaebaicalensis) 50mg †Schisandra(Fruit)(Schisandrachinensis) 100mg †Barberry(RootBark)(Berberisvulgaris) 30mg †Turmeric(Root)(Curcumalonga) 30mg †L-Methionine 20mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished

Other Ingredients: CellulosePowder,Cellulose(capsule),Silica,StearicAcid(vegetable source),andMagnesiumStearate(vegetablesource) Not Manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients.

Lutein Esters60 Capsules - $12.99

120 Capsules - $21.99(SAVE $4)

Luteinandzeaxanthinarethemainpigmentsinpartofthe eye called the macula. Lutein is strongly implicated in maintaining eye health, and as a preventative against macular degeneration.

Luteinactsasanantioxidant,protectingcellsagainstthedamaging effects of free radicals. At one time researchers believedallantioxidantsservedthesamepurpose.Nowthereisgrowingevidencethatindividualantioxidantsmaybeusedby the body for specific purposes. Researchers believe that lutein is deposited into areas of the body most prone to free radical damage.

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:60

Amt/Serving DV%*LuteinEsters 20mg †Zeaxanthin 1.23mg †Cryptoxanthin 0.11mg †

*Dailyvaluebasedon2,000caloriediet.†Dailyvaluenotestablished.

Lycopene 15 mg 60 Softgels - $24.99

Some studies suggest that supplements containinglycopene may help prevent macular degeneration,cataracts, cardiovascular disease, and cancer. Lycopeneisapowerfulantioxidantcarotenoidandthepigmentthatgives tomatoes, watermelon, and pink grapefruit theircharacteristic red color. Clinical studies have indicatedthat Lycopene works through a number of mechanisms tosupport cardiovascular health and immune function.In addition, epidemiological studies have determined thatLycopene may be particularly important for the support ofprostate health, as well as for the health of the digestivetract and support their liver health while traveling abroad.

HElPfUl fOr:•Maculardegeneration•Cataracts•Cardiovasculardisease•Cancerprevention

SUPPLEMENT FACTS

ServingSize:1Softgel ServingsPerContainer:60

Amt/Serving DV%*Lycopene 15mg †(LYCO-O-MATO®)(FromNaturalTomatoExtract)

*Dailyvaluebasedon2,000caloriediet.†Dailyvaluenotestablished.

Free of: sugar, salt, starch, yeast, wheat, gluten, corn, soy, milk, egg, preservatives. Other Ingredients: Softgel(gelatin,Glycerinandwater)RiceBranOil,mediumchain triglycerides,beeswaxandsilica. Suggested Use: As a dietary supplement, take one softgel daily, preferably with meals.

Maca (Organic) 90 Capsules - $13.99

Maca has been traditionally employed, among otherthings,toimprovesexualityandfertility.Recentscientificstudies have demonstrated that Maca supports hormonalbalance and both male and female reproductivehealth.MacaisalsousedtoalleviatePost-Menopausalsymptoms like hot flashes, low libido, depression, andproblems with concentration and mood swings.

•Increaselibidoandsexualfunctioninbothmenandwomen

•Helpdecreasemenopausesymptoms•Increaseenergyandstaminainathletes•Promotesmentalclaritya

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:90

Amt/Serving DV%*Maca(LepidiumMeyenilWalp) 625mg †

*Dailyvaluebasedon2,000caloriediet.†Dailyvaluenotestablished.

Page 30: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

30 www.LifesourceVitamins.com I 1-800-567-8122

Magnesium Citrate 100 Tablets - $13.99

While this macro-mineral is easily obtained from manyfoods,magnesiumdeficienciesareextremelycommonfor many Americans. Magnesium is not only one of thekey nutrients required in both calcium utilization andprotein synthesis, but it also plays a tremendous role invirtually every enzymatic reaction in our body.

SUPPLEMENT FACTS

ServingSize:2Tablets ServingsPerContainer:50

Amt/Serving DV%*Magnesium(asMagnesiumCitrate) 400mg 100%

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished. Other Ingredients: Cellulose,VegetarianCoating(cellulose,calciumcarbonate,MCTOil(mediumchaintriglycerides)(fromcoconut/palmkerneloil),xylitol,StearicAcid(vegetable source),CroscarmelloseSodiumandMagnesiumStearate(vegetablesource). Non-GMO

Magnesium Glycinate 90 Veg Caps - $15.99

Thisformofmagnesium(aswellasMagnesiumCitrate)iseasily absorbable in your system. However, it is less likely tocausealaxativeeffectasfoundinmostotherformsof magnesium.

•Pre-MenstrualSyndrome•KidneyStones•Depression•Fatigue•Migraine/TensionHeadaches

SUPPLEMENT FACTS

Serving Size: 3 Capsules Servings per Container: 30

Amt/Serving DV%*Magnesium(asglycinate) 400mg 100%

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Other Ingredients: Cellulose(vegetablesource),CalciumStearate(vegetablesource), Silica Contains no artificial colors, flavors, or preservatives, no wheat, gluten, milk, eggs, peanuts, tree nuts, soy.

Mellow Mag (MagnesiumCarbonate Powder) 8 oz - $17.99

MagnesiumCarbonatePowder,aneasilyabsorbableformofMagnesiumshowntohelpwithPre-menstrualtension,kidney stones, depression, hypertension, chronic fatigue syndrome(CFS),neuro-muscular/skeletaldisorders,migraine,nausea in pregnancy.

SUPPLEMENT FACTSServingSize:1Scoop(4g) ServingsperContainer:57

Amt/Serving DV%*Magnesium(asmagnesiumcarbonate) 350mg 88%

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.Other Ingredients: Ionicmagnesium(ablendofcitricacidandmagnesiumcarbonate),natural cherry flavor,andorganicsteviaextract Contains no sugar, salt, dairy, soy, yeast, wheat, gluten, preservatives, artificial colors, artificial flavors. Suggested usage:Takeone(1)scoopdaily.Add1scoopinacupandadd2-3ozofhotwater. Let it fizz. Stir until dissolved. Fill cup with additional water or other liquid

MCT Oil 32 fl. oz. - $24.99

MCT oil is a specially engineered fat which contains medium- chainfattyacids(MCFAs).Itprovidestwicetheenergyofproteinandcarbohydrate(8.3caloriespergramversusfour)andisabsorbed into the bloodstream as rapidly as glucose. MCT oil is preferentially used as fuel for energy instead of being stored as body fat. As an added benefit, MCT oil has a thermogenic effect because it is converted to energy very rapidly. In short, it isanextremelyconcentratedsourceofcaloriesthatisrapidlyabsorbed and metabolized for energy by the body.

SUPPLEMENT FACTSServingSize:1Tablespoon(15mL)(14gMCTOil)Servings per Container: 63

Amt/Serving DV%*Calories 100Calories from Fat 100Total Fat 14 g 22%Saturated Fat 14 g 70%TransFat 0g †PolyunsaturatedFat 0g †MonounsaturatedFat 0g †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.MCTOilhasnaturallyoccurringfattyacidsCaprylicAcid(C8:0)andCapricAcid(C10:0).

MCT OIL 3,000 mg 120 Liquid Softgels - $12.99

Mediumchaintriglycerides(MCT’s)arefatsthatarenaturallyfound in coconut and palm kernel oils. They’re more easily and rapidly digested than other types of fats. MCT’s are readily absorbed from the GI tract and are metabolized very quickly by the liver, where they are reported to encourage the use of fat for energy rather than for storage.

SUPPLEMENT FACTSServing Size: 4 Liquid Capsules Servings per Container: 30

Amt/Serving DV%*MediumChainTriglycerides 3,000mg †Typically Providing:CaprylicAcid 1,652mg †CapricAcid 1,052mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: PalmOil,gelatin(bovine)andVitaminE(d-alphatocopherylacetate)

SupportrelaxationandnervefunctionwithgreattastingCalming. Magnesium is an essential mineral that supports relaxation,improvedsleep,muscles,nervefunction,bonehealth and more. When effervescent Calming powder is combined with water it forms Magnesium Citrate with an ionic bond, creating a highly absorbable magnesium supplement. Great tasting Natural Raspberry Lemonade Flavor!

SUPPLEMENT FACTSServingSize:½Teaspoon(4.5g) ServingsperContainer:101 Amt/Serving DV%*Magnesium 340mg 81%

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Ingredients: Citric Acid and Magnesium Carbonate, Natural Raspberry Flavor, Organic SteviaExtract(leaf),NaturalLemonFlavor,SaltCitricAcidandMagnesiumCarbonatewilleffervescence to form ionic Magnesium Citrate when combined with water Contains NoArtificialColors,flavorsorpreservatives;nowheat,gluten,milk,eggs,peanuts,tree nuts, soy, shellfish, or fish. Suitable for Vegans

Calming Magnesium Powder 16 Oz - $28.99NEW

At our lowest, God is our hopeAt our weAkest, God is our strenGth

At our sAddest, God is our comforter

Maca Powder (Organic) 1 lb. - $19.99

Maca is a powerful adaptogen that helps the body deal with biochemical, physiological, and psychological stressors. It has a revitalizing effect on those who are feeling low in energy and vitality. Used as a tonic it can help reduce stress, increase energy levels and mental focus, and restore strength and vigor. It can help improve athletic performance by improving stamina and helping the body recover faster.

SUPPLEMENT FACTS

ServingSize:1Scoop(5g) ServingsperContainer:90

Amt/Serving DV%*Maca(Organic)(Powder) 5,000mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished.

Other Ingredients: 100%OrganicMacaRootPowderSuggested usage: Take 1 scoop daily

NEW

Page 31: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

31www.LifesourceVitamins.com I 1-800-567-8122

=LifeSourceProprietaryBlend

48gofCleanPureProteinperServing.Infact,theyreallyarenotsupplementsatall when you come to think of it. They should be complete meals, which most meal replacements are not. Many have no vitamins or minerals in them, therefore your body is being starved of these needed nutrients, which in turn causes your body nottoloseweightorgainthemusclemassyouarelookingfor.Peoplearealwayslooking for the magic solution to fat loss or building muscle, buying some drink or pill that promises miraculous results. We gain body fat by having poor eating habits, so the only way to undo the damage is to reverse the cycle by developing good eating habits. LifeSource’s Meal Replacements can help make this possible.

•OurWheyProteininourMealReplacementscomesfromgrassfedcowsthataredisease-free, pesticidefree, chemical-free, hormone treatment-free and GMO-free.

•Loadedwith48gramsofproteinperservingwithacompletevitamin/mineral complex

•NonPasteurized!

LIFESOURCE’SMEALREPLACEMENTSDONOTCONTAIN:•AspartameorAcesulfameK•Sucrose,Fructose,CornSyrupSolidsorHydrogenatedOils•AnyCholesterol

Our whey protein comes from grass fed cows who are disease free, pesticide free, chemical free, hormone-treatment free and GMO free

NUTRITION FACTSServingsSize:2Scoops(78g)

Amt/Serving DV%* Typical Amino Profile: Calories 282 Alanine 1,842mg.Caloriesfromfat 8 Arginine 1,647mg.Total Fat 2 g 0% Aspartic Acid 3,127 mg.SaturatedFat 1.5g 0% Cystine 821mg.Cholesterol 0 g 0% Glutamic Acid 10,225 mg.Sodium 84mg 5% Glycine 1,339mg.Total Carbohydrate 20 g 10% Histidine 965 mg.DietaryFiber 4g Isoleucine 2,294mg.Sugars 4 g Leucine 3,254 mg.Protein 48g Lysine 3,560mg.Vitamin A 100% Methionine 1,172 mg.VitaminC 100% Phenylalanine 2,048mg.VitaminD3 100% Proline 2,021mg.VitaminB1 100% Serine 2,983mg.Vitamin B2 100% Threonine 2,147 mg.VitaminB3 100% Tryptophan 998mg.VitaminB5 100% Tyrosine 1,468mg.Vitamin B6 100% Valine 2,145 mg.Vitamin B12 100%Vitamin K1 100%Biotin 100%Zinc 100%Calcium 20%

Ingredients: CrossFilteredWheyProteinIsolate,L-Glutamine,VitaminMineralComplex, Natural Cocoa and French Vanilla Flavoring and Stevia.

Ultra Meal Replacement (Vanilla & Chocolate)

48 g of Clean Pure Protein per serving Double Chocolate Fudge or Creamy French Vanilla

3 lbs. - $59.996 lbs. - $102.99 Free Shipping Over $99

(SAVE $17)

Page 32: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

32 www.LifesourceVitamins.com I 1-800-567-8122

Plant - Based Balanced Meal Complete Nutritional Shake CHOCOLATE OR VANILLA1 LB - $34.99

Finding a quick, easy, but most importantly, complete meal replacement for the vegan and vegetarian can be difficult on the run, but not when you have the LifeSource Vitamins Vegan Wholefoods Meal Replacement Formula to help you out. We have createdagreattasting,greatmixingmealreplacementformulatomeetyourveganlifestyle,andyesittastesgreat!

GLUTEN FREE | NO DAIRY | NO SOY | NON-GMOOne of the most distinguishable features of the vegetarian Meal Replacement Shake is its balanced blend of diverse plant proteins.The18gramsofeasily-to-digestproteinsupportyourbody’sabilitytolowerbodyfatandsupportmusclegrowth.6 Grams of fiber Balanced Meal Complete Nutritional Shake is chock full of Whole-Food Fermented Vitamins & Minerals, FivePlantProteins,OrganicFermentedSprouts,Herbs,Vegetables,Fruits,Spices,Fiber,EssentialFattyAcids,Antioxidants,Probiotics,PrebioticsandDigestiveEnzymes.

•21WholeSuperFoodsFermentedVitamins&Mineralsisrealnutritionfromrealfoods.Organicfermentedsprouts,herbs,vegetables, fruits and spices give you plenty of essential nutrients while also providing naturally occurring enzymes and unique phytonutrients.

•Multi-SourcePlantProteinMatrixcontains18gofcompleteplantproteinfromOrganicSproutedAmaranth&Quinoa,Chlorella,CranberriesandPeas.BCAA’s,GlutamineandGlycinehelpcreatetheperfectbalanceofessentialaminoacids.

•Multi-SourceLow-GlycemicEnergyMatrixprovidesslow-releasecomplexcarbsfromOrganicOats,Amaranth,Quinoa,Buckwheat, Millet and Chia.

•Multi-SourceFiber/AntioxidantMatrixispackedwith25fruits,berries,vegetablesandherbswhicharesomeofthemostpowerfulplantsourcesofantioxidantsthatnaturecanprovide.You’llalsoreceive6goforganicfiberineveryserving.

•Multi-SourcePlantEFAMatrixisfourofnature’srichestsourcesofessentialfattyacids:Flax,Chia,HempandSachaInchi.They contain all three types of EFAs your body needs including, Omega 3, 6 & 9.

•Probiotic,PrebioticandDigestiveEnzymeMatrixjumpstartsdigestionandnutrientabsorptionthemomentyoudrinkyourshakeandensuresthatyougetthemostoutoftheproteins,complexcarbohydratesandhealthyfatsinBalancedMeal.

SUPPLEMENT FACTS

ServingSize:2Scoops(approximately39.5g) ServingsperContainer:12

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Other Ingredients: Cocoa,naturalchocolateflavors,inulin,stevia,guargum,silica,naturalvanillaflavor,naturalcaramalflavor,lohanguo,organicmaltodextrinandorganiccornstarch. Contains No sugar, salt, dairy, yeast, wheat, gluten, preservatives, artificial colors or flavors. Suggested usage: Addtwo(2)levelscoopsto9-12ozofChilledwaterorpreferredbeverageinashakercup

Amt/Serving DV%*Calories 160Calories from Fat 30Total Fat 3 g 4%Saturated Fat .5 g 3%Sodium 290 mg 13%Potassium 290mg 6%Total Carbohydrates 15 g 5%DietaryFiber 6g 21%Sugars <1g †Protein 18g 36%VitaminA(asbetacarotene) 353mcgRAE 39%VitaminC(asascorbicacid) 25mg 28%VitaminD-3(ascholecalciferol) 4mcg(160IU) 20%VitaminE(assuccinate,acetate) 7mg 46%VitaminB-1(asthiamine,hydrochloride,mononitrate) 590mcg 49%VitaminB-2(asriboflavin) 800mcg 62%Niacin(asniacinamide) 9mg 56%VitaminB-6(ashydrochloride) 775mcg 46%Folate 400mcgDFE(240mcgfolicacid) 100%VitaminB-12(ascyanocobalamin) 2.5mcg 104%Biotin 135 mcg 450%PantothenicAcid(asd-calciumpantothenate) 4mg 80%Calcium(ascarbonate) 240mg 18%Iodine(aspotassiumiodide) 67mcg 45%Magnesium(ascitrate,oxide) 8mg 2%Zinc(ascitrate,oxide) 6mg 55%Selenium(asmethionine,selenite) 9mcg 16%Copper(asgluconate) 350mcg 39%Manganese(ascitrate,gluconate) 2.2mg 96%Chromium(asaminoacidchelate,chloride) 40mcg 114%Molybdenum(asaminoacidchelate,molybdate) 8mcg 18%

Amt/Serving DV%*Multi-SourceVitamins&MineralsMatrixwithFermented Whole Foods:OrganicFermentedHerbalBlend:Reishi,Shiitake,Maitake;OrganicFermentedVegetableBlend:Tomato,Pea,Carrot,Spinach,Pepper;FermentedFruitBlend:Cherry,Banana,Apple,Strawberry,Blueberry;OrganicFermentedSproutBlend:Amaranth,Quinoa,Millet;OrganicCulturedSpiceBlend:Cinnamon,Allspice,Cloves;Essential Glyconutrient Blend: Mannose, Glucose, Galactose,Xylosefrom(CoffeaArabica),Aloebarbadensis 850mg †

Multi-Source Plant Protein Matrix: PeaProteinIsolate,Organic Sprouted Amaranth, Organic Sprouted Quinoa,Chlorella protein, Cranberry Seed protein, and a proprietaryaminoacidblendofLeucine,Isoleucine,ValineandGlutamine 20,295mg †

Multi-Source Low-Glycemic Energy Matrix: Organic Oat Bran,Organic Amaranth, Organic Quinoa, Organic Buckwheat,Organic Mullit, Organic Chia, Broccoli sprouts, Watercress sprouts,Kalesprouts,Mustardsprouts,andCabbagesprouts 6,075mg †

Multi-Source Fiber/Antioxidant Matrix: Organic Acacia Gum Fiber,OrganicBeet,Grapeseedextract,PlumFruitextract,Strawberryjuice,HawaiianNonifruit,Pineapplejuice,Guavajuice,Organicapple,Orangejuice,Raspberryjuice,Mangojuice,Acaijuice,Cupuacujuice,CamuCamufruitextract,Greenteaextract,Watermelonjuice,OrganicHawthorneberryextract,Grapeskinextract,Elderberryfruit,OrganicGojiextract,Bilberryextract,Protease,Amylase,Cellulase,Lactase,Lipase,andWildAlaskanAuroraBlueBlueberry 3,950mg †

Multi-Source Plant EFA Matrix: FlaxSeedOilPowder,Flaxseed,Sachainchiseed,ChiaseedandHempseed 1,516mg †

Probiotic, Prebiotic, & Digestive Enzyme Matrix: Bacillus coagulans(1Billionviablecells),Fructo-Oligosaccharides(Inulin),Alpha-galactosidaseandBromelain 988mg †

HAVE QUESTIONS? IT CAN BE OVErWHElmING WE KNOW.CAll US, WE WIll WAlK yOU THrOUGH WHAT SUPPlEmENTS WIll TrUly HElP yOU ANd WHICH ONES yOU rEAlly dON’T NEEd. IT’S WHAT WE dO!

800-567-8122

Page 33: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

33www.LifesourceVitamins.com I 1-800-567-8122

Melatonin 3 mg 120 Capsules - $11.99

Melatonin is a naturally occurring hormone that plays a significant role in the regulation of the sleep-wake cycle. It is alsoapowerfulantioxidantthatsupportsimmunesystemfunction.

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:120

Amt/Serving DV%*Melatonin 3mg †

*Dailyvaluesarebasedon2,000caloriediet. †Dailyvaluenotestablished.

Melatonin 1 mg 60 Veg Lozenge - $6.99

As a naturally-occurring hormone, Melatonin is involved in setting our body’s natural physiologic cycles. It assists the body to normalize sleep disruption, thereby helping alleviate the fatigue that often accompanies chronic lack of sleep.

SUPPLEMENT FACTS

ServingSize:1Lozenge ServingsPerContainer:60

Amt/Serving DV%*Melatonin 1mg. †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Sorbitol,xylitol,cellulose,modifiedcellulosegum,stearicacid(vegetablesource),silicondioxide,citricacid,naturalpeppermintflavorandmagnesiumstearate(vegetablesource) Contains no artificial colors, flavors, or preservatives, no wheat, gluten, milk, eggs, peanuts, tree nuts, soy, crustacean shellfish or fish. Suitable for vegans

Melatonin Plus 50 Veg Tablets - $8.99

SUPPLEMENT FACTSServing Size: 1 Tablet Servings per Container: 50

Amt/Serving DV%*VitaminB-6(PyridoxineHCI) 1mg 50%Calcium(Calciumphosphate) 50mg 5%Melatonin 5mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients:Cellulose(VegetableSource),CalciumStearate(VegetableSource),Silica. Contains No artificial colors, flavors, or preservatives, no wheat, gluten, milk, eggs, peanuts, tree nuts, soy, crustacean shellfish or fish. Suitable for vegans. Suggested usage: Take 1 tablet 15 minutes before bedtime

Memory Enhancer & Brain Connector

Allnaturalproductthatiscompletelysafeandextremelyeffectiveformemoryretainmentandmemoryenhancement/recall.Promotesoverallmentalwellbeingwithanexceptionalblend of natural ingredients that works synergistically to provide optimum results. LifeSource Vitamin’s Memory Enhancer & Brain Connector have had great results for: Alzheimer’s patients, autistic children and also overall memory enhancement for adults all over the world.•ContainsGinkgoBilobawhichhasdemonstratedpositive

effects on memory enhancement and mental clarity•Promotesmentalhealthandimmunesystemfunction•Exertsapositiveimpactonmood,attention,concentration,

and the nervous system in general•Promotesbio-modulationwithintheentirebodyto

enhance overall performance•Providesallessentialaminoacidswhichfeedandenhance

brain activity

NUTRITION FACTS

Serving Size: 4 Capsules Servings per Container: 22

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Suggested usage: Take 2 to 4 capsules daily or as otherwise recommended by your health care professional

Amt/Serving DV%*Beta Carotene 2000 IU 40%Vitamins B1 40 mg 2667%VitaminB3(Niacin) 40mg 200%VitaminB5(Pantothenic Acid) 160mg 1600%VitaminB6 80mg 4000%Vitamin B12 (VegetarianSource) 400mcg 6667%Calcium 120 mg 12%Phosphorous (DiCalciumPhosphate) 40mg 4%Magnesium 80mg 20%Zinc 10 mg 114%Selenium 80mcg 114%AstragalusRoot 400mg †AlphaLipoicAcid 200mg †ViciaFaba-fava(BroadBean) 200mg †MucunaPruriens(VelvetBean) 200mg †L-Glutamine 200mg †Spirulina 160mg †

Amt/Serving DV%*PolygonumMultiflorum 150mg †Chlorella(AlgaeChlorophyll) 120mg †Choline(Bitartrate) 100mg †DMAE (Dimethylaminoethanol) 100mg †L-Tyrosine 80mg †L-Phenylalanine 80mg †Glycine 75mg †L-Alanine 75mg †L-GlutamicAcid 75mg †PygeumAfricanumExtract 75mg †AcetylL-Carnitine 50mg †GinkgoBilobaExtract 40mg †GrapeSeedExtract 20mg †5-HTP(5-HydroxyL-Trytophan) 10mg †Pregnenolone 10mg †CoQ-10 2mg †Melatonin 1mg †Huperzine-A 10mcg †

90 Capsules - $24.99180 Capsules - $44.99

(SAVE $5)

Liquid Memory Enhancer& Brain Connector

LifeSource Vitamins Liquid Memory Enhancer & Brain Connector provides many of the essential vitamins, minerals, fruits, vegetables, and fatty acids necessary for proper brain function and development. This all-natural product is safe and effective for memory retainment, focus, mental clarity and the nervous system in general. Rich in phospholipids, essential fatty acids, amino acids and trace minerals, this product can be used by children, adults or seniors to promote overall mental well-being with an exceptionalblendofnaturalingredientsthatworktogethersynergistically to provide optimum results. For those dealing with neurodevelopmental disorders such as Attention-DeficitDisorderorAttentionDeficitHyperactivityDisorder,thecarefullyselectedingredientsinthisproductcanhelp to improve attention and focus in both children and adults.SUPPLEMENT FACTS

Serving Size: 1 fl oz = 2 tablespoons Servings per Container: 32

32 fl oz - $34.99

Amt/Serving DV%*Calories 35Total Carbohydrates 3 g 1%Sugars 0 gVitamin C(asCalciumascorbate) 225mg 375%Thiamine(B1) 6mg 400%Riboflavin(B2) 15mg 882%Niacin(B3) 15mg 75%Pyridoxine(B6) 15mg 750%Folic Acid 225 mcg 56%Cyanocobalamin(B12) 60mcg 1000%PantothenicAcid(B5) 30mg 300%Calcium(Lactategluconate)(22mgelemental) 250mg 2%Magnesium(gluconate)(13mgelemental) 250mg 2%ChromiumPolynicotinate 60mcg †Choline 15mg †Phospholipid &Essential FattyAcid Blend 258mg †Soy Lecithin blend(containing:phosphatidylcholine, phosphatidylethanolamine,phosphatidylinositol),borage oil(containing:gammalinolenic,linolenic, alpha linolenic oleic,stearic,andpalmiticacid),phosphatidylserine)Proprietary Blend 1,050mg †GABA(Gamma-AminobutyricAcid),Taurine, L-Tyrosine,Hi-Orac fruit andvegetable blend(bananaextract,kiwiextract,mangoextract,pineappleextract,cranberryextract,cherryextract,raspberryextract,redpepperextract,plumextract,apricotextract,

Amt/Serving DV%*gingerextract,broccoliextract,spinachextract,kaleextract,cabbageextract,orangeextract,grapefruitextract,limeextract,greenteaextract,bilberryextract,certified organic guava[Psidiumguajava]extract,certified organic lemon[citruslimon]extract,certified organic sesbaniagrandifloraextract,certified organic amia[Phyllanthusemblic]berryextract,certifiedorganicholybasil[ocimumsantctum]extract,certifiedorganicannatto[bixaOrellana]extract,greencoffeeextract,camu camu concentrate,quercetin, tomato concentrate,broccoli concentrate,acai concentrate,turmeric concentrate,garlic concentrate,basil concentrate,oregano concentrate,cinnamon concentrate,elderberry concentrate,carrot concentrate,Mangosteen concentrate,blackcurrantextract,blueberryextract,sweet cherry concentrate,blackberry concentrate,chokeberry concentrate,raspberry concentrate,spinach concentrate,kale concentrate, brusselssproutconcentrate),DMAE,Redalgae(lithothamnioncalcareum),Stevia(steviarebaudiana)(leaf),Grapeseedextract,L-TheanineTrace Mineral Blend 3mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Other Ingredients: PurifiedWater,100%PurealoeVerajuice,Vegetableglycerin,Xanthan gum,citricacid,Naturalflavoring,Potassiumsorbate(topreservefreshness),Potassiumbenzoate(topreservefreshness).

Contains noartificialcolors,flavorsorsweeteners;gluten,milk,salt,starch,wheatoryeast.

Page 34: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

34 www.LifesourceVitamins.com I 1-800-567-8122

An inadequate amount of vitamins, minerals, amino acids, carbohydrates and enzymes have produced a reduction in intimate relations between couples. The combination of our 37synergisticnutrientsincludingPantothenicAcid,whichwe can find in plant cells with Ginseng, Gotu Kola, Yohimbe, and Guarana, form a unique combination that helps against impotency&ErectileDysfunction.

NUTRITION FACTS

Serving Size: 3 Tablets Servings per Container: 20

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Amt/Serving DV%*Vitamin E(asAlphatocopheryl) 200IU 667%Niacin 50 mg 250%VitaminB6(Pyridoxine) 25mg 1250%Vitamin B12(cobalaminconc.) 100mcg 1667%PantothenicAcid 100mg 1000%Zinc(asgluconate) 22mg 147%Manganese(asgluconate) 10mg 500%Octacosanol 500mg †Yohimbe 325mg †Damiana 250mg †Ginseng 250mg †RawTesticular 250mg †LiverExtract 150mg †TongkatAli 150mg †BeePollen 100mg †Carnitine 100mg †Fo-Ti 100mg †GotuKola 100mg †MuiraPuama 100mg †OatStraw 100mg †

Amt/Serving DV%*OrchicExtract 100mg †ProstateExtract 100mg †Sarsaparilla 100mg †SawPalmetto 100mg †WildMexicanYam 100mg †WildOats 100mg †HornyGoatWeed 75mg †Alanine 50mg †BetaSitosterol 50mg †Capsicum(Cayenne) 50mg †GlutamicAcid 50mg †Glycine 50mg †Guarana 50mg †Histidine 50mg †KolaNut 50mg †Maca 50mg †RoyalJelly 50mg †AvenaSativa 25mg †GammaOryzanol 25mg †Inosine 10mg †DHEA 2mg †DimethylGlycine 100mcg †

Men’s Potency & Libido Enhancer

60 Tablets - $17.99120 Tablets - $31.99

(SAVE $4)

=LifeSourceProprietaryBlend

Men’s Ultra Vitality 60 Veg Caps – $31.99

This unique formula is comprised of potent all natural concentrates that work synergistically. Together they stimulate sexualactivity,maintainandenhanceerectionsandincreasespermproductioninthetestis.Ourformulaisanextrastrengthcombination of natural herbal ingredients known to support a man’shealthysexualactivityandoverallvitality.WithTongkatAli, Tribulus, Maca and Horny Goat Weed, our Men’s Vitality is a targeted botanical formula that a man can use to maintain reproductivefunction,libido,andsexualperformance.

•SupportsHealthySexualFunction&Activity•Strengthens&EnhancesLibido(SexualDesire)•ImprovesEnergyLevels•BoostsYourSexual&LifeStamina•SupportsoverallVitality•HelpsRefuelYourSexDrive!

SUPPLEMENT FACTS

ServingSize:2VeggieCapsules ServingsPerContainer:30

Amt/Serving DV%*TongkatAli(EurycomalongifoliaExtract)(Root)(min.10%Saponins) 200mg †MacaRoot(Lepidiummeyenii)(4:1Concentrate) 500mg †EpimediumExtract(HornygoatWeed)(AerialParts/Leaf)(Epimediumsagittatum)(min.10%Icarin) 250mg †TribulusterrestrisExtract(Fruit)(min.45%Saponins) 250mg †AmericanGinsengRoot(Panaxquinquefolium) 75mg †PanaxGinsengRoot(Panaxginseng) 75mg †MuiraPuama(Ptychopetalumolacoides)(Bark)(10:1Concentrate) 50mg †

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished.

Menopause Support 120 Capsules-$19.99

New & Improved Menopause Support from LifeSource is formulated totheexactspecificationsofourcertifiednutritionists,doctorsandscientists. It contains recommended potencies of key ingredients that have been shown to support normal hormonal levels during menopause. This synergistic blend includes standardized herbal extractsandothernutrients,whichformatrulywell-balancedandeffective product for women. LifeSource’s Menopause Support containsaspecialblendofsoyandotherherbalextractsthatprovide a rich supply of isoflavones - a type of plant chemical that has been shown in clinical studies to promote bone and cardiovascular health and help relieve symptoms of menopause.

SUPPLEMENT FACTS

ServingSize:2VegCapsules ServingsPerContainer:60

Amt/Serving DV%*Soy Isoflavones 30 mg *BlackCohosh(2.5%extract)(root) 160mg *DongQuai(1%extract)(root) 150mg *Licorice(1%extract)(root) 150mg *RedClover(1%extract)(aerialparts) 400mg *Sage(3%extract)(leaf) 200mg *Chasteberry(0.5%extract)(fruit) 50mg *BlessedThistle(herbpowder) 50mg *RedRaspberry(20%extract) 50mg *MexicanWildYam(16%extract) 15mg *trans-ResveratrolPowder(fromPolygonumcuspidatumextract)(root) 1mg *

*Dailyvaluesnotestablished

Other ingredients:Microcrystallinecellulose,gelatin(bovine),vegetablemagnesium stearateandsilicondioxide.

Moringa Leaf Extract 60 Veg Caps - $9.99

Moringa Oleifera contains more than 92 nutrients and 46 typesofantioxidants.Moringaissaidtocureaboutthreehundred diseases and almost have all the vitamins found in fruits and vegetables. With all the health benefits of this miracle herb, it can easily be termed as the most nutritious herb on Earth. It can be consumed by small children and adults. Today, millions world over have started using Moringa based products in porridge, pastas, bread and to reap the everlastinghealthbenefitsoftheextraordinary‘Moringa’herb.

SUPPLEMENT FACTSServing Size: 1 Veggie Cap Servings per Container: 60

Amt/Serving DV%*MoringaLeafExtract10:1Moringaoleifera 500mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Suggested usage: Take 1 capsule with a meal daily or as otherwise recommended by your health care professional.

Milk Thistle (Silymarin) 100 Veg Capsules - $22.99

Silymarin, the key active compound in milk thistle, is one of the most potent liver protective substances known. Silymarin has been shown to increase glutathione production in the liver byaround30%,thusincreasingdetoxificationcapabilitiessignificantly. Silymarin also stimulates protein synthesis in the liver encouraging the growth of healthy liver cells.•Vegetarianformula•Silymarinhasantioxidantproperties.•Anti-inflammatoryeffectsofsilymarinhelpkeeplivercellsfromswellinginresponsetoinjury

•Silymarinseemstoencouragethelivertogrownewcells,while discouraging the formation of inactive fibrous tissue.

•Mayalsokeepcertainharmfulchemicalsfromgettingintoliver cells

•Mayhelptheimmunesystemtobemoreactive.

SUPPLEMENT FACTSServingSize:1VegCapsule ServingsPerContainer:100 Amt/Serving DV%*Sodium 5 mg <1%MilkThistleExtract(Silybummarianum)(FruitandSeeds) 300mg †(Standardizedto80%SilymarinFlavonoids)DandelionRootExtract(Taraxacumofficinale)(4:1) 100mg †ArtichokeExtract(Cynarascolymus)(Leaf)(Standardizedto2%Cynarin) 50mg †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished. Suggested Usage: As an herbal dietary supplement, take 1 Veg Capsules 1 to 3 times daily. Other Ingredients:Cellulose(capsule),Cellulose.

Page 35: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

35www.LifesourceVitamins.com I 1-800-567-8122

Moringa Leaf Powder (Organic) 10 oz - $19.99

•36Anti-Inflammatories•18AminoAcids,9EssentialAminoAcids•NourishestheImmuneSystem•PromotesHealthyCirculation•SupportsNormalGlucoseLevels•ProvidesAnti-InflammatorySupport•PromotesHealthyDigestion•PromotesHeightenedMentalClarity

SUPPLEMENT FACTS

Serving Size: 1 Teaspoon Servings per Container: 56

Amt/Serving DV%**MoringaLeafPowder(Moringaoleifera) 5,000MG †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

MSM Capsules 120 Capsules - $14.99

MSM is an organic form of sulfur found in every cell.

•Alertness •Athleticinjuries/pain•Bloodclotting •Depression•Jointpain •EnhancesvitaminC•Migraines •Musclepain•Scleroderma •Rheumatoidarthritis

SUPPLEMENT FACTS

ServingSize:2Capsules/2000mg ServingsPerContainer:60

Amt/Serving DV%*MSM(Methylsulphonylmethane) 2000mg †

*Dailyvaluesarebasedon2,000caloriediet. †Dailyvaluenotestablished.

MSM Powder 16 oz Powder - $16.99

MSM is an organic form of sulfur found in every cell.

•Alertness •Athleticinjuries/pain•Bloodclotting •Depression•Jointpain •EnhancesvitaminC•Migraines •Musclepain•Scleroderma •Rheumatoidarthritis

SUPPLEMENT FACTS

ServingSize:½Teaspoon(scoopnotincluded) Servings per Container: 226

Amt/Serving DV%*MSM(Methylsulphonylmethane) 2,000mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Suggestedusage:Takeone-half(1/2)totwo(2) teaspoonswithwaterorjuiceonetothreetimesperday

OUR WHEY PROTEIN POWDER COMES FROM RAW MILK

THAT IS HUMANELY HARVESTED FROM ORGANIC GRASS FED, U.S. DAIRY COWS.

IT IS FREE OF PESTICIDES, HORMONES, AND GMO’S.

See Page 65 for our Whey Protein Products

Mushroom Defense Mix 60 Veg Caps - $21.99

Scientific research is proving that some of the most powerful immune-supportivenutrientsarefoundinmushrooms.Peoplewho realize the critical importance of optimizing immune function should seriously consider adding our advanced mushroomcomplextotheirdailyregimen.

8MushroomComplex:•Reishi•TurkeyTail•LionsMane•Cordyceps•Himematsutakea•KingTrumpet•Maitake•AntrodiaCamphorata

SUPPLEMENT FACTS

Serving Size: 1 Veg Cap Servings per Container: 60

Amt/Serving DV%*OrganicMushroomMycelialBiomassBlend 700mg †KingTrumpet(Pleurotuseryngii),Cordyceps(Cordycepsmilitarys),TurkeyTail(Trametesversicolor),Reishi(Ganodermalucidum),Himematsutake(Agaricusblazei),Lion’sMane(Hericiumerinaceus),Maitake(Grifolafrondosa),Antrodia camphorata on myceliated organic oats.

†DailyValuenotestablished. Other Ingredients:VegetableCapsule(cellulose). ContainsNoartificialcolors,flavors,orpreservatives;nowheat,gluten,milk,eggs,peanuts, tree nuts, soy, crustacean shellfish or fish. Suitable for vegans. Suggested usage: Take one capsule daily between meals.

NAC 100 Veg Capsules - $18.99

NAChasbeenshowntoincreaselevelsoftheantioxidantglutathione, which can reduce cell damage, speed recovery from injuryandaidmusclegrowth.

SUPPLEMENT FACTS

ServingSize:1VegCap ServingsPerContainer:100

Amt/Serving DV%*Molybdenum(asAminoAcidChelate) 50mcg 67%Selenium(asL-Selenomethionine) 25mcg 36%N-AcetylCysteine 600mg †

*Dailyvaluesarebasedon2,000caloriediet. †Dailyvaluenotestablished.

Niacin Flush Free (VitaminB3)

Help lower cholesterol and triglycerides.

•Supportpropernervoussystemfunction.•Helpwithloweringbloodpressure•Improvepoorcirculation,stress,legcramps,headachesand

poor immunity

NUTRITION FACTS

ServingSize:2Capsules ServingsPerContainer:45

Amt/Serving DV%*NiacinFlushFree(InositolHexanicotinate) 1000mg †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenot established.

90 Capsules - $12.99

Page 36: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

36 www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

36

Multi Vitamin & Minerals Tablets 90 Tablets - $18.99 180 Tablets - $29.99 (SAVE $7.99) 360 Tablets - $54.99 (SAVE $4.99)

“LifeSource Multi Vitamin tablets are the most complete, well

rounded, scientifically advanced vitamins in the world. This multi

vitamin is the most important supplement that anyone can take to

help prolong life and fight off disease for long term health.”

— Bruce Brightman, Founder

LifeSource Multi-Vitamins are made with:•Wholefoods(notsynthetic)•Chelatedminerals(themostabsorbable)•Digestiveaids(toensureabsorptiontothebloodstream)•Enzymes(criticalfordigestingthesevitaminsandminerals)•Specialherbs(criticalforyourbody’shealth)•Probiotics(essentialfordigestivetracts,immunesystem,anddiseasefighting)

Nutritional Information:•Developedbyateamofdoctors,pharmacists,&nutritioniststoensuremaximum

absorption, optimum potency, and safety.•ThemostcompletevitaminintheWorld.•Betteroverallhealth,nomorecatchingeverycoldandvirusfromyourwork,church,

grocery store, or brought home by a family member.•Immediatenoticeableimprovementofyourhair,skin,&nails.•Consistentenergylevelthroughouttheday.

Great for:•Professional,Olympic&intenseathletes,whobreakdowntheirbodiesanddeplete

nutrients through working and playing hard.•Seniorswhoarebothactiveandnotsoactive,whoneedvitaminsmorethanany

other age group as their bodies quit producing needed nutrients and antibodies the older they get, therefore getting arthritis, bursitis, pneumonia etc.

•Busyadultshaveextremelybustling,day-to-dayliveswithworkandfamilyobligations and can’t afford to be sick all the time and feel sluggish throughout the day.

•Lastly,anyadultswhowanttooptimizetheirhealthtodayandinyearstocome.

FACT: Over 40% of North American’s are currently taking a multi vitamin. Most ofthem are not aware that they are getting less than half of what their body needsto function properly. Therefore, the body will rob and store nutrients, which thendeplete other areas of the body, thus causing other illnesses due to this depletionof nutrients.

FACT: Synthetic vitamins, which are the main vitamins being made aroundtheworldbyalldifferentvitamincompanieshavebeenshowntobeextremelydangerous for your health. Your body cannot process these synthetic vitamins.Whydothesemajornamebrandcompaniesusesyntheticvitamins?Cost,plainand simple. It is far cheaper to produce vitamins synthetically, even at the cost ofthose who take them. Your body needs to attain its nutrition from fruit, vegetablesand whole foods to get the absorption needed for optimum health. Most vitamincompanies in the world do not use these ingredients due to cost constraints andneed for profit. We work for God, profits are not our motivating force! Good health& God are!

LifeSourceMultiVitaminsareunmatchedanywhereintheworld.Herearejustsome of the benefits of our LifeSource Vitamins “Signature Series” where othervitamincompaniesjustcan’tmatchup:

Pre-MatureAging,StrengtheningofBones,DecreaseBodyFat,FightAgainstCancer,CardiovascularHealth,LoweringCholesterol,DigestionAid,Anti-Depression,Diabetes,Energy,GoodBacteria,Heart,Hearing,ImmuneSystem,Kidney/LiverFunctioning, Memory, Stress Level Balancing, Sleep Regulating, Stroke, Skin & Hair and Vision Health.

Article by The Journal of American Medical Association: JAMA Recommends a Multi-vitamin (JAMAstandsfortheJournalofAmericanMedicalAssociation,theforemostauthorityonSupplements).

The American Medical Association is advising all adults to take at least one multi-vitamin per day a reversal of their long-standing anti-vitamin policy.AccordingtoDrs.RobertFletcherandKathleen Fairfield of Harvard University, scientists’ understanding of the benefits of vitamins has rapidly advanced.It now appears that people who get enough vitamins may have a lower risk of some common chronic illnesses as cancer, heart disease and osteoporosis. JAMA’s last comprehensive review of vitamins was about 20 years ago. It concluded that people of normal health did not need to take a multivitamin. JAMA advised that people can get all the necessary nutrients from their diet. Only pregnant women and chronically sick people may need to supplement their diets with certain vitamins. At that time, the knowledge about vitamins was justbeginningtoexpand.Thevalueoffolicacidinpreventing some birth defects and heart disease was not yet known. Researchers hope that JAMA’s endorsement will encourage more people to take dailymultivitamins.Healthexpertsareincreasinglyworried that many American adults are not consumingenoughvitaminsintheirdiet.Almost80percent of Americans do not eat the recommended five servings of fruits and vegetables a day to provide essential nutrients.

NUTRITION FACTS

ServingSize:3Tablets ServingsPerContainer:60

Amt/Serving DV%*VITAMINS

VitaminA(w/BetaCarotene)10,000I.U. 200

VitaminD(fishliveroil) 240I.U. 100

VitaminE(d-alphatocoph.) 120I.U. 400

VitaminC(ascorbicacid) 300mg 500

VitaminB1(thiamine) 30mg 2000

VitaminB2(riboflavin) 30mg 1765

VitaminB3(niacinamide/niacin)90mg 450

VitaminB-5(pantothenicacid)90mg 900

VitaminB6(pyridoxineHCI) 30mg 1500

VitaminB12(cobalamin) 150mcg 2500

VitaminH(d-Biotin) 90mcg **

VitaminM(FolicAcid) 240mcg 100

Choline(bitartrate) 90mg **

Inositol 60 mg ***

ParaAminoBenzoicAcid 30mg **

Bioflavonoids 30 mg **

Rutin 18mg **

Hesperidin 9 mg **

MINERALS(elementalvalues)

Calcium(chelate/ascorbate) 400mg 40

Magnesium(chleate/oxide) 250mg 50

Potassium(aminoacidcomplex)150mg **

Iodine(Kelp) 225mcg 150

Zinc(proteinchelate) 30mg 200

Manganese(proteinchelate) 15mg **

Chromium(GTF/proteinchelate)150mcg ***

Selenium(aminoacidcomplex)100mcg 100

Phosphorous(cal.phosphate) 125mg 125

Vanadium** 50 mcg

Molybdenum** 15 mcg

DIGESTIVE AIDS-ENzYMES***Bromelain(pineapple) 50mg ***

Papain(papaya) 50mg ***

CitrusPectin 50mg ***

Acidophilus 50 mg ***

BetaineHCL(beets) 50mg ***

Amylase 5 mg ***

Lipase 5 mg ***

Cellulase 5 mg ***

Amt/Serving DV%*WHOLEFOODS***Spirulina 150 mg ***Garlic 150 mg ***BeePollen 50mg ***Siberian Ginseng 50 mg ***Soya Lecithin 50 mg ***Oat bran 50 mg ***

HERBS***Kola Nut 50 mg ***Ginger root 50 mg ***Cayenne 25 mg ***YellowDock 50mg ***Fo-Ti 50 mg ***Alfalfa Concentrate 50 mg ***Aloe Vera 50 mg ***Ginkgo Biloba 25 mg ***Dandelion 25mg ***Shiitake 25 mg ***Golden Seal 25 mg ***Echinacea 25 mg ***

OTHER NUTRITIONAL FACTORS***RNA 100 mg ***DNA 30mg ***Royal Jelly 100 mg ***L-Glutathione 3 mg ***L-Phenylalaline 100mg ***L-Glutamine 100 mg ***L-Tyrosine 100 mg ***Coenzyme Q10 3 mg ***Sproutedbarleyjuice(dry) 150mg ***Chlorella 150 mg ***Wheatgrassjuice 150mg ***Flaxseedoil(dry) 150mg ***Cat’s Claw 250 mg ***

*U.S.RecommendedDailyAllowanceforadults.

**NoUSRDAhasbeenestablished.

*** Need in human nutrition not established.

SugarFree•StarchFree•SaltFree•YeastFree•WheatFree•NoAnimal,MilkorEggProducts•NoArtificialColors,FlavorsorPreservatives

=LifeSourceProprietaryBlend

www.LifesourceVitamins.com I 1-800-567-8122

Page 37: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

37www.LifesourceVitamins.com I 1-800-567-8122

Ultra Multi Vitamin & Immune Booster Liquid

32 oz - $39.99 / 3 Bottles for $99.99 (SAVE $20)

100%PlantSourced–WholeFoodBasedLifeSourceVitaminsUltraLiquidMultivitamin&ImmuneBoosteris100%PlantSourced,

packedwithPhyto-Nutrients,MacroNutrients,MicroNutrients,GreenandRedSuperFoods

and what we feel to be the most complete well-rounded liquid vitamin in the world. This multi

has been developed after years of research and testing, and we have finally reformulated this

proprietaryformulatoprovideexactlywhatyourbodytrulyneeds.Synergisticallydesigned

toworkwithoneanotherandprovidemaximumabsorptionatthecellularlevelofthebody.

And tastes great!

Sowhatdoes100%PlantSourcedmean?Just that, everything in our Ultra Multivitamin & Immune Booster is derived by our

Fruits & Veggies. The way God intended it to be.

No Soy – No Gluten – No Artificial Sweeteners – No Sugar –

NoYeast–NoSalt–NoMilkDerivatives–NoGMO’s–

NoPreservatives•SuperPhytoFoodComplex

•ImmuneBoostingSupportwithanAllNaturalandCompleteAntioxidantBlend

•PrebioticMulti-FiberComplexandDigestiveSupport

•PlantBasedOmega3,6&9

•YouthandEnergyComplex

•CardiovascularSupportandLiverCleansing/DetoxSupport

LifeSource Vitamins Ultra Multi Liquids were formulated to meet the needs of a wide range of

individuals, no matter what their age. From Children to the Seniors, all of the known essential

nutrients will be uploaded to the bloodstream in the correct balance, ratio, and potency. Our

UltraMulticontainsvitamins,minerals,fruits,vegetables,antioxidants,greensuperfoods,

mushrooms, amino acids, herbs, EFAs and other natural nutrients to help nourish, protect

and revitalize your body. And through this formulation, we are able to enhance proper pH

andparticlesizesinourliquidmulti,whichmaximizesabsorption,whichinturnmaximizes

effectiveness,whichmeansoptimumhealth.Byre-balancingthebodychemistry,toxinsand

other wastes are eliminated easily and safely via the kidneys. Then the body goes to work

and begins the healing processes through having optimum nutrition and no waste problems,

which allows everything to function, as it should. When your wastes aren’t eliminated prop-

erly&efficiently,yourbodyisholdingontoallofthesetoxinsandbasicallygarbage,thatit

must try to keep away from the rest of your system, as a result, it sometimes neglects what it

is really supposed to be doing, which is to be orchestrating your body’s balances, and this is

when problems arise in our health, skin, mental acuity etc.

SUPPLEMENT FACTS

Serving Size: 1 fl oz Servings per Container: 32

Amt/Serving DV%*

Calories 28

Total Carbohydrates 5 g 2%

Sugars 0

Fat < 1g <1%

Sodium 23 mg <1%

DietaryFiber 2g

*Vitamin A

(NaturalBetaCarotene) 5000IU 100%

VitaminC(asAscorbicAcid,Acerolacherry,

CitrusBioflavonoids) 120mg 200%

VitaminD3(ascholecalciferol) 1000IU 250%

VitaminE(asd-alphatocopherolacetate)

(non-GMOfromsunflower) 30IU 100%

VitaminB1(ThiaminasThiamineHCLUSP) 3mg 200%

VitaminB2(RiboflavinasRiboflavin5Phosphate) 3.5mg 200%

VitaminB3(NiacinasInositolHexanicotinateUSP) 20mg 100%VitaminB6(asPyridoxal5Phosphate) 4mg 200%Folate(L-Methylfolate,Metafolin,FolicAcid) 400mcg 100%Vitamin B12(asMethylcobalamin) 200mcg 3,333%Biotin(asBiotinUSP) 600mcg 200%VitaminB5(PantothenicAcidascalciumpantothenate) D-20mg 200%Calcium(fromLithothamnionRedAlgae)(plantsource) 32mg 3%Magnesium(fromLithothamnionRedAlgae)(plantsource) 5mg 1%Zinc(asZincPicolinate) 3mg 21%Selenium(SeleniumGlycinateChelate) 70 mcg 100%Chromium(asChromiumPolynicotinate) 120 mcg 100%Manganese(asManganeseGlycinateChelate) 1 mg 100%Molybdenum(asSodiumMolybdenate) 75 mcg 100%Omega3,6&9PlantBasedBlend(BorageOil,FlaxSeedOil,SafflowerOil,SunflowerOil) 30mg †All-Natural Carotenoid Blend(AztecMarigold(flower)(containingLutein&Zeaxanthin),Lyco-O-Mato®

(containingLycopene,Beta-Carotene,Phytoene,Phytofluene(fromnaturaltomatoextract) 10mg †Prebiotic Multi-Fiber Complex and DigestiveSupport:Isomalto-oligosaccharides(prebioticfiber),NutraFlora®ScFOSPrebioticBlend,GreenPapayaJuice,Bromelain 2,250mg †Phyto Fruit, Veggie, & Herb Complex/Ultra Immune Support:AloeVeraJuice(ActivAloe®),Seaweedblend:CitrusBioflavonoids,NoniExtract(fruit),Pomegranate4:1 extract,Paud’Arco,Spirulina,AcerolaCherry,IrishMoss(aerialstems), Hi-Orac Fruit & Vegetable Blend:Bananaextract,Kiwiextract,Mangoextract,Pineappleextract,Cranberryextract,Cherryextract,Raspberryextract,RedPepper,extract,Plumextract,Apricotextract,Gingerextract,Broccoliextract,Spinachextract,Kaleextract,Cabbageextract,Orangeextract,Grapefruitextract,Limeextract,GreenTeaextract,Bilberryextract,GreenCoffeeextract,BroccoliSproutconcentrate,Onionextract,Appleextract,Acerolaextract,CamuCamuconcentrate,Quercetin,Tomatoconcentrate,Broccoliconcentrate, Acai concentrate, Turmeric concentrate, Garlic concentrate, Basil concentrate, Oregano concentrate, Cinnamon concentrate, Elderberry concentrate, Carrot concentrate, Mangosteenconcentrate,Blackcurrantextract,Blueberryextract,SweetCherryconcentrate,Blackberry concentrate, Chokeberry concentrate, Raspberry concentrate, Spinach concentrate,Kaleconcentrate,BrusselsSproutconcentrate),OrganicBrokenCell Chlorella5,300mg †Cardiovascular, Liver Cleanse & DetoxSupport: TMG-Trimethylglycine(allnaturalbetainefromsugarbeets),Choline(ascholinechloride),GojiBerryextract,HawthornBerry4:1extract,WholeGrapeextract,(seed,skin&pulp),PanaxGinsengextract(leaf),MilkThistle(Silymarin)fruitextract,Sumaextract(root),AlphaLipoicAcid,HorseChestnut(seed)extract,CoQ10(asubidecarenone),Resveratrol(root) 400mg †Anti-Aging Complex: MSM,GlucosamineHCLUSP(vegansource),RhodiolaRoseaextract(root),OliveLeafextract,GinkgoBilobaLeafExtract,HyaluronicAcid,HorsetailExtract(aerial stems) 235mg †Vegetarian Amino Acid Complex **(from organic quinoa): Alanine, Arginine, Aspartic Acid, Cystine, Glutamic Acid, Glycine, Histidine,Isoleucine,Leucine,Lysine,Methionine,Phenylalanine,Proline,Serine,Threonine,Tyrosine, ValineSea Vegetarian Derived Trace Mineral Complex: Antimony, Barium, Beryllium, Bismuth, Boron, Bromine, Cadmium, Calcium, Carbon, Cerium, Cesium, Chromium, Cobalt, Copper, Dysprosium,Erbium,Europium,Fluoride,Gadolinium,Gallium,Germanium,Gold,Hafnium,Holmium, Indium, Iridium, Iron, Lanthanum, Lithium, Lutetium, Magnesium, Manganese, Molybdenum,Neodymium,Nickel,Niobium,Osmium,Palladium,Phosphorous,Platinum,Potassium,Praseodymium,Rhenium,Rhodium,Rubidium,Ruthenium,Samarium,Scandium,Selenium, Silicon, Silver, Sodium, Strontium, Sulfur, Tantalum, Tellurium, Terbium, Thallium,Thorium, Thulium, Tin, Titanium, Tungsten, Vanadium, Ytterbium, Yttrium, Zinc, Zirconium

**

*PercentDailyValuesarebasedon2,000caloriediet. **NaturallyOccurring†DailyValuenotestablished. Other Ingredients: Filteredwater,erythritol,vegetableglycerinUSP,Xylitol,citricacid, malicacid,naturalflavoring,xanthangum,potassiumsorbateandpotassiumbenzoate (topreservefreshness),rosemaryleafextract

Suggested usage: Take 1 fl oz daily

37

Driven by Faith • PowereD by GoD

www.LifesourceVitamins.com I 1-800-567-8122

Page 38: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

38 www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

38

LifeSourceVitamin’sPowderedUltraMultivitaminprovidesa synergistic blend of vitamins & minerals as well as a vastarrayofCo-nutrients,Antioxidants,Bioflavonoids,PlantEnzymes,DigestiveEnzymes,HerbalExtractsandGreenPhytoFoods.OurwholefoodbasedMultivitaminwillenergizeevery cell in the body enabling those cells to produce moreenergy on their own and to function at peak efficiency. Withoptimum cell function you will feel more alive, more alert andmore aware than you have in years! This is a great formula forthose who struggle to swallow tablets and the added benefitof only needing to take one dose per day makes it a greatchoice for those who are on the go.

SUPPLEMENT FACTS

ServingSize:1Scoop(13grams) ServingsperContainer:30

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

•WholeFoodBased&SuperEnzymes•EnergizingSuperFoods&SuperiorTonicHerbs.•SuperiorAntioxidantFormula.•SuitableforVegetarians•MetabolicEfficiency•Bones&JointSupport•ElectrolyteBalancing•Energy&Endurance•ImmuneFunctionEnhancing•Vision&EyeHealthFunctions•MixesFast&AbsorbedinthebodyImmediately

Ultra Multi Vitamin & Mineral Powder A Whole Food Based Multi Vitamin

14 oz - $29.99

Amt/Serving DV%*Vitamin A 5,000 IU 100%VitaminC 500mg 883%VitaminD3 400IU 100%Vitamin E 200 IU 667%Vitamin B1 50 mg 3333%Vitamin B2 50 mg 2941%Niacinamide 40 mg 200%Vitamin B6 50 mg 2500%Folic Acid 400 mcg 100%Vitamin B12 250 mcg 4166%Biotin 150 mcg 50%PantothenicAcid 50mg 500%Calcium 400 mcg 40%Potassium 150mg 4%Phosphorous 125mg 13%Iodine 225 mcg 150%Magnesium 250 mg 63%Zinc 15 mg 100%

Amt/Serving DV%*Manganese 2 mg 13%Selenium 100 mcg 143%Chromium 150 mcg 125%Molybdenum 15 mcg 20%Cat’sClaw 250mg †Chlorella 150mg †Choline 150mg †FlaxseedOil 150mg †Spirulina 150mg †SproutedBarleyJuice 150mg †WheatGrassJuice 150mg †CamuCamu 100mg †Inositol 100mg †L-Glutamine 100mg †L-Phenylalanine 100mg †L-Tyrosine 100mg †RNA 100mg †RoyalJelly 100mg †

Amt/Serving DV%*Acidophilus 50mg †AdvantraZ 50mg †AlfalfaConcentrate 50mg †AloeVera 50mg †BeePollen 50mg †BetaineHydrochloride 50mg †Bioflavanoids 50mg †Bromelain 50mg †CitrusPectin 50mg †Fo-Ti 50mg †Guarana 50mg †KolaNut 50mg †OatBran 50mg †Papain 50mg †ParaAminoBenzoicAcid 50mg †SiberianGinseng 50mg †SoyLecithin 50mg †YellowDock 50mg †

Amt/Serving DV%*DNA 30mg †Rutin 30mg †GinkgoBiloba 25mg †Dandelion 25mg †Echinacea 25mg †GoldenSeal 25mg †Shiitake 25mg †Hesperidin 15mg †Amylase 5mg †Cellulose 5mg †Lipase 5mg †CoQ10 3mg †L-Glutathione 3mg †Cayenne 1mg †Garlic 1mg †GingerRoot 1mg †YohimbeBark 1,000mcg †Vanadium 50mcg †

LifeSourceVitaminsProprietaryBlendedPowderedUltraMultivitaminwithPhytoReds,Oranges,Purples&Bluesprovidesasynergisticblendofvitamins&mineralsaswellasavastarrayofCo-nutrients,Antioxidants,Bioflavonoids,PlantEnzymes,DigestiveEnzymes,andHerbalExtracts.OurwholefoodbasedMultivitaminwillenergizeeverycellinthebodyenablingthosecellstoproducemoreenergyontheir own and to function at peak efficiency. With optimum cell function you will feel more alive, more alert and more aware than you have in years! This is a great formula for those who struggle to swallow tablets and the added benefit of only needing to take one dose per day makes it a great choice for those who are on the go. See the difference when you take this multi vitamin and what your body can do to heal itself and become amazingly healthy!

SUPPLEMENT FACTS

ServingSize:1RoundedScoop(10g) ServingsPerContainer:30

Ultra Multi Vitamin & Mineral Powder + Phytos Foods LoadedWithPhytoReds,PhytoBlues,PhytoPurplesandPhytoOranges30DaySupply 14 oz - $39.99

Amt/Serving DV%*Calories 17Calories from Fat 0Total Fat 0 gSaturated Fat 0 gTotal Carbohydrates 4 g 1%Sugars 2 g 2%Sodium 10 g <1%Fiber 4 g 16%Protein 2g 4%VITAMINSVitamin A 5,000 IU 100%VitaminC 283mg 314%VitaminD-3 400IU 100%Vitamin E 100 IU 333%VitaminB-1 25mg 2083%Vitamin B-2 27 mg 2077%Vitamin B-3 20 mg 133%Vitamin B-5 25 mg 500%Vitamin B-6 25 mg 1923%Vitamin B-12 asCyanocobalamin) 125mcg 2083%Vitamin H 75 mcg 250%Vitamin M 267 mcg 673%Choline 75 mg 14%Inositol 50 mgMINERALS(ElementalValues)Calcium 202 mg 20%Magnesium 125 mg 31%Potassium 75mg 16%Zinc 8mg 100%Manganese 1 mg 50%Chromium 75 mcg 62%Phosphorous 63mcg 6%Selenium 50 mcg 71%Vanadium 25 mcg 100%Iodine 113 mcg 75%

Amt/Serving DV%*Molybdenum 8mcg 11%

WHOlE fOOdSCat’sClaw 125mg †Spirulina 75mg †SprountedBarleyJuice 75mg †Chlorella 75mg †WheatGrassJuice 75mg †FlaxseedOil 75mg †CamuCamu 50mg †BeePollen 25mg †SiberianGinseng 25mg †OatBran 25mg †SoyaLecithin 25mg †Advantraz 25mg †KolaNut 25mg †YellowDoc 25mg †FO-TI 25mg †AlfalfaConcentrate 25mg †AloeVera 25mg †Guarana 25mg †GinkgoBiloba 13mg †Dandelion 13mg †Shiitake 13mg †GoldenSeal 13mg †Echinacea 13mg †GingerRoot <1mg †Cayenne <1mg †Garlic <1mg †YohimbeBark <1mg †OTHER NUTRITIONAL FACTORSRoyalJelly 50mg †RNA 50mg †L-Phenylalanine 50mg †L-Glutamine 50mg †L-Tyrosine 50mg †

Amt/Serving DV%*ParaAminoBenzoicAcid 25mg †Bioflavanoids 25mg †Rutin 15mg †DNA 15mg †Hersperidin 8mg †L-Glutathione 2mg †CoenzymeQ-10 2mg †

rEd PHyTOSProprietaryFruitandVegetableBlend 1113mg †Blackberries, Acerola, Black Raspberries, Blue-berries,Cherries,Nectarines,Peaches,GogiBerries,Mangos,Pomegranates,Papayas,Black Currants, Blood Oranges, Cranberries, RedPlums,StrawberriesandWatermelonCarrotPowder 100mg †ApplePectin 42mg †FlaxSeed 42mg †Lycopene 42mg †Lutein 42mg †OatBran 29mg †Lecithin 25mg †RiceBran 17mg †ProbioticBlend 17mg †L. Acidophilus, L. Casei, L. Rhamnosus, L.Plantarum,B.BreveandB.LongumORACBlend 8mg †JapaneseKnotweed 7mg †BilberryStd.Extract25% 7mg †GrapeSeedExtract 5mg †Astaxanthin 3mg †PURPLEPHYTOSProprietaryFruitBlend 817mg †Blueberries, Blackberries,Black Cherries, Black Raspberries,

Amt/Serving DV%*BlackCurrants,Plums,Elderberries,Bilberries, Figs and RaisnsProprietaryVegetablePowderBlend 208mg †Eggplant,PurpleCarrots,PurpleCabbageandBeetsAcaiFruitPowder 67mg †CamuCamuPowder 50mg †Mangosteen 50mg †GojiBerry 33mg †Proprietary“Brain”Blend 17mg †(L-CarmosineandAlphaGPC)P40pPomegranateExtract 7mg †Stevia 6mg †Other Ingredients: Natural Raspberry, Strawberry, Cherry, Vanilla and Spearmint flavors, Banna powder, Citric Acid

OrANGE PHyTOSProprietaryFruitBlend 642mg †Oranges,Peaches,Nectarines,Tangerines,Cantaloupe,Pineapple,Clementines,Papaya,Apricot,Mango,Kumquat,PersimmonsProprietaryVegetablePowderBlend 233mg †Carrots,Yams,Pumpkin,Butternut Squash, RutabagaProprietaryEnergyBlend 133mg †Taurine,Inositol,DMG,HCIand WhitePanaxGinsengGreen CoffeeBeanExtract 75mg †Polyphenols40mg,ChloregenicAcid38mg, Caffeine 2g & Coenzyme Q-10 3mgSteviaLeafExtract 6mg †

=LifeSourceProprietaryBlend

www.LifesourceVitamins.com I 1-800-567-8122

Page 39: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

39www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

39

LifeSource Vitamins Adult Gummies are perfect for those adults who want a different and fun way to take their vitamins. If you don’t like swallowing pills, these are for you. They taste great and are a great way to ensure you are getting an adequate intake of the key nutrients your body needs.

OurAdultmixedfruitgummies(Orange,CherryandStrawberry)havenoartificialflavorsorcolors;wedothisfromthefruitweuse.NotSyntheticDyes!

SUPPLEMENT FACTS

ServingSize:2Gummies(Orange.CherryandStrawberryFlavor) ServingsperContainer:45

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Glucosesyrup,sugar,water,citricacid,pectin,sodiumcitrate,naturalflavors,naturalcolors(annatto,elderberryjuice,grapejuiceconcentrate),coconutoilandcarnaubawax. Suggested usage:Take2gummiesdaily.Donotexceed3gummiesdaily. Contains Noartificialcolors,flavorsorpreservatives;nowheat,gluten,milk,eggs,peanuts,treenuts,crustaceanshellfishorfish.Lutemax™2020trademarkbelongstoOmniActiveHealth TechnologiesLtd.Lyc-O-Mato©isaregisteredtrademarkofLycoRed,NaturalProductIndustries,Ltd.

Amt/Serving DV%*Calories 15Total Carbohydrates 4 g 1%Sugars 3g †VitaminA(RetinylAcetate) 4000IU 80%VitaminC(AscorbicAcid) 60mg 30%VitaminD(Cholecalceferol) 400IU 100%VitaminE(dl-AlphaTocopherylAcetate) 40IU 133%VitaminB-6(PyridoxineHydrochloride) 2mg 100%

Amt/Serving DV%*Folic Acid 400 mcg 100%VitaminB-12(Cyanocobalamin) 8mcg1 33%Biotin 150 mcg 50%PantothenicAcid(CalciumD-Pantothenate) 10mg 100%Iodine(PotassiumIodine) 80mcg 53%Zinc(ZincSulfate) 5mg 33%Sodium 15 mg 1%

Adult Gummy Multivitamin 90 Gummies - $15.99

LifeSource Vitamins Liquid Multi provides a solid nutritional base at a great price. It’s easy to swallow, easy to digest and has a pleasantorangeflavor.Likeallofourproductswe’veexcludedtheadditivesandimpuritiesthatyoufindinmanyleadingbrandsofsupplements. LifeSource Vitamin’s Liquid Multi Vitamin starts working for you faster than any tablet, capsule, or soft-gel product. Because the digestive system becomes less effective with age, assimilation of nutrients becomes less than optimal. Research shows that after age 50, the utilization of essential nutrients is greatly reduced. So when nutrient absorption may be most critical, our bodies lack the ability to break down the tablets, gelatin capsules, and soft-gel caps. Highly absorbable liquid from LifeSource Vitamins is the perfect solution for all ages!

SUPPLEMENT FACTS

ServingSize:1Tablespoon(15ml) ServingsPerContainer:32

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

LifeSource Essential Liquid Multi Vitamin (Orange Flavor) 16 fl oz - $22.99

Amt/Serving DV%*Vitamin A(from60%RetinylPalmitate&40%Beta-Carotene)5,000 IU 100%VitaminC(asAscorbicAcid) 250mg 417%VitaminD(asErgocalciferol) 400IU 100%Vitamin E 100 IU 333%(fromd-alphaTocopherylAcetate)Vitamin B-1 10 mg 667%(fromThiamineHydrochloride)Riboflavin(VitaminB-2) 10mg 590%VitaminB-3(fromNiacinamide) 25mg 125%Vitamin B-6 10 mg 500%(fromPyridoxineHydrochloride)Folate(asFolicAcid) 400mcg 100%VitaminB-12(asCyanocobalamin) 100mcg 1667%Biotin 100 mcg 33%Vitamin B-5 25 mg 250%(fromCalciumd-Pantothenate)Calcium(fromCalciumCarbonate) 25mg 3%Iodine[fromKelp(Laminariadigitata)] 75mcg 50%Magnesium(fromMagnesiumOxide) 10mg 3%

Amt/Serving DV%*Zinc(fromZincAAC) 3mg 20%Selenium(fromSelenopureT 15mcg 21%L-selenomethionine)Manganese(fromManganeseAAC) 2mg 100%Chromium 10mcg 8%(fromChromiumChelavite®AAC)Potassium(fromPotassiumChloride) 25mg <1%OrangeJuicePowder 100mg †VitaBerry®HI-ORACFruitBlend 50mg †AloeVeraJuice50mg†ColloidalMinerals(FulvicAcid) 50mg †RiceProteinConcentrate 30mg †Choline(fromCholineBitartrate) 25mg †Inositol25mg†Kelp(Laminariadigitata) 15mg †GrapeseedExtract 10mg †(VitisVinifera)(90%Plyphenols)CitrusBioflavonoids 10mg †Lutein(fromMarigoldExtract) 100mcg †Lycopene(fromNaturalTomatoExtract) 100mcg †

HAVING TrOUBlE SWAllOWING A PIll? lIfESOUrCE VITAmINS NOW HAS A VArIETy Of GUmmy VITAmIN

PrOdUCTS THAT TASTE GrEAT ANd HAVE NO ArTIfICIAl COlOrS Or flAVOrS. VITAmIN C, OmEGA 3, fIBEr, PrOBIOTICS ANd

mANy mOrE GUmmIES NOW AVAIlABlE.

www.LifesourceVitamins.com I 1-800-567-8122

Page 40: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

40 www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

40

Each Pack contains 3 capsules / 1 softgel / 3 tablets. Men’sUltraDailyPackprovideanarrayofMen’snutritionalneedsin the convenience of a single pack. Easy to travel with, throw them in your pocket or suitcase.

AcompletevitaminandmineralcomplexfromAtoZanda42FruitandVegetableblend.AlsoloadedwithwhatMenreallyneed:DigestiveEnzymeComplex,Spirulina,Wheatgrass,GreenTea,PsylliumHusks,ApplePectin,TraceMineralComplex,Kelp,CLA,Omega3’s-EssentialFattyAcids(GLA,ALA,EPA,DHA),SawPalmetto,PygeumAfricanum,PumpkinSeedandover50morenutrientsallworkingtogethertomakethistobethemostcompleteMen’sDailypack available.

TheseMen’sUltraPacksaredesignedtohelpwith:Aging, Immune Support, Prostate Health, Bone Strength, Muscle Growth, Cardiovascular Functioning, Digestion Improvement, Depression, Energy Metabolism, Memory & Cognitive Performance, Hearing, Vision, Sleep, Heart & Circulatory Health, Hair and Skin, Arthritis Support, Kidney & Liver Health and much more.

Vitaminsworkthroughconsistentmethodicaluse,justlikewedon’tgetoverweightfromonemeal,ittakestimetoforvitamins to get your body to a complete & nutritional balance. But once your body gets to a complete balance your system will be better equipped to heal itself. Multivitamins quite simply fill in the gaps and help this process. Long term, lacking of these vitamins and minerals in your daily diet have been shown to cause deteriorating energy levels, poor immunesystem,weakbones,arthriticconditions,cognitive/braindecline,visionissuesandamyriadofotherhealthrelated problems. This is why you have to take matters into your own hands. Vitamins, taken properly over time will greatly help you age stronger and healthier.

Itwouldbeidealtosplitthese7Capsules/Softgel/Tabletsthroughoutthedaywithbreakfastandlunch.Butifyoutakethemallatonemealthatisoktoo.Justtakethemmidmealorattheendofyourmealwith8ouncesofwater.

DID YOU KNOW: Over 75% or 3 out of 4 Americans do not meet the FDARecommended Daily Allowance (RDI) for overall nutrition in their diets. For those over 55, the % is even higher. Our Men’s Ultra Packs will help you fill the gaps in your diet, leading to healthier you!

SUPPLEMENT FACTS

ServingSize:1Packet(3Capsules/1Softgel/3Tablets) ServingsperContainer:30

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. ALLERGN WARNING: ContainsSoy(Lecithin)andFish(Anchovy) Other Ingredients:Gelatin(bovine),vegetablestearicacid,vegetablemagnesiumstearate,glycerin,riceflour,pharmaceuticalglaze,microcrystallinecellulose,croscarmellosesodium,purifiedwaterandsilicondioxide Suggested usage: Take1PacketDail

Amt/Serving DV%*VitaminA(67%asbetacarotene/33%palmitate) 15,000IU 300%VitaminC(ascorbicacid) 500mg 833%VitaminD-3(cholecalciferol) 600IU 150%VitaminE(d-alphatoco.Succinate/acetate) 110IU 367%VitaminB-1(thiaminemononitrate) 50mg 3333%VitaminB-2(riboflavin) 50mg 2941%Niacin(niacingranular) 10mg 50%VitaminB-6(pyridoxinehci) 52.5mg 2625%Folic Acid 400 mcg 100%VitaminB-12(cyanocobalamin) 100mcg 1667%Biotin 100 mcg 33%PantothenicAcid(d-calciumpantothenate) 20mg 200%Calcium(carbonate/dicalciumphosphate/citrate/aminoacidchelate/hydroxyapatite/gluconate/lactate/orotate/succinateandalphaketoglutarate) 675mg 68%Phosphorus(dicalciumphosphate) 111mg 11%Magnesium(oxide/aminoacidchelate) 350mg 88%Zinc(oxide/glycinatemonohydrate) 40mg 267%Selenium(aminoacidchelate) 50mcg 71%Copper(gluconate/oxide) 450mcg 23%Manganese(sulfate) 2mg 100%Chromium(aspolynicotinate) 50mcg 42%Potassium(ascitrate) 50mg 1%42Fruit&VegetableProprietaryBlendConsistingofBlueberry,Cranberry,GrapeSeed,Strawberry,Raspberry,Pomegranate,Bilberry, Alfalfa, Carrot, Beet, Broccoli, Acai, Chokeberry, Apple, ApplePectin,MaquiBerry,GrapeSkin,BlackCherry,Tomato,Barley, Celery,Chlorella,BlackCurrant,Artichoke,Mango,Pineapple,Spirulina, Chlorophyllin,Dandelion,WheatGrass,GreenTea,MilkThistle, EleutherococcusSenticosus,Ashitaba,BingCherry,Elderberry,GojiBerry, Grapefruit,Mangosteen,Spinach,TartCherry,andPapaya 315mg †EnzymeComplex(fromplants)ConsistingofCellulase,Bromelain,Papain,Amylase,Trypsin,andLipase 75mg †SpirulinaAlgae 500mg †WheatGrassPowder(aerialplant) 200mg †Safflower(powder) 100mg †Lecithin 75mg †CholineBitartrate 75mg †Inositol 75mg †CitrusBioflavonoids50%Complex 50mg †

Amt/Serving DV%*GotuKolaPowder(aerialparts) 50mg †

EchinaceaPurpureaRootPowder 25mg †

GreenTea(98%extract)(driedleaves) 25mg †

PABA(para-AminobenzoicAcid) 15mg †

PsylliumHuskPowder(hulls) 15mg †

Oat10:1Extract(aerialparts) 15mg †

ApplePectin(malusdomestica)(fruit) 15mg †

Chlorophyll(sodiumcopperchlorophyllin) 15mg †

Lactobacillus Acidophilus

(*Activitylevelattimeofmanufacture) 20millionCFU* †

Octacosanol 15mcg †

TraceMineralComplex 3mg †

Kelp(thallus) 210mcg †

Boron(asaminoacidchelate) 2027mcg †

CLAComplex(80%conjugatedlinoleicacidfromsaffloweroil) 290mg †

GLAComplex(18.5%gammalinolenicacidfromborageseedoil) 262mg †

ALAComplex(50%alphalinolenicacicfromflaxseedoil) 150mg †

EPA(eicosapentaenoicacidfromfishoil) 125mg †

DHA(docosahexaenoicacidfromfishoil) 100mg †

SawPalmettoPowder(fruitberries) 300mg †

PygeumAfricanum(5:1extract)(bark) 150mg †

PumpkinSeedPowder 150mg †

BurdockRootPowder 2.5mg †

CayennePepperPowder(fruit) 2.5mg †

GoldensealRootPowder 2.5mg †

GravelRootPowder(Eupatoriumpurpureum) 2.5mg †

JuniperBerriesPowder 2.5mg †

MarshmallowRootPowder 2.5mg †

ParsleyLeafPowder 2.5mg †

L-GlutamicAcidHCI 35mg †

L-Alanine 35mg †

L-Glycine 15mg †

Men’s Ultra Daily Pack(WholeFoodBased) 30 Packs - $39.99

www.LifesourceVitamins.com I 1-800-567-8122

Page 41: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

41www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

41

Each Pack contains 3 capsules / 1 softgel / 3 tablets. Women’sUltraDailyPacksareoverflowingwiththenutrientswomenneedeachandeveryday!ProvidingacompletearrayofWomen’snutritionalneedsintheconvenienceofasingle pack. Easy to travel with, throw them in your gym bag, purse, pocket, on your desk at work or in your suitcase.

A complete vitamin and mineral women’s formula from A to Z with a powerful 42 Fruit and Vegetable blend. Also loadedwithwhatWomenreallyneed:DigestiveEnzymeComplex,Calcium,Magnesium,Wheatgrass,GreenTea,Omega3’s-EssentialFattyAcids(GLA,ALA,EPA,DHA),BlackCohosh,DongQuai,LicoriceExtract,VitexBerry(ChasteBerry),RedClover,Sage,FalseUnicorn,BlessedThistle,RedRaspberry,MexicanWildYamandover50morenutrientsallworkingsynergisticallyomakethisthemostcompleteWomen’sDailypackavailable.

ThesepackscontainCalcium/Magnesiumtablets,providingdualsupportforbonehealthandstrength.Stresscanbeamajorissueformanyactivewomen,butWomen’sUltraPacksaddressthisbyhavingasoothingherbalblendthathelpsbalanceemotionsandencouragerelaxation.

TheseWomen’sUltraPacksaredesignedtosupport:Aging, Immune Support, Hormone Levels, Bone Strength, Muscle Growth, Mood Balance, Cardiovascular Functioning, Digestion Improvement, Energy Metabolism, Depression, Stabilize Physical, Mental and Emotional Energy, Memory & Cognitive Performance, Hearing, Vision, Sleep, Heart & Circulatory Support, Hair and Skin, Arthritis Support, Kidney & Liver Health and much more.

Itwouldbeidealtosplitthese7Capsules/Softgel/Tabletsthroughoutthedaywithyourbreakfastandlunch.Butifyoutakethemallatonemealthatisoktoo.Justtakethemmidmealorattheendofyourmealand8ouncesofwater.

DID YOU KNOW: Vitamins and minerals are called “Essential” because they are needed to sustain life and our bodies do not create them, they must be obtained from diet. The most common source are fruits and vegetables, but only 14% of U.S. adults and 9.5% of teens are eating the recommended servings. Our Women’s Ultra Daily Packs can fill the gaps in your diet and make a difference in your long term health!

SUPPLEMENT FACTS

ServingSize:1Packet(3Capsules/1Softgel/3Tablets) ServingsperContainer:30

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

ALLERGN WARNING:ContainsSoy(LecithinandSoyIsoflavones)andFish(Anchovy) Other Ingredients:Gelatin(bovine),microcrystallinecellulose,vegetablestearicacid,vegetablemagnesiumstearate,glycerin,pharmaceuticalglaze,croscarmellosesodium,riceflour,silicondioxideandpurifiedwater

Suggested usage:Take1PacketDaily

Amt/Serving DV%*

VitaminA(67%asbetacarotene

/33%palmitate) 15,000IU 300%

VitaminC(ascorbicacid) 500mg 833%

VitaminD-3(cholecalciferol) 600IU 150%

VitaminE(d-alphatoco.Succinate/acetate) 110IU 367%

VitaminB-1(thiaminemononitrate) 50mg 3333%

VitaminB-2(riboflavin) 50mg 2941%

Niacin(niacingranular) 10mg 50%

VitaminB-6(pyridoxinehci) 50mg 2500%

Folic Acid 400 mcg 100%

VitaminB-12(cyanocobalamin) 100mcg 1667%

Biotin 100 mcg 33%

PantothenicAcid(d-calciumpantothenate) 20mg 200%

Calcium(carbonate/dicalcium

phosphate/citrate/aminoacidchelate/

hydroxyapatite/gluconate/lactate/orotate/

succinateandalphaketoglutarate) 675mg 68%

Phosphorus(dicalciumphosphate) 111mg 11%

Magnesium(oxide/aminoacidchelate) 350mg 88%

Zinc(glycinatemonohydrate) 15mg 100%

Selenium(aminoacidchelate) 50mcg 71%

Copper(oxide) 200mcg 10%

Manganese(sulfate) 2mg 100%

Chromium(aspolynicotinate) 50mcg 42%

Potassium(ascitrate) 50mg 1%

42Fruit&VegetableProprietaryBlend

Consisting of Blueberry, Cranberry, Grape Seed,

Amt/Serving DV%*

Strawberry,Raspberry,Pomegranate,Bilberry,

Alfalfa, Carrot, Beet, Broccoli, Acai, Chokeberry,

Apple,ApplePectin,MaquiBerry,GrapeSkin,

Black Cherry, Tomato, Barley, Celery, Chlorella,

BlackCurrant,Artichoke,Mango,Pineapple,

Spirulina,Chlorophyllin,Dandelion,WheatGrass,

Green Tea, Milk Thistle, Eleutherococcus Senticosus,

Ashitaba,BingCherry,Elderberry,GojiBerry,

Grapefruit, Mangosteen, Spinach, Tart Cherry,

andPapaya 315mg †

EnzymeComplex(fromplants)Consistingof

Cellulase,Bromelain,Papain,Amylase,Trypsin,

andLipase 75mg †

SpirulinaAlgae 500mg †

WheatGrassPowder 200mg †

Safflower(powder) 100mg †

Lecithin 75mg †

CholineBitartrate 75mg †

Inositol 75mg †

CitrusBioflavonoids50%Complex 50mg †

GotuKolaPowder(aerialparts) 50mg †

EchinaceaPurpureaRootPowder 25mg †

GreenTea(98%extract)(driedleaves) 25mg †

PABA(para-AminobenzoicAcid) 15mg †

PsylliumHuskPowder(hulls) 15mg †

Oat10:1Extract(aerialparts) 15mg†

ApplePectin(Malusdomestica)(fruit) 15mg †

Amt/Serving DV%*

Chlorophyll(sodiumcopperchlorophyllin) 15mg †

Lactobacillus acidophilus

(*Activitylevelattimeofmanufacture) 20millionCFU* †

Octacosanol 15mcg †

TraceMineralComplex 3mg †

Kelp(thallus) 210mcg †

Boron(asaminoacidchelate) 2027mcg †

CLAComplex(80%conjugatedlinoleicacid

fromsaffloweroil) 290mg †

GLAComplex(18.5%gammalinolenicacid

fromborageseedoil) 262mg †

ALAComplex(50%alphalinolenicacic

fromflaxseedoil) 150mg †

EPA(eicosapentaenoicacidfromfishoil) 125mg †

DHA(docosahexaenoicacidfromfishoil) 100mg †

SoyIsoflavones 15mg †

BlackCohosh(2.5%extract)(root) 80mg †

DongQuai(1%extract)(root) 75mg †

Licorice(1%extract)(root) 75mg †

RedCloverExtract(1%extract)(aerialparts)200mg †

Sage(2.5%extract)(leaf) 100mg †

Chasteberry(0.5%extract)(fruit) 25mg †

BlessedThistle(herbpowder) 25mg †

RedRaspberryPowder(fruit) 25mg †

WildYam(16%extract)(root) 7.5mg †

trans-Resveratrol

(fromPolygonumcuspidatumExtract)

(root) 500mcg †

Women’s Ultra Daily Pack (WholeFoodBased) 30-Packs - $39.99

www.LifesourceVitamins.com I 1-800-567-8122

Page 42: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

42 www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

42

Other male multiples are now obsolete with LifeSource Vitamins Men’s Multivitamin formula. Our vegetarian vitamins are formulated for higher levels of the nutrients men need to maintain optimum health. What makes our formula better?

•Contains10,000IUbetacarotenefromavegetariansource,withmixedcarotenoids.•InositolhexanicotinateforvitaminB-3-thesuperiorformnutritionistsrecommend.•B-6derivedfromP-5-P,amorebioavailableandefficientform.•B-12asmethylcobalamin,themostactiveco-enzymeform.•160mgofSawPalmetto-importantforeverymanover30.•50mgofthepowerfulmetabolicantioxidantAlphaLipoicAcid-rarelyfoundinothermultiples.•15mgofCoQ10idealformenofallages.•HighlevelsofLycopeneandLutein,carotenoidscriticalforprostateandeyehealth.•Iron-freeformulaoffersthebestvalueonthemarketforpremiummalemultiples.•VegetarianFormula.•Keepingmenactiveinallareasoflife!

IdEAl fOr mEN Of All AGES SUPPLEMENT FACTS

ServingSize:3VegCapsules ServingsPerContainer:30

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished. Other Ingredients: CellulosePowder,Cellulose(capsule),StearicAcid(vegetablesource)andSilica. Contains: Soy derivatives. Contains no: sugar, salt, yeast, wheat, gluten, milk, egg, shellfish or preservatives.

Amt/Serving DV%*VitaminA(75%asBeta-Caroteneand25%asRetinylPalmitate) 10,000IU 200%VitaminC(fromCalciumAscorbate) 250mg 417%VitaminD(asErgocalciferol) 1,000IU 250%VitaminE(asd-alphaTocopherylSuccinate) 150IU 500%VitaminK(asMenaquinoneK2andPhytonadioneK1) 80mcg 100%Thiamine(Vit.B-1)(fromThiamineHCl) 25mg 1667%Riboflavin(VitaminB-2) 25mg 1471%Niacin(VitaminB-3)(asNiacinamideandfromInositolHexanicotinate) 35mg 175%VitaminB-6(fromPyridoxineHClandPyridoxal-5-Phosphate(P-5-P) 25mg 1250%Folate(asFolicAcid) 400mcg 100%VitaminB-12(asMethylcobalamin) 250mcg 4167%

Amt/Serving DV%*Biotin 300 mcg 100%PantothenicAcid(VitaminB-5)(fromD-CalciumPantothenate) 50mg 500%Calcium(fromCalciumAscorbateandCalciumCitrate) 50mg 5%Iodine(fromPotassiumIodide) 150mcg 100%Magnesium(fromMagnesiumCitrate 25mg 6%Zinc(fromZincBisglycinate)(TRAACS) 15mg 100%Selenium(fromL-Selenomethionine) 200mcg 286%Copper(fromCopperBisglycinate)(TRAACS) 500 mcg 25%Manganese(fromManganeseBisglycinate)(TRAACS) 2mg 100%Chromium(fromChromiumPicolinate) 200mcg 167%Molybdenum(fromSodiumMolybdate) 75mcg 100%Potassium(fromPotassiumChloride) 25mg <1%

Amt/Serving DV%*SawPalmettoExtract(Berry)(Serenoarepens)(min.45%FattyAcids) 160mg †AlphaLipoicAcid 50mg †AloeVera(Leaf)(200:1Concentrate) 50mg †Choline(fromCholineBitartrate) 25mg †GrapeSeedExtract(Vitisvinifera)(StandardizedforPolyphenols) 25mg †Inositol 25mg †CoQ10(CoenzymeQ10) 15mg †NaturalTrans-Resveratrol[fromJapaneseKnotweedExtract(Polygonumcuspidatum) (Root)] 10mg †Lycopene(fromNaturalTomatoExtract) 3mg †Lutein(fromMarigoldFlowers) 500mcg †

Mens Superior Multi Veg Capsules 90 Veg Caps - $22.99

Why Softgels?

The softgel medium is a popular way to deliver a dose of vitamins, minerals, or herbs. Unlike hard tablets and capsules,softgelsaresoftandpliable.Thisallowsthemtobeswallowedmoreeasily,andexudesamorecomfortableappearance.

•WithSawPalmetto,PlantSterols,Lycopene,NettleRoot&CoQ10•Supportscardiovascularandprostatehealthandlowercholesterol

IdEAl fOr mEN Of All AGESSUPPLEMENT FACTS

ServingSize:2Softgels ServingsPerContainer:90

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:PumpkinSeedOil,SoftgelCapsule(gelatin,glycerin,water,carob),SoyLecithin,BeeswaxandCinnamon(Cinnamomumcassia)barkoil Not manufactured with wheat, gluten, milk, eggs, fish or shellfish ingredients.

Amt/Serving DV%*VitaminA(60%asBeta-Carotene(Betatene®)and40%RetinylPalmitate) 10,000IU 200%VitaminC(fromCalciumAscorbate) 250mg 417%VitaminD-3(asCholecalciferol) 1,000IU 250%VitaminE(asd-alphaTocopherol) 150IU 500%VitaminK(asMenaquinoneandPhytonadione) 80mcg 100%Thiamine(Vit.B-1)(fromThiamineHCl) 25mg 1667%Riboflavin(VitaminB-2) 25mg 1471%Niacin(VitaminB-3)(asNiacinamide) 35mg 175%VitaminB-6(fromPyridoxineHClandPyridoxal-5-Phosphate(P-5-P) 25mg 1250%Folate(asFolicAcid) 400mcg 100%VitaminB-12(asCyanocobalaminandMethylcobalamin) 120mcg 2000%Biotin 300 mcg 100%

Amt/Serving DV%*PantothenicAcid(VitaminB-5)(fromD-CalciumPantothenate) 50mg 500%Calcium(fromCal.Ascorbate,Aquamin®FSeaweedDerivedMineralsandCalciumPantothenate) 55mg 6%Iodine(fromPotassiumIodide) 225mcg 150%Magnesium(fromMagnesiumCitrateandAquamin®FSeaweedDerivedMinerals) 25mg 6%Zinc(fromZincBisglycinate)(TRAACS®) 15mg 100%Selenium(fromSeleniumAminoAcidComplex)(TRAACS®) 200mcg 286%Copper(fromCopperBisglycinate) (TRAACS®) 500mcg 25%Manganese(fromManganeseBisglycinate)(TRAACS®)2mg100%Chromium(fromChromiumChelavite®) (TRAACS®) 120mcg 100%

Amt/Serving DV%*Molybdenum(fromMolybdenumBisglycinate)(TRAACS®) 75mcg 100%Potassium(fromPotassiumChloride) 25mg <1%SawPalmettoExtract(Berry)(Serenoarepens)(min.85%FattyAcids) 160mg †Phytosterols(PlantSterols)(withBeta-Sitosterol) 50mg †AlphaLipoicAcid 25mg †Choline(fromCholineBitartrate) 25mg †GrapeSeedExtract(Vitisvinifera) 25mg †Inositol 10mg †CoQ10(asUbiquinone) 10mg †Lycopene(LYC-O-MATO®)(fromNaturalTomatoExtract) 3mg †Lutein(FloraGLO®)(fromMarigoldFlowers) 500mcg †

Men’s Superior Multi Softgels90 Softgels - $24.99

180 Softgels - $42.99 (SAVE $7)

www.LifesourceVitamins.com I 1-800-567-8122

Page 43: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

43www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

43

Research has proven that strength & endurance athletes, due to their intensity and frequency of their training programs, have higher nutritional requirements than regular athletes. Over 90% of these athletes do not get enough nutrients to reach full potential.

The nutrients in Men’s Ultra Sport Multi’s have been shown to be much more absorbable and utilizable by the body, meaning you get much more nutrition out of each serving. Men’s Ultra Sport Multi’s contain a full spectrum blend of vitamins and minerals and the timed-release functionality of the multivitamin which ensures that your body has a steady stream of vital nutrients throughout the day. So work hard, play hard, train hard and these multi’s will keep up with you!

ThisMultivitaminisspecificallydesignedforMenwhoarebetween18and75andarestillextremelyactiveintheirsportor their profession.

IdEAl fOr mEN Of All AGES SUPPLEMENT FACTS

Serving Size: 3 Softgels Servings per Container: 30

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:SoftgelCapsule(bovinegelatin,glycerin,water,carob),BeeswaxandSoyLecithin,ContainsSoy.MCTOilfromcoconut/palmkerneloil. Not Manufactured withwheat,gluten,milk,egg,fishorshellfishingredients.ProducedinaGMPfacilitythatprocessesotheringredientscontainingthesealler-gens.

Amt/Serving DV%*Calories 25Calories from Fat 20Total Fat 2.5 g 4%SaturatedFat 1.5g 8%TransFat 0g †VitaminA(100%asBeta-Carotene)(Betatene®) 5,000IU 100%VitaminC(asAscorbicAcid) 120mg 200%VitaminD-3(asCholecalciferol) 1,000IU 250%Vitamin E(fromd-alphaTocopherylAcetate) 100IU 333%Vitamin K(asMenaquinoneandPhytonadione) 45mcg 56%Thiamin(VitaminB-1)(fromThiaminHCI) 50mg 3333%Riboflavin(VitaminB-2) 50mg 2941%Niacin(VitaminB-3)(asNiacinamide) 50mg 250%VitaminB-6(fromPyridoxineHCI) 50mg 2500%Folate(asFolicAcid) 400mcg 100%

Amt/Serving DV%*VitaminB-12(asMethylcobalamin) 1,000mcg16,667%Biotin 300 mcg 100%PantothenicAcid(fromCalciumPantothenate) 50mg 500%Calcium[fromCalciumCarbonate(Aquamin®SeaweedDerivedMinerals)] 50mg 5%Iodine(fromPotassiumIodide) 225mcg 150%Magnesium(fromMagnesiumAspartate,Magnesium Citrate and Aquamin®SeaweedDerivedMinerals) 25mg 6%Zinc[fromZincBisglycinate(TRAACS®),ZincMonoL-methionineandZincAspartate) 15mg 100%Selenium(fromSeleniumGlycinateComplex) 200mcg 286%Copper(fromCopperBisglycinate)(TRAACS®) 2mg 100%Chromium(fromChromiumPicolinate) 200mcg 167%Molybdenum(fromSodiumMolybdate) 75mcg 100%MCT(MediumChainTriglycerides)Oil 1,500mg †

Amt/Serving DV%*Amino Acids, proprietary bland of:L-Leucine, L-Isoleucine, L-Valine,L-Glutamine, L-Arginine, Taurine(allfree-form) 175mg †TribulusterrestrisExtract(Fruit) 100mg †ZMA®(complexofZincMono-L-methionine,Magnesium/ZincAspartateand PyridoxineHCI) 100mg †CardioAid®-SPlantSterolEsters(withBeta-Sitosterol,plusCampesterol andStigmasterol) 100mg †PanaxGinsengExtract(Root) 100mg †Maca(Lepidiummeyenii)(Root) 50mg †GreenTeaExtract(Leaf) 50mg †SawPalmettoExtract(Fruit) 50mg †AlphaLipoicAcid 50mg †AloeVega(Leaf)(Concentrate) 50mg †Lutein(fromMariGoldExtract) 500mcg †Lycopene(fromNaturalTomatoExtract) 500mcg †

Men’s Ultra Sport Multi 90 Softgels - $24.99

LifeSourceVitaminsMen’sOnceDailyMulti,containsallofthebasicarrayofvitamins/mineralsinaonceperdayvegetariantablet,butalsokeyingredientsstudied,andshowntosupportmen’shealth,withavarietyofPlantFoods,Herbs,EnzymesandProbiotics.

•GreenFoods,Herbs,PlantFoodsandEnzymesfordigestionanduploading•ProbioticBlend,FolicAcidandBVitamins•SupportCardiovascularandProstatehealthandhelpslowercholesterol

IdEAl fOr mEN Of All AGES SUPPLEMENT FACTS

Serving Size: 1 Tablet Servings per Container: 30

**PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Other Ingredients: Cellulose,StearicAcid(vegetablesource),SiliconDioxideandModifiedCellulose. Contains noartificialcolors,flavorsorpreservatives;nowheat,gluten,milk,eggs,peanuts,treenuts,crustacean.

Amt/Serving DV%*VitaminA(50%beta-carotene,50%palmitate) 5,000IU 100%VitaminC(asascorbicacid) 120mg 200%VitaminD3(ascholecalciferol) 800IU 200%VitaminE(d-alphatocopherylsuccinate) 100IU 333%VitaminK1(asphytonadione) 100mcg 125%Thiamin(asthiaminhydrochloride) 25mg 1,667%Riboflavin 25 mg 1,471%Niacin(asniacinamide) 25mg 125%VitaminB6(aspyridoxinehydrochloride) 25mg 1,250%FolicAcid 800mcg 200%VitaminB12(ascyanocobalamin) 25mcg 417%Biotin 150 mcg 50%PantothenicAcid(asd-calcium pantothenate) 25mg 250%

Amt/Serving DV%*Calcium(fromcalciumcarbonate,dibasic calcium phosphate, calcium citratemalateandcalciumpantothenate) 50mg 5%Magnesium(frommagnesiumoxide) 25mg 6%Zinc(OptiZinc®) 20mg 133%Selenium(fromselenomethionine,aminoacidcomplex) 200mcg 167%Copper(aminoacidchelate) 2mg 100%Manganese(frommanganousgluconate) 2mg 100%Chromium(fromchromiumnicotinate) 200mcg 167%Molybdenum(fromsodiummolybdate) 75mcg 100%Choline(ascholinebitartrate) 20mg †Inositol 20mg †

Amt/Serving DV%*CitrusBioflavonoidComplex 25mg †Men’s Health BlendSawPalmetto(berry)2:1Extract 50mg †Spirulinaplatensis 50mg †Lycopene(fromTomato,natural) 1,000mcg †Vegetable Juice Blend(Kale[leaf].Spinach[leaf],DandelionGreens[leaf],Beet(betavulgaris)[root]) 10mg †DigestiveSupportBlendProtease,Amylase,Lipase,Cellulase 36mg †LactobacillusSporogenes(Probioticstrain) 25mg †BetaineHCI 10mg †

Men’s Once a Day Whole Food Multi 30 Tablets - $14.99, 90 Tablets $38.99 (SAVE $6)

www.LifesourceVitamins.com I 1-800-567-8122

Page 44: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

44 www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

44

Our Women’s Multi Vitamin & Mineral formula is designed for women who are in their child bearing years. This Multi will bridge the nutrient gap in your daily diet, while assisting in bringing your body back into a naturally balanced state. It’s widely known & accepted that a body in proper balance can heal itself. What makes Women’s Multi so effective?

•NaturalBeta-CaroteneasthesourceofVitaminA.(safe&effective)•RecommendedpotenciesofB-vitaminswithB-3,B-5&B-6.•Highpotencyfolate/folicacid–importantforwomen.•BufferedVitaminC(calciumascorbate)forreducedacidity.•ContainsAlbionLab’spatentedFerrochel®ironbisglycinate,whichisgentleonthestomach.•Non-GMO

fOr WOmEN AGES 20’S, 30’S & 40’S SUPPLEMENT FACTS

ServingSize:3Tablets ServingsPerContainer:30

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Other Ingredients:Cellulose,Silica,StearicAcid(vegetablesource),CroscarmelloseSodium,VegetarianCoatingandChlorophyll.VitaminEfromsoy.

Amt/Serving DV%*VitaminA(100%asBeta-Carotene) 10,000IU 200%VitaminC(fromCalciumAscorbateandAscorbylPalmitate) 300mg 500%VitaminD(asErgocalciferol) 1,000IU 250%VitaminE(asd-alphaTocopherylSuccinate) 200IU 667%VitaminK(asMenaquinoneK2andPhytonadioneK1) 80mcg 100%Thiamin(VitaminB-1)(fromThiaminHCl) 25mg 1667%Riboflavin(VitaminB-2) 25mg 1471%Niacin(VitaminB-3)(asNiacinamideandfromInositolHexanicotinate) 30mg 150%VitaminB-6(fromPyridoxineHClandPyridoxal-5-Phosphate(P-5-P)) 25mg 1250%Folate(asFolicAcid) 800mcg 200%VitaminB-12(asMethylcobalamin) 200mcg 3333%Biotin 300 mcg 100%

Amt/Serving DV%*PantothenicAcid(VitaminB-5)(fromD-CalciumPantothenate) 50mg 500%Calcium[fromCalciumCarbonate(Aquamin®TGRedAlgaeSeaMinerals)andCalciumAscorbate] 250mg 25%Iron(fromFerrochel®FerrousBisglycinate)(TRAACS®) 18mg 100%Iodine(fromPotassiumIodide) 150mcg 100%Magnesium(fromMagnesiumCitrateandAquamin®TGRedAlgaeSeaMinerals) 100mg 25%Zinc(fromZincBisglycinate)(TRAACS®) 15mg 100%Selenium(fromL-Selenomethionine) 200mcg 286%Copper(fromCopperBisglycinate) (TRAACS®) 1mg 50%Manganese(fromManganeseBisglycinate)(TRAACS®) 2mg 100%Chromium(fromChromiumPicolinate) 120mcg 100%

Amt/Serving DV%*Molybdenum(fromSodiumMolybdate) 75mcg 100%Potassium(fromPotassiumChloride) 25mg <1%Cranberry(Vacciniummacrocarpon)(Fruit) (Standardizedtomin.6%QuinicAcid) 100mg †PomegranateExtract(Fruit)[min.40%Punicalagins(PunicosidesAandB)] 50mg †OrganicAcai(Euterpeoleracea)(FruitSkinandPulp) 50mg †MangosteenExtract(FruitPeel)(Garciniamangostana)(min.10%Mangostin) 50mg †CoQ10(CoenzymeQ10) 30mg †AlphaLipoicAcid30mg†Choline(fromCholineBitartrate) 25mg †Inositol25mg†AloeVera(Leaf)(200:1Concentrate) 25mg †Lycopene(fromNaturalTomatoExtract) 500mcg †Lutein(fromMarigoldFlowers)

Women’s Superior Multi Tablets 90 Tablets - $21.99

In a perfect world women would get all their vitamins from the food they eat. Although it’s not impossible for most of us it’s improbable. The fact of the matter is that we live busy high-paced lives. We don’t always eat the right foods and therefore don’t always get the vitamins that we need. Women are especially susceptible to vitamin deficiency as many of us tend to put everyone and everything before ourselves. This means that we tend to our spouses, children, household chores, and work before we take the time out to take care of ourselves. Vitamin importance takes a backseat to these things as a result. What is the answer to the loss of vitamins in our busy life? Take a multivitamin.

•WithEveningPrimrose,Cranberry,GreenTea,HorsetailSilica,&CoQ10•Gentlerandeasiertoswallowandabsorb

fOr WOmEN AGE 30’S THrOUGH 50’SSUPPLEMENT FACTS

ServingSize:3Softgels ServingsPerContainer:30

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Suggested Usage: Take 3 Softgels daily with food. Other ingredients: SoftgelCapsule(gelatin,glycerin,water,carob),FlaxSeedOil,SoyLecithinandBeeswax Contains no: wheat, gluten, milk, egg, fish or shellfish ingredients.

Amt/Serving DV%*Calories 25Calories from Fat 20Total Fat 2 g 3%Protein 1g 2%Beta-Carotene(100%asBeta-Carotene) (Betatene®) 5,000IU 100%VitaminC(fromCalciumAscorbate) 200mg 333%VitaminD-3(asCholecalciferol) 1,000IU 250%VitaminE(asd-alphaTocopherol) 150IU 500%VitaminK(asMenaquinoneandPhytonadione) 80mcg 100%Thiamine(Vit.B-1)(fromThiamineHCl) 25mg 1667%Riboflavin(VitaminB-2) 25mg 1471%Niacin(VitaminB-3)(fromNiacinamideandInositolHexanicotinate) 25 mg 125%VitaminB-6(fromPyridoxineHClandPyridoxal-5-Phosphate(P-5-P)) 25mg 1250%Folate(asFolicAcid) 800mcg 200%VitaminB-12(asMethylcobalamin) 120mcg 2000%Biotin 300 mcg 100%

Amt/Serving DV%*PantothenicAcid(VitaminB-5)(fromD-CalciumPantothenate) 50mg 500%Calcium(fromAquamin®SeaweedDerivedMinerals,CalciumCarbonate,AscorbateandPantothenate) 140mg 14%Iron(fromFerrochel®IronBisglycinate)(TRAACS®)6mg33%Iodine(fromPotassiumIodide) 225mcg 150%Magnesium(fromMagnesiumCitrate,MagnesiumOxideandAquamin®SeaweedDerivedMinerals 100mg 25%Zinc(fromZincBisglycinate)(TRAACS®) 15mg 100%Selenium(fromSeleniumAminoAcidComplex)(TRAACS®)(Albion®) 200mcg 286%Copper(fromCopperBisglycinate)(TRAACS®) 1 mg 50%Manganese(fromManganeseBisglycinate)(TRAACS®) 2mg 100%Chromium(fromChromiumChelavite®)(TRAACS®) 120mcg 100%

Amt/Serving DV%*Molybdenum(fromMolybdenumBisglycinate)(TRAACS®) 75mcg 100%Potassium(fromPotassiumChloride) 25mg <1%EveningPrimroseOil(Oenotherabiennis)(Seed) 500mg †CranberryConcentrate(20:1)(Vacciniummacrocarpon)(Fruit) 100mg †HorsetailExtract(Equisteumarvense)(AerialParts)(min.8%Silica) 50mg †AlphaLipoicAcid 25mg †Choline(fromCholineBitartrate) 25mg †GrapeSeedExtract(Vitisvinifera) 25mg †GreenTeaExtract(Camelliasinensis)(Leaf) 25mg †Inositol 25mg †CoQ10(asUbiquinone) 10mg †Lycopene(LYC-O-MATO®)(fromNaturalTomatoExtract) 500mcg †

Women’s Superior Multi Softgels90 Softgels - $23.99

180 Softgels - $39.99 (SAVE $8)

www.LifesourceVitamins.com I 1-800-567-8122

Page 45: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

45www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

45

Women’sOnceDailymulticontainsnotonlybasicnutritionalsupportofvitaminsandmineralsinonevegetariantablet,butalsokeyingredientsobservedinstudiestosupportfemalehealth,includingavarietyofHerbs,PlantFoods,EnzymesandProbiotics.

•WholeFoodBased•MadewithGreenFoods-Kale,SpinachandDandelion•EnzymesandProbioticsfordigestionandAbsorption•ContainsDongQuai•120mgofVitaminC•800IUVitaminD3•AllBVitamins•FolicAcid•Magnesium,Zinc,Selenium

SUPPLEMENT FACTS

Serving Size: 1 Tablet Servings per Container: 30

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Other Ingredients:Cellulose,StearicAcid(vegetablesource),ModifiedCellulose,SiliconDioxideandGlycerin Contains noartificialcolors,flavorsorpreservatives;nowheat,gluten,milk,eggs,peanuts,treenuts,crustacean.

Amt/Serving DV%*VitaminA(50%beta-carotene, 50%palmitate) 5,000IU 100%VitaminC(asascorbicacid) 120mg 200%VitaminD3(ascholecalciferol) 800IU 200%VitaminE(d-alphatocopherylsuccinate) 100IU 333%VitaminK1(asphytonadione) 100mcg 125%Thiamin(asthiaminhydrochloride) 25mg 1,667%Riboflavin 25 mg 1,471%Niacin(asniacinamide) 25mg 125%VitaminB6(aspyridoxinehydrochloride) 25mg 1,250%FolicAcid800mcg200%VitaminB12(ascyanocobalamin) 25mcg 417%Biotin 150 mcg 50%PantothenicAcid (asd-calciumpantothenate) 25mg 250%Calcium(fromcalciumcarbonate,dibasiccalciumphosphate,calcium citrate malate andcalciumpantothenate) 200mg 20%Magnesium(frommagnesiumoxide) 100mg 25%Zinc(OptiZinc®) 10mg 67%

Amt/Serving DV%*Selenium(fromselenomethionine, aminoacidcomplex) 200mcg 167%Copper(aminoacidchelate) 1mg 50%Manganese(frommanganousgluconate) 2mg 100%Chromium(fromchromiumnicotinate) 200mcg 167%Molybdenum(fromsodiummolybdate) 75mcg 100%Choline(ascholinebitartrate) 20mg †Inositol 20mg †Boron(aminoacidcomplex) 1mg †CitrusBioflavonoidComplex 25mg †Women’s Health Blend(DongQuai[root]4:1Extract,Spirulinaplatensis,WildYamRootExtract) 125mg †Vegetable Juice Blend(Kale[leaf].Spinach[leaf},DandelionGreens[leaf],Beet(betavulgaris)[root]) 10mg †DigestiveSupportBlendProtease,Amylase,Lipase,Cellulase 36mg †Lactobacillussporogenes(Probioticstrain) 25mg †BetaineHCI 10mg †

Women’s Once a Day Whole Food Multi 30 Tablets - $14.99, 90 Tablets $38.99 (SAVE $6)

WeatLifeSourceVitaminsareproudtoofferthiseversocompletePrenatalMultiwithDHA.Thereisnomoreimportanttimeforwomentotakemultivitaminsaswhentheyare

pregnant,andfranklyafewmonthsbeforetheygetpregnantaswell.OurPrenatalisdesignedforwomenwhoaretryingtoconceive,arepregnant,ornursing,asweallhave

learnedhowimportantnursingistothechild’slifelonghealth.Theperfectcombinationof33nutrientsincludingDHAforahealthyMom&Babyduringthisveryspecialtime.

PregnantwomendependonDHAtopromotehealthyfetaldevelopment.AccordingtotheAcademyofNutritionandDietetics,theaveragewomanonlyeats2ouncesofthe

recommended8to12ouncesoffishperweekduringpregnancy.ThisisexactlywhyweaddedDHAtothesemulti’s.

SUPPLEMENT FACTS

Serving Size: 3 Tablets Servings per Container: 60

Directions: PregnantorLactatingwomen,takethreetabletsdaily.

Amt/Serving DV%*VitaminA 8000IU 100%VitaminC 180mg 300%VitaminD-3 400IU 100%Vitamin E 30IU 100%VitaminB1 15mg 882%VitaminB2 17.5mg 875%Vitamin B3 Niacin 20mg 100%VitaminB6(asPyridoxineHCI) 10mg 400%FolicAcid 800mcg 100%Vitamin B12 12mcg 150%Biotin 300mcg 100%PantothenicAcid 30mg 300%Calcium 660mg 51%Iron 18mg 100%Iodine from kelp 150mcg 100%Magnesium 900mg 200%Zinc 15mg 100%Selenium 30mcg 43%Copper 100mcg 5%Manganese 3mg 150%Chromium 25mcg 21%

Amt/Serving DV%*

Molybdenum 25mcg 33%

Potassium 25mg <1%

DHA 100mg †

L-Taurine 50mg †

LemonBioflavonoids 40mg †

Inulin(FOS) 30mg †

Choline 15mg †

DHEA 10mg †

Inositol 10mg †

PABA 5mg †

Rutin 5mg †

L-HistidineHCL 3mg †

Octacosanol 50mcg †

Protease50000HUT/GM 1800HUT †

Amylase5000KB/GM 140DU †

Lipase1000FIP/GM 1.5LU †

Cellulase1000CU/GM 1.75CU †

LactobacillusSporogenes 1.5Million †

Pre-Natal Plus with DHA Multi Vitamin 180 Tablets - $19.99

www.LifesourceVitamins.com I 1-800-567-8122

Page 46: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

46 www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

46

OurChildrensMultiisaPhytoNutrientWholeFoodbasedmultivitamin/mineralsupplementenrichedwithPhytoFruitsandPhytoVeggies.CompleteB-complexformulabalancedformentalclarityandimmunestrength.LifeSourceVitaminsChildren’sMultivitamincontainsBetaCaroteneProVitaminA,Bioflavonoids,and400IUofVitaminD3,asrecommendedbytheAmericanAcademyofPediatrics.LoadedwithantioxidantsprovidedfromourPhytoFruitsandVeggiestoprotectkidsfromenvironmentalpollutantsandstress.Andbestofall,theyaresugarFREE,notlikemostothermajorbrandsthatarepackedwithunnaturalsugar,sucrose,sucraloseorotherharmfulsweeteners!OursissweetenedsimplybythePhytoFruitsinsidetheseKids’Multi’s.

We Consider This Kids Multi to be the Best in the World, Sold Anywhere at Any Price! Loaded with Phyto Fruits and Veggies and they will love the taste SUPPLEMENT FACTS 4+ YEARS OLD

Serving Size: 1 Tablet

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Kids & Teens Chewable Multi Vitamins & Minerals

Amt/Serving DV%*Beta Carotene 5000 IU 100%Vitamin C(withRoseHips,BufferedwithMineralAscorbates) 100mg 166%VitaminD3 400IU 100%Vitamin E(naturald-alpha) 45IU 150%VitaminB1(Thiamin) 3.4mg 226%VitaminB2(Riboflavin) 4.1mg 239%Niacinamide 24 mg 120%Vitamin B5 (PantothenicAcid) .22mg 220% Amt/Serving DV%*Vitamin B6 2 mg 100%Vitamin B12 3 mcg 100%Choline 5mg †Inositol 2.5 mg *

Amt/Serving DV%*PABA .5mg *Biotin 150 mcg 50%Folic Acid 200 mcg 50%Vitamin K1 10 mcg *CitrusBioflavonoidComplex(VitaminP) 30mg *Zinc,Elemental(Chelated) 5.25 mg 35%Selenium(YeastFree) 10mcg *Calcium, Elemental 100 mgMagnesium, Elemental 50 mg 12.50%Iron,Elemental(Chelated) 6.3mg 35%Chromium(asPicolinate) 10mcg *Iodine(askelp) 75mcg 50%Phosphorus 10mcg 1%Molybdenum 5 mcg *Copper 200 mcg 10%

Phyto-Nutrients Whole foods Concentrate 225 mg *Whole Food Vegetable Complex:Carrots, Broccoli, Spinach, Celery, Beets, Amt/Serving DV%*GreenBeans&Parsley.Whole Food Fruit Complex: OrangeJuice,PineappleJuice,RaspberryJuice,DriedApples,DriedApricots,DriedPeaches,DriedCherries,DriedPlums&Figs.SuperProteinConcentrateEnzyme Blend: Amylase, Protease,Lipase 25mg *Acerola Cherry Juice Concentrate 10 mg *HesperidinComplex 10mg *Rutin 5 mg *

90 Chewable - $19.99 180 Chewable - $34.99 (SAVE $5)

Duringthistimeofyourchild’slifetheirbrainissettingthefoundationforallmentalcapacitiesforlife,theirhealthisformulatingwhethertheywillbeahealthychildaswellasalloftheir bodily functions are growing & processing to ensure efficiencies for the rest of their lives. No time is more critical to help with their nutritional intake than this time as kids can be picky eaters and not get what they truly need to grow and be healthy and reach their full potential.*Children need a sound nutritional basis upon which to grow and develop, so it’s important to ensure that they eat a balanced diet. Of course, many children do not eat the right foods, opting instead for fast foods and foods containing more sugar than nutritional value. In order to ensure that your children get all the nutrients needed, you may choose to give them a daily vitamin. However, the last thing you want in that vitamin is a bunch of sugar. So what is a parent to do? Try LifeSource Vitamins Gummies for your kids, which is a multivitamin formulated specifically to ensure that children receive the nutrients they need to properly support their bodies during their years of growth and development.

LifeSource Vitamins All Natural Kids Gummies Contain Essential Vitamins and Minerals for your kids growing brains and bodies:•VitaminA:HealthyEyeFunctioningandImmuneSystem.MorethanoneandahalfcupsofBroccoli.•VitaminC:HelpsSupportImmuneSystem.Morethan2Tangerines•VitaminD:SupportsHealthierBones,Teeth,MuscleandImmuneSupport•VitaminE:AntioxidantandEssentialNutrient,HeartandImmuneHealth.•BVitamins:Niacin,VitaminB6,FolicAcid,VitaminB12,BiotinandPantothenicAcidtohelpconvertthefoodweeatintoEnergy.•Iodine:AnEssentialMineral•Zinc:ImmuneSupport

Other Highlights:•AllNaturalFruitFlavors:NoSynthetics!•Colorsarederivedfromthefruitweuse:NoSyntheticDyes!•GlutenFree•NoYeast•NoPreservatives•45DaySupply

SUPPLEMENT FACTS

Serving Size: 2 Gummies Servings per Container: 45

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Amt/Serving DV%*Calories 15TotalCarbohydrates(Ages2to4) 4g †Sugars 3g †TotalCarbohydrates(Ages4&Up) 4g 1%Sugars 3g †VitaminA(palmitate) 2100IU 42/84%

Amt/Serving DV%*VitaminC(ascorbicacid) 20mg 50/33%VitaminD(cholecalciferol) 400IU 100%VitaminE(dl-AlphaTocopherylace 16.5IU1 65/55%VitaminB-6(pyridoxinehydrochloride) 2mg 286/100%FolicAcid 260mcg 130/65%VitaminB-12(cyanocobalamin) 6mcg 200/100%

Amt/Serving DV%*Biotin 60mcg 40/20%PantothenicAcid(calciumpantothenate) 5.2mg 104/52%Iodine(potassiumIodine) 42mcg 60/28%Zinc(citrate) 2.7mg 34/18%Choline(bitartrate) 40mcg †Inositol 40mcg †

Kids & Teens Multivitamin Gummies 90 Gummies - $15.99

www.LifesourceVitamins.com I 1-800-567-8122

Page 47: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

47www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

47

LifeSource Vitamins Kid’s & Teens Liquid Multivitamins & Minerals is a new, full spectrum blend of liquid vitamins designed to provide children with the important vitamins and minerals that their bodies need on a daily basis to grow healthy minds and bodies. Great tasting and a powerful full day of nutrients in one serving. Ideal for all children, and teenagers as well! If youwantthemostcompletemultivitaminavailable,orifyourchildwillnottakechewablemulti’s,thesearewhatjustyouneed.Youcanmixitrightintotheirjuiceduringtheday.Flora®ScFOSPrebioticBlendwithGreenPapayaandBromelaingentlystrengthenstheimmuneanddigestivesystem.HiORACSuperiorPhytoFoodFruit&VeggieComplex-Loadedwith:Apricots,Bananas,Broccoli,Cabbage,Cherries,Cranberries,Ginger,Grapefruits,GreenTea,Kale,Kiwis,Lemons,Limes,Mangoes,Oranges,Pineapples,Plums,Raspberries,RedPeppers,Spinach,SweetenedwithXylitolnotSucralose,foritsbeneficialproperties.NoCrystallineFructose!WholeFoodMultiSpecificallyFormulatedforourkidsandyours.!

SUPPLEMENT FACTS

ServingSize:Children1-4yearsold1/2Tablespoon,Children5andolder1Tablespoon ServingsperContainer:64/32

Amt/Serving DV% (1- 4) DV% (4-12)Calories 10 † †Sodium <10mg † †Carbohydrates 4g † †DietaryFiber 1g 5% 4%Sugars 0g † †VitaminA(asNatural Beta-Carotene) 2,500IU 100% 50%VitaminC(asAscorbicAcid,CitrusBioflavonoids) 120mg 300% 200%VitaminD3(asCholecalciferol) 400IU 100% 100%VitaminE(asd-alpha-tocopherol acetate) 20IU 100% 65%VitaminB1(asThiamineHCL) 2mg 140% 135%VitaminB2(asRiboflavin-5-Phosphate) 2 mg 140% 120%VitaminB3(asNiacinamide) 10mg 100% 50%VitaminB6(asPyridoxineHCL) 2mg 100% 100%Folate(100%fromcertifiedorganicCitrusLimonextract(peel)asOrgen-FA®) 400 mcg 200% 100%VitaminB12(asMethylcobalamin) 15mcg 500% 250%Biotin 65 mcg 45% 20%PantothenicAcid(asd-calciumpantothenate) 10mg 200% 100%Calcium(asCalciumCitrateandAquamin®SeaMinerals) 25mg 8% 5%Iodine(PotassiumIodine) 50mcg 70% 30%Magnesium(asMagnesiumCitrateandAquamin®seaminerals) 25mg 13% 25%

Amt/Serving DV% (1- 4) DV% (4-12)Zinc(asZincPicolinate) 5mg 60% 30%Selenium(asSeleniumamino acidchelate) 10mcg † 14%Manganese(asManganeseBisglycinateChelate) 1mg † 50%Chromium(asChromiumPolynicotinate)10mcg † 8%Molybdenum(asSodiumMolybdenate) 20mcg † 27%Potassium(asPotassiumCitrate) 50mg † †Choline(Bitartrate) 20mg † †Inositol 15mg † †Aquamin®S(asMineralizedRedAlgaeSeaMinerals)(Lithothamniumcoralloides/Lithothamniumcalcareum)(WholePlant)44mg † †Wellberry™(VitaminC,IndianGooseberryFruitExtract,CitrusBioflavonoids, VegetableFattyAcids) 205mg † †DigestiveHealthBlend(Isomalto-oligosaccharides(prebioticfiber),NutraFlora®(ScFOSPrebioticBlend),GreenPapayajuice,Bromelain1 225mg † †Fruits&GreensAntioxidantFruitandVegetableBlend(extractsofBanana,Kiwi,Mango, Pineapple,Cranberry,Cherry,Raspberry,RedPepper,Plum, Apricot, Ginger, Broccoli, Spinach, Kale, Cabbage, Orange, Grapefruit,Lemon,Lime,GreenTea) 50mg † †

Kids & Teens Liquid Multi Vitamin & Minerals 16 fl oz - $26.99

•100%ofVitamins:A,C,D3,E,B1,B2,B3,B6,FolateandB12•AFullSpectrumofVitamins,MineralsandEnzymes.•98%Absorptionwithin90seconds.•VitaminA(asnaturalbetacarotene)•VitaminD3–TheAmericanAcademyofPediatricshasdoubledit’srecommendationofVitaminDintake.Thismultihasyourkidscovered.

•OrganicIngredients–NonGMO–GlutenFree•SugarFree–SoyFree- 100% Vegetarian & Vegan

•NoArtificialFlavorsandNoArtificialSweeteners•VitaminCw/Bioflavonoids-120mg.300%DailyAllowance

•TraceMineralBlend-Aquamin®-MineralizedRedAlgae•PrebioticMulti-FiberComplexandDigestiveSupport-NutraFlora®ScFOSPrebioticBlendwithGreenPapayaandBromelaingentlystrengthenstheimmuneanddigestive system.

•HiORACSuperiorPhytoFoodFruit&VeggieComplex-Loadedwith:Apricots,Bananas, Broccoli, Cabbage, Cherries, Cranberries, Ginger, Grapefruits, Green Tea, Kale,Kiwis,Lemons,Limes,Mangoes,Oranges,Pineapples,Plums,Raspberries,RedPeppers,Spinach,

•SweetenedwithXylitolnotSucralose,foritsbeneficialproperties.•NoCrystallineFructose

Other Ingredients:Cellulose,Silica,ModifiedCelluloseGum,StearicAcid(VegetableSource),MagnesiumStearate(VegetableSource),Glycerin,NaturalCinnamonOil. Contains Noartificialcolors,flavors,orpreservatives;nowheat,gluten,milk,eggs,peanuts,treenuts,crustaceanshellfishorfish*DailyValuenotestablished.

The LifeSource Vitamins Ultra Teen Multi provides older children, teens, and adults with a complete multivitamin containing100%oftheDailyAllowanceof29vitamins,minerals&nutrientsthatarealltooofteninadequatelysuppliedin our teens daily diet. Our Ultra Teen Multivitamins contain higher potencies than in typical children’s supplements, in a combination that gives special attention to the balance and bioavailability of nutrients.

SUPPLEMENT FACTS

ServingSize:1Tablet ServingsPerContainer:60

Amt/Serving DV%*Vitamin A(80%aspalmitate,20%asbeta-carotene) 5,000IU 100%VitaminC(asascorbicacid) 120mg 200%VitaminD3(ascholecalciferol) 400IU 100%VitaminE(asd-alphatocopheryl succinate) 30IU 100%Thiamin(asthiaminmononitrate 30mg 2000%Riboflavin 30 mg 1760%Niacin(asniacinamide) 30mg 150%VitaminB6(aspyridoxinehydrochloride) 30mg 1500%Folic Acid 400 mcg 100%VitaminB12(ascyanocobalamin) 30mcg 500%

Amt/Serving DV%*Biotin 300 mcg 100%PantothenicAcid(asd-calcium pantothenate) 10mg 100%Calcium(fromcalciumcarbonate,dibasiccalciumphosphateandcalciumpantothenate) 100mg 10%Iron(fromferrousfumarate) 9mg 50%Phosphorus(fromdibasiccalciumphosphate) 7 mg 6%Iodine(frompotassiumiodide) 150mcg 100%Magnesium(frommagnesiumoxide) 100mg 25%Zinc(fromzincoxide) 15mg 100%Selenium(fromsodiumselenate) 70mcg 100%Copper(fromcupricoxide) 2mg 100%Manganase(frommanganousgluconate) 2mg 100%

Amt/Serving DV%*Chromium(fromchromiumchloride) 120mcg 100%Molybdenum(frommolybdenumaminoacidchelate) 75mcg 100%LemonBioflavonoidComplex 75mg *Rutin(Saphorajaponica) 45mg *Choline(bitartrate) 30mg *Inositol 30 mg *OrganicWholeFoodBlend(Organicspinach,organicblueberry,organiccarrots) 30mg *Spirulina 5 mg *Chlorella 5 mg *

Ultra Teen Multi Vitamin & Minerals 60 Tablets - $15.99

www.LifesourceVitamins.com I 1-800-567-8122

Page 48: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

48 www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

48

LifeSource Vitamins advanced Ultra Senior Multi-Vitamin is a great vegetarian formula for Men ages 50 and older. Contains nutrients ideal

forBoneSupport,EyeSupport,HealthyDigestion,BloodPressure&CholesterolSupport.LifeSourceVitaminsMen’sUltraSenior’salso

contains Co-Enzyme, or activated forms of B-vitamins, for ease and assurance of activation in the body. Enhanced chelated minerals for

optimum bioavailability. Moderate and effective doses of essential nutrients for the entire body. Enzymes support nutrient digestion and

assimilation, sparing the body’s valuable supply of enzymes and saving energy in the digestive process.

This unique formula is designed to focus on what a man’s body needs as he ages, and contains unique nutrients not found in other multi

vitamins,suchasLutien/Zeaxanthin,Lycopene,Bilberry,GrapeseedExtract,SawPalmetto,Lemonbioflavonoidcomplex,Cinnamon

Powder,TomatoPowder,Enzymes,BetaineHCI,Gingerandmuchmore.

IDEAL FOR MEN OVER 50 YEARS OF AGE

SUPPLEMENT FACTS

ServingSize:3Tablets ServingsPerContainer:60

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Cellulose,modifiedcellulosegum,stearicacid(vegetablesource),silica,magnesiumstearate(vegetablesource),glycerin,naturalcinnamonoil. Contains Noartificialcolors,flavorsorpreservatives;nowheat,gluten,milk,eggs,peanuts,treenuts,crustaceanshellfishorfish.Lutemax™2020trademarkbelongstoOmniActiveHealthTechnologies Ltd. Lyc-O-Mato©isaregisteredtrademarkofLycoRed,NaturalProductIndustries,Ltd.

Amt/Serving DV%*VitaminA(asbeta-carotene) 2,500IU 50%VitaminC(asascorbicacid) 300mg 500%VitaminD3(ascholecalciferol) 400IU 100%VitaminE(d-alphatocopherylsuccinate) 75IU 250%Thiamin(asthiaminmononitrate) 60mg 4000%Riboflavin 60 mg 3529%Niacin(asnicotinicacid) 30mg 150%VitaminB6(aspyridoxineHCI) 60mg 3000%FolicAcid 800mcg 200%VitaminB12(ascyanocobalamin) 400mcg 6667%Biotin 300 mcg 100%Pantothenicacid(asd-calciumpantothenate) 100 mg 1000%Calcium(fromcalciumcitrate) 240mg 24%

Amt/Serving DV%*Iron(fromferrousfumarate) 4mg 22%Iodine(frompotassiumiodine) 150mcg 100%Magnesium(frommagnesiumoxide) 200mg 50%Zinc(fromzincoxide) 30mg 200%Selenium(fromL-selenomethionine) 200mcg 286%Copper(fromcupricoxide) 2mg 100%Manganese(frommanganousgluconate) 2mg 100%Chromium(fromchromiumchloride) 200mcg 167%Molybdenum(fromsodiummolybdate) 45mcg 60%Inositol 30mg †Choline(bitartrate) 180mg †Lutien/Zeaxanthin(fromLutien™2020)(fromTageteserecta) 3.75mg †Lycopene(Lyc-O-Mato©) 2mg †

Amt/Serving DV%*Bilberry 50mg †

Grapeseedextract 20mg †

Sawpalmetto(Serenoarepens)(berry) 100mg †

Lemonbioflavonoidcomplex 10mg †

Cinnamonpowder 100mg †

Tomatopowder 10mg †

EnzymeBlend(Papain,Bromelain,Lipase,

Protease,Amylase) 20mg †

BetaineHCI 25mg †

Ginger 40mg †

Boron 200mcg †

Vanadium 2mcg †

Men’s Senior Multi Vitamin $38.99 (2 Month Supply - Only $19.50 per month)

LifeSourceVitaminshascreatedaSuperiorSeniorMultivitaminjustforWomenover50.OurUltraSeniorWomen’smultiplevitaminandmineral will help to bridge the nutrient gap in your daily diet. These will truly help get your body back to a balance so it can start healing itself.Wefeelthisisthebestmultiavailable,justcomparelabels!Intoday’sworldofprocessedfoodsandfastpacedlifestyles,mostofus do not get the daily recommended allowance of vitamins, minerals and other nutrients. LifeSource’s multivitamins & minerals are formulated to provide a broad range of nutrition in a synergistic manner.

UniquelyformulatedforthefemalebabyboomerwithAlphaLipoicAcid,Lutien&antioxidantsforeyeandcellhealth.

IDEAL FOR WOMEN OVER THE AGE OF 50

SUPPLEMENT FACTS

ServingSize:3Tablets ServingsPerContainer:60

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Cellulose,modifiedcellulosegum,stearicacid(vegetablesource),magnesiumstearate(vegetablesource),Silica,cinnamonoil,glycerin. Contains Noartificialcolors,flavorsorpreservatives;nowheat,gluten,milk,eggs,peanuts,treenuts,crustaceanshellfishorfish.Lutemax™2020trademarkbelongstoOmniActiveHealthTechnologies Ltd. CranMax©andCRAN-MAX©logotypeareusedunderlicencewithpermissionoftheirproprietor.

Amt/Serving DV%*VitaminA(asbeta-carotene) 5,000IU 100%VitaminC(asascorbicacid) 300mg 500%VitaminD3(ascholecalciferol) 400IU 100%VitaminE(d-alphatocopherylsuccinate) 75IU 250%Thiamin(asthiaminmononitrate) 60mg 4000%Riboflavin 60 mg 3529%Niacin(asnicotinicacid) 20mg 100%VitaminB6(aspyridoxineHCI) 60mg 3000%FolicAcid 800mcg 200%VitaminB12(ascyanocobalamin) 400mcg 6667%Biotin 600 mcg 200%Pantothenicacid(asd-calciumpantothenate) 50mg 500%Calcium(fromcalciumcitrate) 240mg 24%

Amt/Serving DV%*Iron(fromferrousfumarate) 10mg 56%Iodine(frompotassiumiodine) 150mcg 100%Magnesium(frommagnesiumoxide) 240mg 60%Zinc(fromzincoxide) 15mg 100%Selenium(fromL-selenomethionine) 200mcg 286%Copper(fromcupricoxide) 2mg 100%Manganese(frommanganousgluconate) 2mg 100%Chromium(fromchromiumchloride) 200mcg 167%Molybdenum(fromsodiummolybdate) 45mcg 60%Inositol 30mg †Choline(bitartrate) 120mg †Lutien/Zeaxanthin(fromLutien™2020)(fromTageteserecta) 3.75mg †Bilberry 50mg †

Amt/Serving DV%*Pomegranatepowder 15mg †AlphaLipoicAcid 50mg †Grapeseedextract 20mg †Soy(non-GMO) 30mg †Cranberry(CranMax©) 25mg †Lemonbioflavonoidcomplex 200mg †Cinnamonpowder 100mg †Tomatopowder 10mg †EnzymeBlend(Papain,Bromelain,Lipase,Protease,Amylase) 30mg †BetaineHCI 25mg †GingerRootExtract 60mg †Boron 3,000mcg †Vanadium 2mcg †

Women’s Senior Multi Vitamin $38.99 (2 Month Supply - Only $19.50 per month)

www.LifesourceVitamins.com I 1-800-567-8122

Page 49: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

49www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

49

LifeSource’s advanced Ultra Senior Multi-Vitamin is a great formula for men or women ages 50 and older. This is designed to

focus on what the body needs as we age and contains unique nutrients not found in other multi vitamins such as Coenzyme

Q10,GinkgoBiloba,AlphaLipoicAcid,Phosphatidylserine,Lycopene,BilberryExtract,Octacosanol,andmore.Thiscombination

of60ingredientsputsfocusoncardiovascular,neurologicalandocularhealth,aswellasdefensiveantioxidantsupport.

IDEAL FOR ANYONE OVER 50 YEARS OF AGE

SUPPLEMENT FACTS

Serving Size: 3 Tablets Servings per Container: 60

*DailyValuenotestablished. Other ingredients: Stearicacid,cellulose,silicondioxide,pharmaceuticalglaze

Amt/Serving DV%*VitaminA(2000IUaspalmitateand7500IUasbeta-carotene) 9500IU 190%VitaminC(asAscorbicAcid& CaAscorbate) 300mg 500%VitaminD3(Cholecalciferol) 200IU 50%VitaminE(asd-alphatocopheryl succinate) 200IU 667%VitaminK(asPhytonadione) 2.5mcg 3%Thiamin 25 mg 1667%Riboflavin 25 mg 1471%Niacin(andasNiacinamide) 25mg 125%Vitamin B 6 (PyridoxineHCI90%,P-5-P10%) 25mg 1250%Folic Acid 200 mcg 50%VitaminB12(Methylcobalamin) 25mcg 417%Biotin 150 mcg 50%PantothenicAcid(asCaPantothenate) 25mg 250%Calcium(asCaCitrate) 300mg 30%Iodine(fromkelp) 35mcg 23%Magnesium(asMgCarbonate) 150mg 38%Zinc(asZnGluconate) 10mg 67%Selenium(asSeAAC) 25mcg

Amt/Serving DV%*Copper(asCuAAC) 0.025mg 1%Manganese(asMnGluconate) 2.5mg 125%Chromium(asCrPolynicotinate) 25mcg 21%Molybdenum(asMoAAC) 25mcg 33%Boron(asBAAC) 0.5mg *Potassium(asKcitrate) 25mg 1%Silicon(HorsetailRush) 3mg *Vanadium(asVAAC) 10mcg *Choline(asCholineBitartrate) 50mg *Inositol 25 mg *PABA(para-aminobenzoicacid) 25mg *L-Cysteine(entericcoated) 25mg *Glutamic Acid 25 mg *DL-Methionine(entericcoated) 25mg *L-Aspartic Acid 50 mg *Phosphatidylserine 12.5mg *Octacosanol 500 mcg *Soy Lecithin 50 mg *

Amt/Serving DV%*Gamma Linolenic Acid 2.5 mg *Alpha Lipoic Acid 15 mg *Coenzyme Q10 5 mg *Lycopene 2.5 mg *Bioperine® 2.5 mg *Ginkgo Biloba 5 mg *RNA(ribonucleicacid) 5mg *MixedCitrusBioflavonoids 100mg *Hesperidin 12.5 mg *Rutin 12.5 mg *Pectin 12.5mg *Betaine HCl 15 mg *Bromelain 2 mg *Papain 2mg *BilberryExtract4:1 20mg *Lutein 1.5 mg *A proprietary blend of vegetarian enzymes(amylase,protease,lipase,hemicellulase, andlactase) 10mg *

Seniors Ultra Multi Vitamin $38.99 (2 Month Supply - Only $19.50 per month)

SEE PAGE 43

www.LifesourceVitamins.com I 1-800-567-8122

Page 50: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

50 www.LifesourceVitamins.com I 1-800-567-8122

Olive Leaf Extract 750 mg 60 Veg Caps - $14.99

SUPPLEMENT FACTS

Serving Size: 1 Veg Cap Servings per Container: 60

Amt/Serving DV%*OliveLeaf(20%extract)(standardizedtocontain150mgofOleuropein) 750mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Cellulose, vegetable magnesium stearate and silicondioxide. Suggested usage: Take 1 capsule 1 to 2 times daily.

Oregano Oil 90 Softgels - $16.99

•Clearcongestion•Antibacterial&antifungalproperties•Soothedigestivetract•PowerfulAntioxidant

SUPPLEMENT FACTS

ServingSize:1Softgel ServingsPerContainer:90

Amt/Serving DV%*Oregano Oil(Origanumvulgare)(min.55%Carvacrol) 0.2mL/181mg †Ginger Oil(Zingiberofficinale) 0.2mL/17.6mg †Fennel Oil(Foeniculumvulgare) 0.2mL/19.3mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValue not established. Other Ingredients:SoftgelCapsule(gelatin,glycerin,water,entericcoating,carob)andExtraVirginOliveOil. Not manufactured with yeast, wheat, gluten, soy, milk, egg, fish or shellfish ingredients.

Omega 3SuperEPA/DHA

100 Softgels - $13.99 200 Softgels - $23.99

(SAVE $4)

Omega-3 fatty acids have earned a wide reputation for preventing heart disease. The Omega-3 fatty acids help lowerLDLcholesterolandcontributetofunctionsthathelpthinblood and decrease plaque along the artery walls, improving blood circulation. Omega 3 has been shown to increase your overall health and energy level.

SUPPLEMENT FACTSServingSize:1Softgel/300mg ServingsPerContainer:100 Amt/Serving DV%*EicosapentaenoicAcid(EPA) 180mg †DocosahexainoicAcid(DHA) 120mg †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Super Omega 3-6-990 Softgels - $14.99

180 Softgels - $26.99 (SAVE $3)

BlendofFish,BorageandOrganicFlaxSeedOils.Thiscombination of well-known nutritional oils provides a unique balance of Omega-3 and Omega-6 essential fatty acids plus Omega-9, a non-essential, but beneficial fatty acid.

•Nervetransmission•Divisionofcells(growthandhealingprocesses)•Responsetopain,swellingandinflammation•Transportingofoxygenfromcellstotissues•Supportingimmuneresponse•Providingenergytotheheartmuscle/hearthealth

SUPPLEMENT FACTS

Serving Size: 2 Softgels Servings per Container: 45

Amt/Serving DV%*Calories 25Total Fat 2.5 g 3%Saturated Fat <.5 g 2%PolyunsaturatedFat 1.5g †MonounsaturatedFat .5g †Protein <1g 1%BorageOil(seed) 800mg †NaturalFishOilConcentrate 800mg †OrganicFlaxSeedOil 800mg †Naturally Occurring Fatty Acids(example)perservingOmega-3FattyAcids 604mg(126mgEPA,78mgDHA) †Omega-6FattyAcids 539mg(160mgGLA) †Omega-9FattyAcids 225mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Other Ingredients:SoftgelCapsule(bovinegelatin,glycerin,water)andVitaminE (asnaturald-alphatocopherolwithmixedtocopherols).Non-GMO ContainsFish(sardines,anchovies).VitaminEfromsoy

Ultra Omega-3PER BOTTLEPER BOTTLE

(SAVE $7)

90 Softgels - $21.99 180 Softgels - $36.99

The Natural Fish Oil Concentrate used in this softgel ismanufactured under strict quality control standards. It is tested to be free of potentially harmful levels of contaminants (i.e.mercury,heavymetals,PCB’s,dioxins,andothercontaminants)andisNon-GMO.

Specifically, the omega-3 fatty acids found in fish oil have been shown to:•Reducetheriskofheartattackorstroke•Lowerbloodtriglyceridelevels•Lowerbloodpressure•Decreaseinflammation•Reducejointstiffness•Lowercholesterollevels

SUPPLEMENT FACTS

ServingSize:1Softgel ServingsPerContainer:180

Amt/Serving DV%*Calories 10Calories from Fat 10Total Fat 1 g 2%*Saturated Fat <0.5 g <1%*TransFat 0g †PolyunsaturatedFat 1g †MonounsaturatedFat <0.5g †Cholesterol 0 mg 0%NaturalFishOilConcentrate 1,000mg †Omega-3 Fatty AcidsEicosapentaenoicAcid(EPA) 500mg †DocosahexaenoicAcid(DHA) 250mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: SoftgelCapsule(bovinegelatin,glycerin,entericcoating,water)andVitaminE(asnaturald-alphatocopherol). Contains: Fish(anchovies).VitaminEfromsoy.FishoilisaproductofPeruandChile. Not manufactured with yeast, wheat, gluten, milk, egg, or shellfish ingredients.

lIfESOUrCE VITAmINS HAS BEEN GIVING All PrOfITS TO fINE CHrISTIAN

OrGANIzATIONS fOr OVEr 27 yEArS

Page 51: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

51www.LifesourceVitamins.com I 1-800-567-8122

Ultra High PotencyLiquid Omega 3 8.5 fl oz - $24.99

HighPotencyOmega-3isadelicious,yeswesaiddeliciousway to complement any diet with a complete and balanced source of natural Omega 3 fatty acids. This essential fatty acid is vital to good health and has been scientifically researched for its role in supporting cardiovascular health and a normal, healthy immune and inflammatory response. ThisliquidcontainsthehighestcombinedlevelsofEPAandDHAofanyLifeSourceproduct.You’llloveits“LightlySweet”MapleSyrupflavor;plus,itssugarandsodiumfree.HighPotencyLiquidOmega-3canbetakenbythetablespoonormixedintosmoothies,yogurtorblendedbeveragestofortifyyour foods with optimal amounts of omega 3 fatty acids.

SUPPLEMENT FACTS

ServingSize:1Teaspoon(5mL) ServingsperContainer:50

Amt/Serving DV%*Calories 40Calories from Fat 40TotalFat 5g 8%EPA(eicosapentaenoicacid) 705mg †DHA(docosahexaenoicacid) 440mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Natural Maple Flavor, Natural Lemon Oil Flavor, Non-GMO Sunflower Lecithin, D-AlphaTocopherol(fromsunflowers),Rosemaryextract,LuoHanGuo,AscorbylPalmitate Contains no artificial colors, flavors, or preservatives, no wheat, gluten, milk, eggs, peanuts, tree nuts, soy, or crustacean shellfish.

Omega w/DHA Gummies 60 Gummies -$14.99

MostpeoplebelievethatfisharearichsourceofDHA,wheninfactfishgetDHAfromthealgaeintheirfoodchain.LifeSourceVitaminsgoesstraighttothesource,producingDHAfromthesame microalgae sources fish get it from. Grown in a controlled environment, our Gummies are a vegetarian and sustainable sourceofOmega3-6-9&DHA.

This product is for those 2 years or older, meaning it’s great for kids or adults. Also, it tastes great with natural Lemon and Orange flavors. Gluten-free and Vegetarian.

SUPPLEMENT FACTSServingSize:3Gummies ServingsPerContainer:20

Amt/Serving DV%*Calories 30TotalCarbohydrate(Ages2to4) 7g *Sugar 4 g *TotalCarbohydrate(Ages4&up) 7g 2%Sugars 4 g *VitaminC(ascorbicacid) 20mg 50/33%Sodium 20mg */1%

OmegaOil(Chia&DHA)-Omega-3(AlphaLinolenicAcid)1 30mg-Omega-6(LinolenicAcid) 65mg-Omega-9(OleicAcid) 30mg275mg *DHA(life’sDHA™fromalgae) 50mg *

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other ingredients:Softgelcapsule(gelatin,glycerin,water,entericcoating)andVitaminE (asnaturald-alphatocopherol)Containsfish(tuna).FishoilisaproductofIndia. NON-GMO

DHA 500 mg 90 Softgels - $24.99

Contrary to most leading fish oils available in the market place (whichcontainmoreEPAthanDHA),LifeSourceDHA-500contains500mgofDHAand250mgofEPAineach enteric-coated softgel.

DHA(docosahexaenoicacid)isalong-chainomega-3fattyacidthat comes from fish oil. It is the longest and most unsaturated of the omega-3 fatty acids and is considered physiologically essential in the proper growth and development of the brain, nervous system and retina to support optimal cognitive function.DHAaccumulatesinthebrainourfirstcoupleyearsoflife;nootheromegafattyaciddoesthis. DHA =brainfood.

•CardiovascularSupport•HelpswithCholesterolSupport•Canlowerbloodpressure

SUPPLEMENT FACTSServingSize:1Softgel ServingsPerContainer:90 Amt/Serving DV%*Calories 10Calories from Fat 10Total Fat 1 g 2%Saturated Fat 0 g 0%TransFat 0g †PolyunsaturatedFat 1g †MonounsaturatedFat 0g †Cholesterol 0 mg 0%NaturalFishOilConcentrate (1,000mg) †Omega-3 Fatty AcidsDocosahexaenoicAcid(DHA) 500mg †EicosapentaenoicAcid(EPA) 250mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other ingredients:Softgelcapsule(gelatin,glycerin,water,entericcoating)andVitaminE (asnaturald-alphatocopherol)Containsfish(tuna).FishoilisaproductofIndia.NON-GMO

Kids DHA 60 Chewables Softgels - $12.99

Recent research shows the important role the essential fatty acid DHAplaysinthedevelopingbrain.DHAisthefirstfattyacidused by the brain to form healthy cell membranes vital for cell signaling.Molecularlydistilledandtestedformercury,PCB’s,dioxinsandheavymetalsineverybatch,ourKidsDHAprovidesthis essential fat from cold water fish in a chewable, natural orangecrème-flavoredsoftgelkidscanenjoy.

SUPPLEMENT FACTSServingSize:2Softgels ServingsPerContainer:30

Amt/Serving DV%*Calories 4.5Calories from Fat 4.5Total Fat 0.5 gVitamin A 0 IU 0%VitaminD3 0IU 0%VitaminE(asd-alphatocopherolfromsoy) 2IU 7%FishOil(fromanchovy,salmon,sardine,and/ortuna) 500mg **Fatty Acid Composition: Total Omega-3 fatty acids 270mg **EPA(aseicosapentaenoicacid) 50mg **DHA(asdocosahexaenoicacid) 200mg **

*PercentDailyValuesarebasedon2,000caloriediet.**DailyValuenotestablished. Other Ingredients:Softgel(gelatin,glycerin,water,naturalorangeflavor),naturalorangecrèmeflavor,steviaextractpowder Contains Noartificialcolors,flavorsorpreservatives;nowheat,gluten,milk,eggs,peanuts,tree nuts or crustacean shellfish.

Page 52: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

52 www.LifesourceVitamins.com I 1-800-567-8122

Pancreas Health 90 Tablets - $18.99

“ I lost my father to pancreatic cancer, so this one was easy for me to get into production. I loved him and feel that he could be here today with all of the knowledge we have now on the pancreas, its functions and preventative supplements. ”—Bruce Brightman, founder of LifeSource Vitamins LifeSource’s PancreasFormulaisuniquelydesignedtogivehighlyconcentratedextractstosupportpancreaticfunctionandsupplement pancreatic enzyme production.

Key Benefits•Allnatural,herbalingredients.•Supportshealthypancreaticfunction.•Rejuvenatesdigestivesystem.•Naturally-occurringvitamins,minerals,andnutrients.

SUPPLEMENT FACTS

ServingSize:3Tablets ServingsPerContainer:30

Amt/Serving DV%*Chymotripsin 200mcg †Pancreatin(4X) 100mg †Biotin 300mcg †ChromiumPicolinate (12.5%) 200mcg †GTFChromium(0.1%) 100mcg †Glucosol(1%) 100mg †Amylase(10,000RAU/g) 100mcg †Protease(75HUT/g) 100mg †Lipase(1,000LA/g) 100mg †

Amt/Serving DV%*VanadylSulfate(31.3%) 500mcg †NopalCactusLeaves 300mg †FenugreekSeed 200mg †BlueBerryFruit 200mg †BitterMelon 300mg †ZincGluconate 100mcg †HuckleberryFruit 200mg †Spirulina 100mg †Trypsin(1:75) 30mg †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Para-Cleanse 120 Tablets - $32.99

LifeSource’sPara-Cleanseisdesignedtoridyourbodyofawiderange of harmful human parasites. This vegetarian formula of plantextractsisdesignedtosupportthebodyineliminatingunwantedmicroorganisms;whileatthesametimehelpingtomaintain proper immune system and G.I. tract functions.

Millions of people are infected by one or more of over 1000 known human parasites. Intestinal parasites are one of the more common types of parasites, but parasites can be found in all areas of our body. Let us help you rid them!

SUPPLEMENT FACTS

ServingSize:2Tablets ServingsPerContainer:60

Amt/Serving DV%*BlackWalnut(Juglansnigra)GreenHull 400mg †Wormwood(Artemesiaannua)(Stem&LeafPowder) 200mg †GrapefruitSeedExtract 200mg †Olive(Oleaeuropaea)LeafExtract 200mg †yieldingOleuropein 30mg †PauD’Arco(Bark) 200mg †BlackCumin(Nigellasativa)Seed 200mg †Garlic(odorless)Extract 200mg †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Other Ingredients: microcrystalline cellulose, stearic acid, croscarmellose sodium, vegetable stearate,silicondioxide.

Phosphatidyl SerineComplex 500 mg

30 Softgels - $19.99

PSorPhosphatidylSerine,isalsoreferredtoastheEssentialBrainNutrient!Phosphatidylserineisaphospholipidthatis found in virtually every cell of our bodies, but is most highly concentrated in the walls or membranes of brain cells, that have been shown to make up about 70% of its nerve tissue mass. There it aids in the storage, release and activity of many vital neurotransmitters and their receptors. Phosphatidylserinealsoaidsincell-to-cellcommunication.PSisamusthaveforthemaintainingofhealthycognitivefunctioning over the course of our lives.

SUPPLEMENT FACTS

Serving Size: 1 Softgel Servings per Container: 30

Amt/Serving DV%*Phosphorus 10mg 1%Potassium 3mg <1%Phosphatidylserinecomplex 500mg †Phosphatidylserine 100mg †Phosphatidylcholine 55mg †Phosphatidylinositol 10mg †Phosphatidylenthanolamine 20mg †Linolenicacid 10mg †Linoleicacid 85mg †Oleicacid 15mg †Palmiticacid 27mg †Stearicacid 6mg †Capricacid 51mg †Caprylicacid 120mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished.

Other Ingredients:Softgel(gelatin,glycerin,water),soybeanoil,carobandVitaminE. Contains No sugar, salt, dairy, yeast, wheat, gluten, corn, preservatives, artificial colors or flavors. Suggested usage:Take1softgelcapsuleone(1)tothree(3)timesdailywithmeals.

Be stronG AnD CourAGeous. Do not Be AFrAiD;

Do not Be DisCourAGeD, For the LorD your GoD wiLL Be with you wherever you Go.

JoshuA 1:9

Krill Oil (Neptune) 60 Softgels - $33.99

There are many advantages to taking a Neptune Krill Oil supplement. Not only do you get the health benefits of omega 3 fatty acids, you also get a natural source of brain-nourishingphospholipidsandapotentantioxidant-Astaxanthin.ThisuniquecombinationofNeptuneKrillOil ingredients is what separates it from other healthy oils. LifeSource Neptune Krill Oil is manufactured under strict quality control standards. It is tested to be free of potentiallyharmfullevelsofcontaminants(i.e., mercury,heavymetals,PCB’s,dioxins,andothercontaminants).

•Cardiovascularhealth•Healthybloodsugarlevels•Promotesoptimalreproductivecycles•Supportshealthyjoints•Supportsmentalhealthandimmunesystemfunction•Helpsbrainandnervoussystemfunction

SUPPLEMENT FACTS

Serving Size 2 Softgels Servings per Container 30

Amt/Serving DV%*Calories 10Calories from Fat 10Total Fat 1 g 2%*Neptune Krill Oil (NKOT) 1.0g(1,000mg) †Omega-3FattyAcids 230mg †

Amt/Serving DV%*

EicosapentaenoicAcid(EPA)120mg †

DocosahexaenoicAcid(DHA)70mg †

Phospholipids 390mg †

EsterifiedAstaxanthin 750mcg †

Page 53: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

53www.LifesourceVitamins.com I 1-800-567-8122

PHyTO fOOdS10 oz Powder / 31 Servings — $29.99 PER CONTAINER

2 lbs. Powder /100 Servings — $69.99 PER CONTAINER (SAVE $25)

120 Capsules / 20 Servings — $17.99 PER BOTTLE

240 Capsules / 40 Servings — $31.99 PER BOTTLE (SAVE $4)

LifeSource’sProprietaryFormulaisapowerfulMega-Foodformulationofcertifiedorganicallygrowngrasses,sproutedgrains,vegetables,bloodpurifyingandimmuneenhancingherbs,withantioxidants.LifeSource’sGreenPhytoSuperFoods Formula is the most complete well-rounded SuperFoods green formula on the market today. Our Green PhytoFoodsarethecombinationofthebestofgreenSuperFoodsavailableanywhereintheworld.Ourall-naturalnutrients ensure that you will get 100% absorption, while synthetic and non-organic greens will provide 5-15% absorption. Phytobenefits:helpsenergylevels,cholesterol,fat,strengthensimmunesystemandnaturalweightloss.Detoxifiestheintestinaltractsandcleans/purifiesthecolon.Neutralizesacidity.Helpswithdigestion,heartburn,acidreflux,upsetstomachs,bodilywastefunctions,aidsinmentalclarity,Oxygenatesthecells,andhelpstheskincellstoregeneratemoreefficiently.Maximizesbloodpurificationandaidsindetoxification,dramaticallyslowstheagingprocessescausedbyover-acidification and helps hair and nails strengthen and become healthier. 2.5 lbs of veggies per serving.NUTRITIONAL FACTS

Serving Size: 1 Rounded Scoop

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Amt/Serving DV%*Calories 40BarleyGrassPowder,Org. 500mg †Calories from Fat 15CarrotPowder 500mg †Total Fat 0.5 g <1%BarleyMaltPowder 400mg *Saturated Fat 0 g 0%BroccoliPowder 350mg †Cholesterol 0 mg 0%BrownRiceBran 350mg †Sodium 30 mg 2%AppleFiber 350mg †Total Carbohydrate 6 g 2%ApplePectin 300mg †DietaryFiber 2g 8%OatBran 300mg †Sugars 1 g

Amt/Serving DV%*ChlorellaPowder 300mg †Protein 1g 2%RedBeetPowder 300mg †Vitamin A(asBeta-Carotene) 6250IU 125%PanaxGinsengRootPowder(C.A.Mayer)(min.5%Ginsenosides) 250mg †Vitamin K 160 mcg 200%Eleuthero(Eleutherococcussenticosus)(Root) 100mg †Vitamin B-12 2.1 mcg 35%PeppermintPowder 150mg †Calcium 40 mg 4%GreenTeaExtract(40%Catechins) 100mg †Iron 1.8mg 10%RoyalJellyPowder(min.5%10-HDA) 100mg †Iodine(fromKelp) 150mcg 100%Fructooligosaccharides(NutraFloraTMFOS) 100mg †

Amt/Serving DV%*Magnesium 24 mg 6%TraceMineralConcentrate 100mg †Zinc 900 mcg 6%MilkThistleExtract(80%Silymarin) 80mg †Lecithin(FinePowder) 2.0g †KelpPowder 50mg †Spirulina(Hawaiian,Org.) 1.0g †GinkgoBilobaExtract(24%Ginkgoflavonglycosides)(Leaves) 20mg †AlfalfaJuiceConcentrate 700mg †GrapeseedExtract(95%Polyphenols) 20mg †WheatGrassPowder,Org. 500mg †BilberryExtract(25%Anthocyanidins) 20mg †PlantBasedEnzymes 350mg †CoenzymeQ10(CoQ10) 10mg †AlphaLipoicAcid 10mg †SteviaExtract(Leaves) 10mg †

Green Phyto Foods (30 Whole Food Concentrates)

10 oz Powder / 33 Servings - $29.99 PER CONTAINER

2 lbs. Powder / 106 Servings - $69.99 PER CONTAINER (SAVE $25)

Phytonutrients appear to serve three major functions in the human body:1.Theyactasantioxidants-protectourbodiesfromfree-radicaldamageandsupporthealthycellularfunctions. (Freeradicaldamage)2.Theyregulatehormonelevels-Phytonutrientsprovidenutrientsrequiredforoptimumhormonalfunctions.3.Preserveoptimalhealthandlongevity.

Phytonutrientscan:•Slowand/orstopthedevelopmentofcancercells.•Blocktestosteroneandestrogenfrompromotingcancercellgrowth.•Preventtumorsfromspreadingbychokingofftheirbloodsupply.•Detoxifyenvironmentalcarcinogens.•Reversecoronaryarterydisease.•ReduceoreliminatetheneedforinsulininjectionsfortypeII(adult-onset)diabetes.•Boosttheeffectivenessofconventionalcancertreatmentsandreducetheirtoxicsideeffects.•Replacelostbonemineralsinpeoplesufferingfromosteoporosis.•Wholebodysupportwithvitamins,enzymes,fruitsandfiber.•Highinnaturalanti-oxidantsforhealthyaging,vascularandimmunesupport.

NUTRITIONAL FACTS

ServingSize:1RoundedScoop(8.5grams)

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished. Other Ingredients: SteviaAllergyInformation:ThisproductcontainsLecithin(FromSoy).

Amt/Serving DV%**Calories 22Calories from Fat 0Total Fat 0.5 g <1%Saturated Fat 0 g 0%Total Carbohydrate 4 g 1.33%Fiber 2g 8%Sugars 0 gProtein 0gProprietaryBlendGojiberries,Cranberries,strawberries,Cherries, Black Raspberries,

Amt/Serving DV%*Peaches,Pears,Papayas,Mangos,Watermelon, Black Currents, Nectarines,BloodOranges,Pomegranates,Acerola,Blueberries,BlackberriesandRedPlums 6.675g *CarrotPowder 600mg †ApplePectin 250mg †FlaxSeed 250mg †OatBran 175mg †Lecithin 150mg †RiceBran 100mg †ProbioticBlend(L.Acidophilus,

Amt/Serving DV%*L.Casei,L.Rhamnosus,L.Plantarum,B.BreveandB.Longum 100mg †GrapeSeedExtract 30mg †ORACBlend 50mg †PolygonumCuspidatum 40mg †BilberryStd.Extract25% 40mg †Lycopene 5mg †Lutein 5mg †Astaxanthin 1mg †

Phyto Reds Powder (5,000 ORAC per serving)

Page 54: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

54 www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

54

LifeSourceVitaminsPhytoBlues&Purplescombine23

nutrientsthatarerichwholefruits,vegetablesandextracts.

This is a great way to get your blue fruits and purple fruits

that are so very important in today’s hectic lifestyle that

we all have. Our goal was to create a delicious, Anti-Aging,

drinkmixthatwouldchangepeople’slivesthroughbetter

nutrition.TheseBlues&Purplesarethesuretohelp

your nutritional balance and effect your life. When your

body gets: Blueberry, Blackberry, Black Cherries, Black

Raspberries,BlackCurrants,Plums,Elderberries,Bilberries,

Figs,Raisins,Eggplant,PurpleCarrots,PurpleCabbage,

Beets,AcaiFruitPowder,CamuCamu,Mangosteen,Goji

Berry,L-Carnosine,AlphaGPC&PomegranateExtractyour

body will feel absolutely alive with energy, and it will give

yourbodyexactlywhatitneedsforoptimumhealth!

LifeSource Phyto Blues & Purples contain powerful color-rich phytonutrients that support:

•Anti-Aging-HealthyAging

•Circulation&VascularHealth

•HelpsoverallMemory

•RadiantSkin,SmoothandHealthy

•Mentalclarity&focus

•ImmuneSystemFunction

•CompleteCellHealth&Function

•SupportsHealthyNerveandBrainFunctions

NUTRITIONAL FACTS

ServingSize:1Scoop(10.95g) ServingsperContainer:30

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished. Other Ingredients: SteviaAllergyInformation:ThisproductcontainsLecithin(FromSoy).

Amt/Serving DV%*Calories 40Calories from Fat 1Total Fat, 5 g 1%Total Carbohydrates 9 g 3%Sugars 4g †Fiber 3 g 12%Protein 1g 2%Vitamin A 31 IU 1%Vitamin C 2.95 mg 5%Folic Acid 400 mcg 100%Calcium 14 mg 1%Iron .687mg 4%Sodium 50 mg 2%

Amt/Serving DV%*

ProprietaryFruitPowderBlend

containing Blueberry, Blackberry,

Black Cherries, Black Raspberries,

BlackCurrants,Plums,Elderberries,

Bilberries,FigsandRaisins 4,900mg †

SolubleFiber(Fibersol®2brand) 2,000mg †

ProprietaryVegetablePowder

BlendcontainingEggplant,PurpleCarrots,Purple

Carrots,PurpleCabbageandBeets 1,250mg †

AcaiFruitPowder 400mg †

Amt/Serving DV%*

CamucamuFruitPowder 300mg †

Mangosteen(Garciniamangostana)

FruitRindExtract 300mg †

Goji(Wolfberry/Lyciumbarbarum)

Berrypowder 200mg †

Proprietary“BrainBlend”containing

Phosphatidylserine,Inositol,L-Carnosine

andAlphaGPC 100mg †

PomegranateExtract 40mg †

SteviaLeafExtract 35mg †

Phyto Blues & Purples Age Fighter 11.59 oz Powder / 30 Servings - $29.99

LifeSourceVitaminsFatigueFightingPhytoOrangesisagreatwaytogetyourdaystartedoramid-daysnackthatwillkeepyouenergized the healthy way. This formula is a wonderful blend of fruits that will make your body run much more efficiently and will help fightoffcoldsandflus,alongwiththegeneralfeelingofsluggishnessthatmanyofusexperience.Combatthemid-daylullinahealthywayHaveagreatallnaturalfruitshakethatissoverygoodforyouandisloadedwithOranges,Peaches,Nectarines,Tangerines,Cantaloupe,Pineapple,ClementinesPapaya,Apricot,Mango,Kumquat,Persimmons,Yams,Pumpkin,ButternutSquash,Rutabagaandmore.Yourbodywillfinallygetthefruitsthatyouneedtorunoptimally.Youwillfeeladifferenceafterajustafewservings.

NUTRITIONAL FACTS

ServingSize:1RoundedScoop/10g ServingsPerContainer:30

Amt/Serving DV%*Calories 40Calories from Fat <1Total Fat <.5 g <1%TotalCarbohydrates 8g 3%Sugars 4g †Fiber 2g 8%Protein 1g 2%Iron 16 mg 1%Sodium 14.3 mg <1%Riboflavin 12 mg 706%VitaminC(ascorbicacid) 200mg 333%ProprietaryFruitBlend:Oranges,Peaches,Nectarines,Tangerines,Cantaloupe,Pineapple,Clementines,Papaya,Apricot,Mango,Kumquat,Persimmons 3,850mg †

Amt/Serving DV%*

SolubleFiber(Fibersol®brand) 1,500mg †

ProprietaryVegetableBlend:Carrots,

Yams,Pumpkin,ButternutSquash,

Rutabaga 1,400mg †

ProprietaryEnergyBlend:Taurine,

Inositol,N,N-DimethylglycineHCI(DMG),

WhitePanaxGinseng 800mg †

GreenCoffeeBeanExtract 450mg †

CoQ10 15mg †

SteviaLeafExtract 35mg †

Phyto Oranges With CoQ10 10.58 oz Powder / 30 Servings - $29.99

*PercentDailyValuesarebasedon2,000caloriediet.†Dailyvaluenotestablished. Other Ingredients: Natural orange and vanilla flavors, banana powder, citric acid Productcontainsnaturalsourcesofironandsodium

=LifeSourceProprietaryBlend

www.LifesourceVitamins.com I 1-800-567-8122

Page 55: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

55www.LifesourceVitamins.com I 1-800-567-8122

Chocolate or Vanilla Just Raw, Vegan Whole Food Nutrition To Support YourBusy,ActiveLifestyle!LifeSourceVitaminsUltraPlantProteinisanutritionally complete plant protein supplement that is highly digestible &freeofcommonfoodirritants.Thecombinationofourexceptionalplantproteinsscoresaperfect1.0ontheProteinDigestibilityCorrectedAminoAcidScore(PDCAAS).PDCAASisthegoldstandardforratingthequalityofproteinforhumannutrition.LifeSourceVitaminsUltraPlantProteinalsocontainsaddedBCAA’stomakeituniqueamongproteinproducts. Most plant based products contain less than optimal amounts of these important compounds. BCAA’s are important for preventing muscle breakdown and supporting muscle growth. Finally a deliciously greattastingVeganPlantProteinthatmixes perfectly

•Synergisticenzymeblendensureseasydigestion•BlendedwithOmega3richChiaSeedandSachaInchiSeed•21gramsofpurecleanveganprotein•Providesenergyforworkingmusclesandpromotesmusclegrowth•Greatforalldiets,sensitivitiestowheyandotherproteinsources•Sweetenedw/Stevia–NOTSucralose!•Containsawhopping6,225mgofBCAA’s,(BCAA’s:leucine,isoleucine,and valine)

•Alsocontains3,475mgofGlutaminetoSupportLeanMuscleMass,Muscle Growth & Strength, Immune Function and GI health*

•Boostsyourpre-workoutenergylevelandhelpsyourmusclesrecoverafterexercising:BCAA’s,Amino’s&Glutamine.

•Ourprocessingisearthfriendlyandnochemicalprocesses.

SUPPLEMENT FACTSServingSize:1Scoop ServingsPerContainer:30

Otheringredients:Inulin,stevia,xanthangum,glycine,naturalflavorandsilica. *Dailyvaluesarebasedon2,000caloriediet. †Dailyvaluenotestablished.ed.

Amt/Serving DV%*Calories 130

Calories from Fat 20

Total Fat 2.5 g 4

Sodium 280mg 12

Potassium 50mg 3

Total Carbohydrate 4 g 1

DietaryFiber 1g <1

Sugars <1 g **

Protein 21g 42

Calcium 50 mg 5

Amt/Serving DV%*Iron 6 mg 33

MultiSourcePlantProteinBlend

(Peaproteinisolate,Cranberryseed,

Chia seed and Sacha Inchi

seed) 25,550mg **

BranchChainAminoAcids(L-Leucine,

L-IsoleucineandValine) 6,225mg **

Glutamine 3,475 mg **

Enzyme Blend Alpha-galactosidase

and Bromelain 110mg **

Ultra Plant Protein (Chocolate or Vanilla) 2.2 lbs. - $49.99

Page 56: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

56 www.LifesourceVitamins.com I 1-800-567-8122

Policosanol 10 mg 60 Veg Caps - $15.99

Policosanolisablendoflong-chainfattyalcohols(LCFA)derived from sugar cane. LCFA’s are naturally occurring plant waxes.Studiesindicatethattheseplantwaxesmayhelptosupport cholesterol levels already within the normal range.

SUPPLEMENT FACTSServingSize:1VegCap ServingsPerContainer:90

Amt/Serving DV%*Policosanol(fromSugarCane) 10mg †

Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished. Other Ingredients: RiceFlour,Cellulose,Cellulose(capsule),SilicaandMagnesiumStearate(vegetablesource). Contains no: salt, yeast, wheat, gluten, corn, soy, milk, egg, shellfish or preservatives. Vegetarian/Vegan Product.

Potassium Gluconate 100 Tablets - $7.99

Thisimportantmineralisamajorcomponentofthecellsinour body and is required for muscle contraction, production of energy, synthesis of nucleic acids and proteins. Even thebeatingoftheheartdependsonpotassium.Potassiumbenefits athletic performance, but is depleted from the bodybyexcessivelossoffluidlikethatexperiencedduringintenseworkouts.ManyathletestakePotassiumtopreventandfightoffmusclecramps.DrinkaglassofwaterwithyourPotassiumGluconatesupplement.Also,increaseyourintakeof water when taking this product as it helps with overall performance. •Preventandfightmusclecramps.•Importantforhealthynervoussystemandregular

heart rhythm.•Helpsintheoverallloweringofbloodpressure.

SUPPLEMENT FACTSServingSize:1Tablet ServingsPerContainer:100

Amt/Serving DV%*Potassium(fromPotassiumGluconate) 99mg 3%

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Cellulose,ModifiedCelluloseGum,Silica,StearicAcid(vegetablesource),CalciumStearate(vegetablesource),Glycerin.

DophilusPlusisacombinationof8differentspeciesofbeneficial bacteria designed to support gastrointestinal health and immune system function. FOS is also included in this product to assist healthy growth of acidophilus andbifidusorganisms.DophilusPlusexclusivelyutilizesthe finest strains from Rhodia Incorporated, the world’s leading supplier of high quality probiotic ingredients, and is enteric-coated to ensure that the bacteria in this product are not destroyed in stomach acid but reach the small and large intestines where they are most beneficial. After opening store is a cool, dry place, refrigeration is recommended.

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:60 Amt/Serving DV%*Blendof8StrainsofProbioticBacteria 4.0 Billion Organisms*Lactobacillus acidophilus 1.2 billion*Lactobacillus casei 600 million*Lactobacillus rhamnosus 600 million*Bifidobacterium longum 200 million*Bifidobacterium lactis 200 million*Streptococcus thermophilus 400 million*Bifidobacterium bifidum 200 million*

*PercentDailyValuesarebasedon2,000caloriediet.+DailyValuenotestablished. Free of: wheat, milk, egg, fish, shellfish or tree nut ingredients Other Ingredients: Cellulose(capsule),AscorbicAcid,MagnesiumStearate(vegetablesource),FOS(Fructooligosaccharides),MaltodextrinandEntericCoating. Refrigeration after opening is suggested but not required.

Dophilus PlusProbiotic

60 Veg Caps - $16.99 120 Veg Caps - $29.99

(SAVE $4)

35 BillionProbiotic

30 Vegetarian Capsules - $26.99 60 Vegetarian Capsules - $49.99

(SAVE $4)

Our35BillionProbiotic,alsoreferredtoasfriendlyorgood bacteria, gut flora, intestinal flora, microflora, anddirectfedmicroorganisms(DFM),probioticshelpmaintainthenaturalbalanceoforganisms(microflora)in the intestines. They are live, microscopic living organisms – such as bacteria, viruses, and yeasts – that play a vital role in the fermentation and digestion of carbohydrates, and aid in the digestion of fats and proteins.Probioticshasshowntopreventbloating,gas, and yeast overgrowth because they help maintain intestinal acidity at a healthy pH level. These probiotic can also help generate certain vitamins and nutrients, support the immune system, and help prevent disease by depriving bad bacteria of nutrients, and secreting acids that harmful bacteria can’t cope with.

SUPPLEMENT FACTS

Serving Size: 1 Vegetarian Capsule Servings per Container: 30

Amt/Serving DV%*Proprietaryprobioticblend 35billioncellspercapsule †Lactobacilliacidophilus(La-14)Bifidobacteriumlactis(BI-04)Lactobacillisalivarius(Ls-33)Lactobacilliplantarum(Lp-115)Bifidobacteriumbifidum(Bb-02)Bifidobacteriumlongum(BI-05)Lactobacillirhamnosus(Lr-32)Lactobacillibulgaricus(Lb-64)Prebioticblend 50mg

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Vegetariancapsule(cellulose,water),cellulose,silica,magnesiumstearateand calcium silicate. Contains No salt, dairy, wheat, gluten, preservatives, artificial colors or flavors

Pre-Workout Formula 10.6 oz - $19.99IntroducingournewscientificallyformulatedPre-WorkoutFormula. Still all-natural with no artificial colors or flavors and loaded with proven synergistic ingredients that will provide maximumresultsforathletes,weekendwarriors,orforthosewho participate in light to moderate physical activity. For use to enhance physical activity and athletic performance by increasing energy, stamina and endurance. Sharpens mental clarity and focus, promotes lean muscle growth and supports lactic acid clearance to reduce fatigue or post-workout soreness and discomfort.•UsingGuaranaSeedExtractandB12,providespre-workout

energy to get you ready to lift, run or compete physically•CarnoSyn®Beta-Alaninesupportsanincreaseinmuscle

carnosine and athletic performance•NewCitrusSplashFlavor

SUPPLEMENT FACTSServingSize:1Scoop(Approximately20grams) ServingsperContainer:15

Amt/Serving DV%*Calories 60 Sodium(assodiumchloride) 50mg 2%Total Carbohydrates 15 g 5%VitaminB-12 65mcg 2,708%PantothenicAcid 5mg 100%Potassium(aspotassiumchloride) 50mg 1%Pre-WorkoutProprietaryBlend 4,354mg †Creatine Monohydrate, CarnoSyn® Beta-Alanine, Arginine Alpha Ketoglutarate, GuaranaSeedExtract,KrebCycleIntermediates,AlphaLipoicAcidandCitrullineMalate

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Maltodextrin,steviaandnaturalorangeflavor.Thisproductcontainsapproximately100mgofcaffeineperserving,whichisequivalentto1½cupsofcoffee Contains no sugar, dairy, yeast, wheat, gluten, soy, preservatives, artificial colors or flavors Suggested usage: Add 1 scoop to ten ounces of water Take 1 scoop 30-35 minutes prior to exercise

NEW

Page 57: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

57www.LifesourceVitamins.com I 1-800-567-8122

100 Billion Probiotic 30 Veg Caps - $49.99

100BillionProbioticisacombinationof12differentstrainsofbeneficial bacteria designed to support gastrointestinal health andimmunesystemfunction.100Billion,HighPotency.

SUPPLEMENT FACTS

Serving Size: 1 Vegetarian Capsule

Servings per Container: 30

Amt/Serving DV%*Proprietaryprobioticblend

(100billioncells

percapsule) 421mg †

Bifidobacteriumlactis(BI-04)

Lactobacilliacidophilus(La-14)

Bifidobacteriuminfantis(Bi-26)

Lactococcuslactis(LI-23)

Bifidobacteriumbreve(Bb-03)

Lactobacilliuscasei(Lc-11)

Amt/Serving DV%*Lactobacillusrhamnosus(Lr-32)Bifidobacteriumlongum(BI-05)Bifidobacteriumbifidum(Bb-06)Lactobacillussalivarius(Ls-33)Lactobacillusplantarum(Lp-115)Lactobacillusbulgaricus(Lb-87)Larch Arabinogalactan (FiberAid) 25mg †Fructooligosaccharides (FOS) 25mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Vegetariancapsule(cellulose,water),cellulose,silica,magnesiumstearateand calcium silicate Contains No salt, dairy, wheat, gluten, preservatives, artificial colors or flavors

Women’s 50 BillionProbiotic

LifeSource Vitamins Women’s 50 Billion Probiotic:HighPotencyProbioticw/PrebioticsSpecificallyFormulatedforWomenandtheirexactneedstopromoteBalanceandHarmony.

Supports women’s gut flora, intestinal flora, microflora,anddirectfedmicroorganisms(DFM),probioticshelpmaintainsthenaturalbalanceoforganisms(microflora)inthe intestines. They are live, microscopic living organisms– such as bacteria, viruses, and yeasts – that play a vitalrole in the fermentation and digestion of carbohydrates,and aid in the digestion of fats and proteins.

SUPPLEMENT FACTS

Serving Size: 1 Vegetarian Capsule Servings per Container: 30

Amt/Serving DV%*ProprietaryLactobacillusblend (25billionCFU)Lactobacillusacidophilus(La-14)Lactobacilluscasei(Lc-11)Lactobacilluslactis(Ll-23) †Lactobacillussalivarius(Ls-23)Lactobacillusplantarum(Lp-115)ProprietaryBifidobacteriumblend (25billionCFU)Bifidobacteriumlactis(Bl-04)Bifidobacteriumbreve(Bb-03)Prebioticblend(Fructooligosaccharides(FOS),LarchArabinogalactan(FiberAid®)) 50mg

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Vegetariancapsule(modifiedcellulose,water),cellulose,magnesiumstearate, silica and calcium silicate Contains No salt, dairy, wheat, gluten, soy, preservatives, artificial colors or flavors Suggested usage: Take 1 tablet daily with meals

60 Capsules - $32.99

Kids DophilusProbiotic Chewables 60 Chewables - $12.99

•All-naturalberryflavor•Naturallyaidsdigestion•Boostsimmunity•Nosugar•ShowntohelpIrritableBowelSystems

SUPPLEMENT FACTS

ServingSize:1Chewable ServingsPerContainer:60

Amt/Serving % Daily Value*

FOR CHILDREN 4+ YRS OF AGECalories 5 †Total Carbohydrates 1.4 g 1%SugarAlcohol 1.2g †Blend of 10 Strains ofProbioticBacteria 2BillionOrganisms †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Kids Dophilus Probiotic ChewablesExtraStrength

50 Chewables - $21.99

LifeSourceVitaminsKidsDophilusExtraStrengthwith10Billion CFU is a combination of probiotic bacterial strains designed to support gastrointestinal health and immune system function. In addition, healthy intestinal flora also helps to create a favorable environment for the absorption of nutrients. FOS is included in this product to assist healthy growthofacidophilusandbifidusorganisms.KidsDophiluscan be used by both adults and children. Because it is sweetened with Xylitol, it won’t harm teeth and it tastes great.

SUPPLEMENT FACTS

Serving Size: 1 Chewable Servings per Container: 50

Amt/Serving DV%*Calories 5

Total Carbohydrates 1 g <1%

SugarAlcohols(Xylitol&Sorbitol) 1g †

Blendof10Strains 10BillionCFU †

Lactobacillusacidophilus(La-14)

Lactobacillusplantarum(Lp-115)

Lactobacillusrhamnosus(Lr-32)

Lactobacillusparacasei(Lpc-37)

Lactobacillussalivarius(Ls-33)

Bifidobacteriumlactis(BI-04)

Bifidobacteriumlongum(BI-05)

Streptococcusthermophiles(S1-21)

Bifidobacteriumbreve(Bb-03)

Lactobacilluscasei(Lc-11)

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other ingredients:Xylitol,Sorbitol,Cellulose,StearicAcid(vegetablesource),Silica,NaturalBerryFlavors,BeetPowderandFOS(Fructooligosaccharides) Not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or other tree nut ingredients

Probiotic Gummies 60 Gummies - $24.99

SUPPLEMENT FACTS

Serving Size: 1 Gummy Servings per Container: 60 Amt/Serving DV%*Calories 10Total Carbohydrates 3 g 1%Sugars 2g †Sodium 5 mg <1%DE111®(BacillusSubtilis) 2.5BillionCFU †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Organic tapioca syrup, organic evaporated cane sugar, natural flavors, pectin, citric acid, sodium citrate,naturalcolor(blackcarrot),organicsunfloweroil(contains carnaubawax)andcornstarch Suggested usage:Adults/ChildrenOver4,oneGummyDaily

NEW

Page 58: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

58 www.LifesourceVitamins.com I 1-800-567-8122

ProbioticDigestive Support

•Aprebiotic(fructo-oligosaccharide)actsasafoodsourceto aid the growth, multiplication, and survival of efficacious probiotics in the gut.

•RestorestheNaturalBalanceofGoodBacteriainYourDigestiveTract*

•Helpsmaintainahealthy,balancedimmunesystem*•HelpsEntireDigestiveSystemWorkBetter*•Provides10efficaciousbacterialspecies•Provides9enzymestofurthersupportdigestivehealthand

balance

SUPPLEMENT FACTS

Serving Size: 2 Capsules Servings per Container: 30

60 Capsules - $32.99

Amt/Serving DV%*20billionx10strainpre-andpro-blend(grownonmilk) 470mg †Fructo-oligosaccharidesLactobacillusacidophilus(3.8billioncfu)Lactobacillusrhamnosus(3.75billioncfu)Lactococcuslactis(375millioncfu)Bifidobacteriumlongum(350millioncfu)Lactobacilluscasei(350millioncfu)Bifidobacteriumlactis(325millioncfu)Lactobacillusbrevis(325millioncfu)Bifidobacteriumbifidum(300millioncfu)Streptococcusthermophilus(300millioncfu)Lactobacillusbulgaricus(200millioncfu)BioCore®OptimumCompleteDigestionsupport 220mgAmylase(3,500DU)Protease(21,000HUT/4,000PC/50SAPU)Alpha-galactosidase(150GalU)Glucoamylase(9AGU)Lactase(1,000ALU)Invertase(400SU)Lipase(500FIP)Acidmaltase(14MaltU)Peptidase(2AP)

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Contains NoArtificialcolors,flavors,orpreservatives;nowheat,gluten,eggs,peanuts,treenuts, soy, crustacean shellfish or fish.

Progesterone (AllNatural)LiposomalSkinCream)

Studies have shown that progesterone may provide many benefits such as protection against fibrocystic breasts and breast cancer, protection againstosteoporosis,maintainingthesexdriveandnormalizing blood sugar levels. Research has also indicated the importance of progesterone to the centralnervoussystem(thebrainandspinalchord)–finding levels of progesterone to be 20 times higher in brain cells than in the blood. Therefore it has been studiedinbenefitingbraininjuriesandpreventingmigraineheadaches.Progesteronehaslongbeenstudied for its calming almost sedating effect. Properlevelshavebeenlinkedtosleepingwellandmaintaining a sense of calm. All natural & plant based. ProgesteroneCreamcanhelpwith

•Depressionandsadness•Anxiety•Uterinefibroids•Endometriosis•Menopausehotflashes•Urinaryincontinence•Weightgain•Sleepdifficulties•PMDD-Premenstrual•Lowsexdrive•DysphoricDisorder•PCOS-PolycysticOvarySyndrome•Breastpain•Anovulation(lackofovulation)

•Skinconditions•LutealPhaseDefect/infertility•Vaginaldryness•Premenstrual&chronicheadaches•Irregularbleeding•Depression,anxiety&sadnes•Estrogendominance•Noartificialcolorsorfragrances•Liposomalskincreamwithnatural

progesterone from wild yam and balancing herbs

•Eachpumpcontains20mgofnaturalprogesterone!

3 oz - $21.99

ProstaPlex90 Tablets - $24.99

180 Tablets - $44.99 (SAVE $5)

LifeSource’sSignatureProstaPlexFormulacontaining31ingredients is 10 times more effective than saw palmetto by itself.OurProstaPlexFormulahelpspreventprostategrowthand inflammation, and also restores urinary regularity. ProstaPlexisalsofortifiedwithanti-bacterialadditives.Somedegreeofbenignprostatichyperplasiaispresentin80%ofall men over forty years in age. LifeSource’s potent formula protectsagainsturinaryandsexualdysfunctionassociatedwithBPH.Scientificratiosofpotentsubstrateshelpblockdi-hydrotestosterone, an identified cause of enlargement of the prostate, while anti-bacterial additives simultaneously protect against infection.

Hundreds of thousands of men die each year from prostate cancer.Itcanbeprevented!ProstaPlex,themostcomprehensivesupplement for prostate health on the market today!

Amt/Serving DV%*VitaminA(asBeta Carotene) 10,000IU 200%VitaminE(Acetate) 100IU 333%VitaminB6(Pyridoxine) 25mg 1250%Zinc Arginate 10 mg 67%Copper(SulfateAnhydrous) 2mg 100%SawPalmettoPowder 200mg †StingingNettleRoot(Extract)175mg †SawPalmettoBerryExtract125mg †ApisMellifica(Honeybee) 100mg †DongQuaiPowder 100mg †LicoriceRoot 100mg †ProstateExtract 100mg †

Amt/Serving DV%*AfricanCherryExtract 75mg †DongQuaiExtract 75mgGlycine 75mg †L-Alanine 75mg †L-GlutamicAcid 75mg †TurmericPowder 50mg †CowherbSeedExtract 25mg †EuropeanGoldenrodExtract 25mg †IndianFrankincenseExtract 25mg †TurmericExtract 25mg †PanaxGinsengExtract 15mg †SalviaRoot 15mg †HydrangeaRootExtract 10mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Suggested usage: Take 2 tablets daily.

SUPPLEMENT FACTS

Serving Size: 2 Tablets Servings per Container: 45

Psyllium Husk Powder12oz. 12 oz. - $10.99

Soluble fiber from foods such as psyllium seed husks, as part of a diet low in saturated fat and cholesterol, may reduce theriskofheartdisease.AservingofPsylliumHuskPowdersupplies 6 grams of the 7 grams soluble fiber necessary per day to have this effect.

SUPPLEMENT FACTSServingSize:1LevelTablespoon(about9g)Servingspercontainer:38 Amt/Serving DV%*Calories 30Sodium 10 mg <1%TotalCarbohydrates 8g 3%*DietaryFiber 7g 28%*Soluble Fiber 6 gInsoluble Fiber 1 gCalcium 2%Iron 8%

*PercentDailyValuesarebasedon2,000caloriediet.b†DailyValuenotestablished. Suggested Use: Asadietarysupplement,mix1leveltablespoonintoatleast12ozofwaterorjuiceandconsumeimmediately.Besuretodrinkplentyofadditionalfluidsthroughouttheday. Other Ingredients: None Non-GMO Notice: This product should be taken with at least a full glass of liquid. Taking this product without enoughliquidmaycausechoking.Donottakethisproductifyouhavedifficultyin swallowing

Pycnogenol 60 Veg Capsules - $26.99

Asapotentnaturalscavengeroffreeradicals,Pycnogenolhelpstoprotectthebody’stissuefromoxidativestressandsupports a healthy, balanced immune system response to normal metabolic stress..

SUPPLEMENT FACTS

Serving Size: 2 Veg Capsules Servings per Container: 30

Amt/Serving DV%*Pycnogenol®(FrenchMaritimePineBarkExtract)(Pinuspinaster) 60mg †CitrusBioflavonoidComplex 600mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Cellulose(capsule),RiceFlourandMagnesiumStearate(vegetablesource). Not manufactured with yeast, wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients.

Page 59: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

59www.LifesourceVitamins.com I 1-800-567-8122

Quercetin Complex 100 Capsules - $24.99

Quercetin is a naturally occurring bioflavonoid compound. It servesasanantioxidantinthebodyandassistswithahealthyinflammation response. Bioflavonoids are compounds that give color to fruits and vegetables, as well as red colored wines.

Bromelain, a proteolytic enzyme from pineapple, and magnesium are added to help support the body’s response to inflammation.

SUPPLEMENT FACTS

Serving Size: 1 Capsule Servings per Container: 100

Amt/Serving DV%*VitaminC(asascorbicacid) 100mg 167%Magnesium(frommagnesiumcarbonate) 15mg 4%Quercetin 250mg †LemonBioflavonoidComplex 50mg †Bromelain(frompineapple) 25mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Cellulose,VegetarianCapsule(Cellulose),MagnesiumStearate (vegetablesource),Silica Contains no artificialcolors,flavorsorpreservatives;nowheat,gluten,milk,eggs,peanuts,tree nuts, soy, crustacean shellfish or fish. Suitable for vegans.

Organic Red YeastRice With CoQ10

1200 mg with CoQ10 60 mgRed Yeast Rice is a unique natural product that’s been used inAsiantraditionalmedicalsystemssinceapproximately800A.D.Itisproducedbythefermentationofredyeast(Monascuspurpureus)withwhiterice.LifeSourceVitaminRed Yeast Rice is carefully produced to avoid the presence ofcitrinin,asometimestoxicby-productofthefermentationprocess. This product is further enhanced with the addition of CoQ10 to support healthy cardiovascular and immune system function,MilkThistleExtracttosupporthealthyliverfunction,andAlphaLipoicAcidtoprovideantioxidantsupport.

•Cardiovascularsupport•Lowerscholesterol•Milkthistle&alphalipoicacid•Vegetarianformula

SUPPLEMENT FACTS

ServingSize:2Vcaps ServingsPerContainer:30

Amt/Serving DV%*OrganicRedYeastRice(Monascuspurpureus) 1200mg †MilkThistle(Silybummarianum) 210mg †StandardizedExtract(min.80%Silymarin)AlphaLipoicAcid 100mg †CoQ10(CoenzymeQ10)(asUbiquinone) 60mg †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Other ingredients: Cellulose(capsule),Silica,StearicAcid(vegetablesource)andMagnesium Stearate(vegetablesource).Containssoyderivative. Contains no sugar, salt, wheat, gluten, corn, milk, egg, shellfish or preservatives. Vegetarian/veganproduct.

60 Veg caps - $22.99 120 Veg caps - $39.99

(SAVE $6)

•Greatcholesterol-loweringagent•Promotesbloodcirculation•Aidsincardiovascularhealth

SUPPLEMENT FACTS

ServingSize:1Tablet ServingsPerContainer:60

Amt/Serving DV%*Calcium(fromCalciumCarbonate) 150mg 12%RedYeastRice(Monascuspurpureus) 1.2g(1,200mg) †Concentrated(10:1)Powder)

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Red Yeast Rice 1200 mg 60 Tablets - $24.99

Resveratrol Plus 60 Veg Caps - $19.99

Scientific studies have shown that Resveratrol supportshealthy cardiovascular function through various mechanisms.Resveratrol, especially when combined with otherpolyphenols, is known for it’s anti-aging effects, as well asfor its ability to support a healthy inflammatory response.LifeSource’sResveratrolPluscontainsacomprehensiveblend of polyphenols, including natural resveratrol andproanthocyanins(OPC’sfromgrapeseed),pluscatechins(greenteaextract)forpowerfulcardiovascularprotection.*

Benefit’s of LifeSource’s Resveratrol:•100mgofredwineextract•Cardiovascularsupport*•Richinpolyphenols!•Vegetarianformula•NaturalTrans-Resveratroll50mg

SUPPLEMENT FACTSServingSize:2VegCaps ServingsPerContainer:30

Amt/Serving DV%*RedWineExtract(Alcohol-Free)(Vitisvinifera)(min.30%Polyphenols) 200mg †PolygonumCuspidatumExtract(Root) 200mg †(50%NaturalTrans-Resveratrol-100mg)GreenTeaExtract 200mg †(Camelliasinensis)(Leaf)(min.98%TotalPolyphenols,70%TotalCatechinsand45%EGCg)(Containsupto14mgofNaturalCaffeine)GrapeSeedExtract(Vitisvinifera)(min.95%Polyphenols) 100mg †

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished.

Royal Jelly 60 Capsules - $19.99

RoyalJellyhasacomplexnutritionalprofilethatincludesnucleotides, polyphenols, and unique organic acids. It has been used traditionally since ancient times as a health tonic.

•BoostImmuneSystem•Beneficialforshort-termmemory•Reducemenopausalsymptoms

SUPPLEMENT FACTSServingSize:1VegCapsule ServingsPerContainer:60

Amt/Serving DV%*RoyalJelly(min.6%10-HDA)(Freeze-driedconcentrateequivalent to 1500 mg of fresh Royal Jelly 500 *

*DailyValueNotEstablished. Suggested Use: As a dietary supplement, take 1 capsule daily, preferably with meals.

Other Ingredients:Cellulose(capsule),RiceFlourandMagnesiumStearate(vegetablesource). Not manufactured with yeast, wheat, gluten, soy, corn, milk, egg, fish, shellfish or tree nut ingredients.

SAM-E 30 Tablets - $22.99

SAM-e is produced in small amounts by the human body, where it is an important physiological factor in the production of many compounds. However, the body does not always produce adequate amounts of SAM-e and supplementation is sometimes required.

•Helpsfightdepression•Canreducesymptomsofosteoarthritis

SUPPLEMENT FACTS

ServingSize:1Tablet ServingsPerContainer:30

Amt/Serving DV%*SAMe(from400mgofs-adenosyl-l-methloninetosylate) 200mg. *

Other Ingredients: Cellulose, silica, magnesium stearate, ethyl cellulose, oleic acid, medium chain triglycerides, sodium alginate, modified cellulose, triacetin, calcium carbonate and riboflavin(forcolor).

=LifeSourceProprietaryBlend

Page 60: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

60 www.LifesourceVitamins.com I 1-800-567-8122

Saw Palmetto 120 Softgels - $16.99

SawPalmettoberrieshavebeenfoundtosupporthealthyurinary tract and prostate functions.

SUPPLEMENT FACTS

ServingSize:1Softgels/160mg ServingsPerContainer:120

Amt/Serving DV%*SawPalmettoExtract 160mg †

*Dailyvaluebasedona2,000caloriediet. †Dailyvaluenotestablished.

Selenium 90 Veg Caps - $9.99

•Maylowertheriskoflung,prostateandcolorectalcancers•Antioxidantproperties

SUPPLEMENT FACTS

ServingSize:1VegCap ServingsPerContainer:90

Amt/Serving DV%*Selenium(asL-Selenomethionine) 200mcg 286%

*Dailyvaluesarebasedon2,000caloriediet. Free of: sugar, yeast, salt, milk, corn, wheat, gluten, soy, preservatives, colors.

Shark Cartilage 100 Capsules - $14.99

LifeSource Vitamins Shark Cartilage is derived from 100% pure freeze dried backbone of sharks and is a natural source of chondroitinandglycosaminoglycans(GAG’s).Ourpowderisthoroughly tested for important shark components and contains no solvents, bleaches or chemical processing agents. May help withArthritis,AntiInflammatory,Skin,Digestive&EyeHealth.

SUPPLEMENT FACTSServingSize:6Capsules ServingsPerContainer:16

Amt/Serving DV%*Calories 10Total Carbohydrate 1 g <1%Sodium 55 mg 2%Protein 2g 4%Calcium 1,000 mg 77%SharkCartilage(withnatural mucopolysaccharides) 4.5g †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Gelatin(capsule),Cellulose,MagnesiumStearate(vegetablesource),StearicAcid(vegetablesource)andSilica. Contains fish(shark).Non-GMO Not manufactured with yeast, wheat, gluten, soy, corn, milk, egg, shellfish or tree nut ingredients.

Sleep Formula Advanced 50 Capsules - $13.99

SleepFormulaAdvanced(Melatonin-Free)canhelpyougeta good night sleep. This blend contains natural herbs such as PassionFlower,Chamomile,Hopsandotherprovennutrientsto encourage natural, restful sleep.

SUPPLEMENT FACTSServing Size: 1 Capsule Servings per Container: 50 Amt/Serving DV%*VitaminB6(aspyridoxineHCI) 1mg 50%PantothenicAcid(ascalciumpantothenate) 50mg 500%Magnesium(citrate) 40mg 10%GABA(gammaaminobutyricacid) 180mg †L-Theanine 120mg †Chamomile(flowers) 75mg †PassionFlowerExtract 20mg †HopsExtract(HumulusLupulus4:1)Flower 20mg †LemonBalm(leaf) 10mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:VegetableCapsule(Cellulose),Cellulose,MagnesiumStearate(VegetableSource),Silica. Contains No artificialcolors,flavors,orpreservatives;nowheat,gluten,milk,eggs,peanuts, tree nuts, soy, crustacean shellfish or fish. Suitable for vegans. Suggested usage: Take 1 capsule: 30 minutes prior to bedtime.

Spirulina 200 Tablets - $15.99

Spirulina is rich is Beta-Carotene and Vitamin B12 and has naturallyoccurringproteinandGLA(GammaLinolenicAcid),apopularfattyacidwithnumeroushealthbenefits.In addition, Spirulina has naturally occurring minerals, trace elements, cell salts, amino acids and enzymes.

SUPPLEMENT FACTSServingSize:6Tablets ServingsPerContainer:33

Amt/Serving DV%*Calories 10Total Fat 0 g 0%Spirulina 3,000mg †Sodium 40 mg 2%Total Carbohydrate < 1 g <1%Protein 2.0g 4%Vitamin B-12 60%Vitamin A 140%Iron 1 0%Calcium 2

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Warnings: Pleasediscardtheinediblefreshnesspacketenclosed.

Stevia Extract Liquid (Organic) 2 fl. oz - $9.99•Pleasanttastingherb•Non-bitteraftertaste•All-naturalherbalproduct•Safefordiabetics•Safe,naturaldietarysupplement•Vegetarianproduct•Doesn’taffectbloodsugar•Notoothdecaylevels•Lowcaloricvalue,zerocarbsperserving• also available in caramel, chocolate, cinnamon, hazelnut,

orange, peppermint and vanilla, $12.99 EachNUTRITIONAL FACTS

ServingSize:4drops(0.13ml) ServingsPerContainer:461 Amt/Serving DV%*SteviaLiquidExtract(Steviarebaudiana)(Leaf) 0.13ml †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Stevia Extract Powder (Organic) 1 oz. - $9.99

NUTRITIONAL FACTSServingSize:1LevelScoop ServingsPerContainer:622

Amt/Serving DV%*SteviaExtractPowder 45mg † (Steviarebaudiana)(Leaf)(min.80%Glucosylsteviosides)

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenot established.

Spirulina Powder (Organic) 1 lb - $19.99

Spirulina is considered a complete protein because well over half of it consists of amino acids -- the building blocks of protein. It is also a rich source of other nutrients including Bcomplexvitamins,beta-carotene,vitaminE,carotenoids,manganese, zinc, copper, iron, selenium, and gamma-linolenic acid(anessentialfattyacid).LifeSource’sUSDAOrganicSpirulinaPowderhelpssupportenergy production and immune function at the cellular level.

SUPPLEMENT FACTSServingSize:5g(1tablespoon) ServingsperContainer:90 Amt/Serving DV%*Calories 17.31 Energy 72.45 KJ Total Fat 500 mg .1%Cholesterol < .1 mg 0%Sodium .6 g 2.5%Total Carbohydrates 1.33 g .3%DietaryFiber .34g 1.35%Iron 2.21 mg 12.3%Protein 3.33g 6.7%

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Ingredients: 100%OrganicSpirulinaPowder.Suggested usage: Take 1 tablespoon daily

NEW

Page 61: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

61www.LifesourceVitamins.com I 1-800-567-8122

Stress Relief &Calming Formula

100 Tablets - $17.99

•Improvesstressprotectionanddefense•Strengthenstheimmunesystem•Helpsantioxidantlevels•Buildsadaptiveenergyandvitality•Harmonizesallorgansystems&revitalizesbodybalances

SUPPLEMENT FACTS

Serving Size: 3 Tablets Servings per Container: 33

Amt/Serving DV%*Vitamin E 100 IU. 333VitaminC 500mg. 833Vitamin B1 50 mg. 6,666Vitamin B2 50 mg. 2,491Vitamin B3 40 mg. 1,000Vitamin B5 200 mg. 2,000VitaminB6 100mg. 2,058Vitamin B12 50 mcg. 2,500Vitamin H 150 mcg. 50Vitamin M 450 mcg. 100Calcium 250 mg. 25Magnesium 250mg. 83Potassium 99mg. †Iron 25 mg. 136Zinc 25mg. 186Manganese mg. †Chromemate 10mg. †Selenium 10mg. †

Amt/Serving DV%*L-GlutamicAc. 50mg. †GABA 50mg. †Tyrosine 50mg. †RibonucleicAc. 50mg. †Chamomile 75mg. †Hops 75mg. †PassionFlower 75mg. †Skullcap 75mg. †Valerian 200mg. †St.John’sWort 100mg. †KavaKavaRt. 75mg. †Choline 100mg. †Inositol 250mg. †PABA 50mg. †LemonBio.Con. 250mg. †RiceBranCon. 100mg. †Melatonin 1000mcg. †

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

In a natural base of acerola, capsicum, celery seed, fo-ti, ginseng, gotu-kola, lecithin, rose hips and wood betony.

=LifeSourceProprietaryBlend

I CAN dO All THINGS THrOUGH

CHrIST WHO STrENGTHENS mE.

PHIlIPPIANS 4:14

St. John’s Wort 100 Capsules - $12.99

•Depression•Anxiety•PMSrelief•Earinfections•Coldsores•Ulcerativecolitis•Woundhealing

NUTRITIONAL FACTSServingSize:1Capsule ServingsPerContainer:100

Amt/Serving DV%*St.John’sWortExtract 300mg †(Hypericumperforatumaerialpartwithflowersstandardizedtocontain0.3%hypericin)

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenot established.

Tart Cherry, combined with Turmeric, are highly prized health-boostingsubstancesbecauseoftheirantioxidantproperties protecting cells from free radical damage. In addition, they help manage appropriate levels of COX enzymes,supportinghealthytissuesandjoints,andpositivecontrol of immune responses.

SUPPLEMENT FACTS

Serving Size: 1 Tablet Servings per Container: 30 Amt/Serving DV%*TartCherry(Prunuscerasus)[fruit] (8:1fruitextractstandardizedtocontain atleast0.8%anthocyanosides) 825mg †Turmeric(Curcumalonga)Extract[root] (standardizedto95%curcuminoids) 50mg †

Tart Cherry W/Turmeric 30 Veg Tablets - $12.99

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients:Cellulose,StearicAcid(VegetableSource),MagnesiumStearate(VegetableSource),Silica,Glycerin Contains Noartificialcolors,flavorsorpreservatives;nowheat,gluten,milk,eggs,peanuts,tree nuts, soy, crustacean shellfish, or fish. Suitable for Vegans

Taurine 500 mg – Free Form 100 Caps - $7.99

Taurine is a conditionally essential amino acid that is not utilized for protein synthesis, but is mainly found free in mosttissues, especially throughout the nervous system. It functions in tissues by stabilizing cell membranes and aiding the transport of potassium, sodium, calcium and magnesium in and out of cells. It is also used by the body in visual pathways, as well as in the brain and nervous system, where it works together with glycine and GABA as a neurotransmitter.

SUPPLEMENT FACTS

Serving Size: 1 Capsule Servings per Container: 100

Amt/Serving DV%*Taurine(Free-Form) 500mg †

Other Ingredients: RiceFlourandGelatin(capsule)

Thermo Lean 90 Tablets - $13.99

LifeSource’s Thermo Lean delivers a unique combinationof 17 different synergistic nutrients that work withyour body to turn up your thermogenesis, in essenceincreasing the rate at which fat is released from the bodyand increasing your resting metabolic rate.

SUPPLEMENT FACTS

ServingSize:3Tablets ServingsPerContainer:30

Amt/Serving DV%*ChromiumPicolinate 150mcg †ProprietaryBlend 2100mg †Hawthorne Berry, Licorice Root,Bladderwrack, Choline, Ginger Root,Ginkgo Biloba, Ginseng, Gotu Kola, Guaranaseedextract),L-Carnitine,UvaUrsi,Burdock Root, Cornsilk, Bromelain, Boron.

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Page 62: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

62 www.LifesourceVitamins.com I 1-800-567-8122

Thyroid Energy

Hypothyroidism is a condition that occurs when the thyroid gland produces insufficient amounts of thyroid hormones in the body. Life- Source’s Thyroid Energy is a complete nutritional support for the thyroid gland. Unlike Thyodine, it contains no glandulars and is suitable for vegans. LifeSource has combined Iodine(fromKelp)andTyrosine,thetwointegralconstituentsofthyroid hormone, with the minerals Selenium, Zinc and Copper to assist in production. In addition, LifeSource’s Thyroid Energy containsGuggulExtract,anAyurvedicherbknownforitsabilityto support a healthy metabolism.

Note: If you are taking prescription thyroid medication, we strongly recommend that you consult with your doctor before taking Thyroid Energy.

SUPPLEMENT FACTS

ServingSize:2VegCaps ServingsPerContainer:45 Amt/Serving DV%*VitaminB-6(fromPyridoxineHCl) 2mg 100%Folate(asFolicAcid) 400mcg 100%VitaminB-12(asMethylcobalamin) 60mcg 1000%Iodine(fromKelpandIrishMoss) 175mcg 150%Zinc(fromL-OptiZinc®-ZincL-MethionineComplex) 25mg 170%Selenium(fromL-Selenomethionine)(Yeast-Free) 50mcg 70%Copper(fromCopperAminoAcidChelate) 1mg 50%L-Tyrosine(Free-Form) 1.0g1,000mg †IrishMoss(Chondruscrispus)(Thallus) 200mg †Guggul(Commiphoramukul)(ResinousSap) 75mg †StandardizedExtract(min.10%Guggulsterones)Kelp(Laminariadigitata)(WholePlant) 60mg †Ashwagandha(Withaniasomnifera)(Root)StandardizedExtract(min.4.5%Withanolides) 50mg †Concentrace®TraceMinerals 5mg †

*Dailyvaluebasedona2,000caloriediet.†Dailyvaluenotestablished.

90 Veg Caps - $21.99 180 Veg Caps - $38.99

(SAVE $5)

Tribulus 90 Tablets - $19.99

Tribulus has been used for centuries in ancient Greece, India and Africa to enhance vitality and virility. Recent research indicates that Tribulus can support the body’s free radical defense systems and preliminary studies suggest that Tribulus may help to promote healthy endocrine function and male reproductive health.

SUPPLEMENT FACTS

Serving Size: 1 Tablet Servings per Container: 90 Tablets

Amt/Serving DV%*Tribulusterrestris(Standardizedextract)(min.45%Saponins)(Fruit/AerialParts) 1,000mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Cellulose,StearicAcid(vegetablesource),SilicaandVegetarianCoating Not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients Suggested usage: Take 1 tablet daily with meal

Triphala 90 Veg Caps - $14.99

Triphala restores digestive function, encourages beneficial intestinal bacteria, enhances enzyme production, helps draw stagnated wastes out of the intestines, and encourages healthy and complete elimination. The formula is non-irritating, non-habit forming, can be used on a daily basis, and is gentle enough for those more sensitive to cleansing, and is suitable for vegetarians.

Studies have shown Triphala to have a wide-range of medicinalpropertiesincludingantioxidant,antibiotic,anti-inflammatory, adaptogenic, hypoglycemic, analgesic, antipyretic, antimutagenic, and anticancer. Triphala contains polyphenols and flavonoids, including gallic acid, chebulagic acid, and chebulinic acid, which are believed to contribute to its many health benefits.

SUPPLEMENT FACTSServing Size: 1 Vegetarian Capsule Servings per Container: 90

Amt/Serving DV%*OrganicTriphalaFruitBlend(ChebulicmyrobalanFruit, BellericmyrobalanFruit,Amalaki-AmlaFruit) 500mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: Modified Vegetable Cellulose

NEW

Turmeric Root(Organic)

Turmeric is one of the most potent anti-inflammatory herbs. It works by keeping naturally occurring levels of cortisone at higher blood levels, thus producing a systemic anti-inflammatory effect. This can help conditions ranging fromallauto-immunedisorders(MS,lupus,psoriasis,asthma,arthritis)toanyconditionwherecortico-steroiddruguseisindicated. This includes Crohn’s disease, colitis and bursitis.Turmeric is a liver cooler that prevents the liver from breaking down. It can arrest cirrhosis and stop necrosis of the liver. It helps alcoholics and drug abusers save their liver. It increases bile and as a result helps in fat digestion. It is indicated for those with elevated liver enzymes including Hepatitis C.

SUPPLEMENT FACTS

Serving Size: 1 Veggie Capsule Servings per Container: 60 Amt/Serving DV%*OrganicTurmericRoot(Curcumalonga)Extract 400mg †TurmericRootExtract(95%Curcuminoids,95mg) 100mg †TurmericRootCO2SupercriticalExtract(40%Turmerones,20mg) 50mg †BlackPepperFruitExtract 5mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Non-GMO Soy Lecithin, Vegetable Cellulose, Medium Chain Triglycerides, Chlorophyll

60 Liquid Capsules - $24.99NEW

Turmeric Advancedw/Bioperine750mg

Turmeric(Curcumalonga),thebrightyellowofthespicerainbow, is a powerful medicine that has long been used in the Chinese and Indian systems of medicine as an antiinflammatory agent to treat a wide variety of conditions, includingflatulence,jaundice,menstrualdifficulties,bloodyurine, hemorrhage, toothache, bruises, chest pain, and colic.

•BioPerinesupportsproperassimilationofturmeric,curcuminoid compounds and other nutrients

•APotent,YetSafeAnti-InflammatorySUPPLEMENT FACTS

ServingSize:1VegetarianCapsule ServingsPerContainer:60 Amt/Serving DV%*Turmericrootextract(Curcumalonga) 750mg(rhizome)(Standardizedto95%[712.5mg]curcuminoids)BioPerine(blackpepperfruitextract) 5mg *

*PercentDailyValuesarebasedon2,000caloriediet.+DailyValuenotestablished. OtherIngredients:Hydroxypropylmethylcellulose,vegetablemagnesiumstearateandsilicon dioxide.

60 Veg Caps - $26.99

Turmeric Advanced PowderTurmeric has a long history of use in Ayurvedic medicine. Curcumin is the active ingredient in turmeric and has been consumed for medicinal purposes for thousands of years. Several of the healthful inflammation response effects of curcumin are mediated through suppression of the expressionofmediatorsproducedbycells,allofwhichcomefromgenesregulatedbynuclearfactorkappaB(NF-kB).Black pepper and its principle component, piperine, aid in the absorption and bioavailability of curcumin. Finally, our organic turmeric is fermented using Lactobacillus acidophilus. Fermented foods provide beneficial probiotics and offer enhanced nutrient bioavailability.

•USDAOrganic•Fermented•Non-GMO

1.6 oz - $19.99

SUPPLEMENT FACTS

ServingSize:½Teaspoon(1.01g) ServingsperContainer:45 Amt/Serving DV%*OrganicFermentedTurmeric(rhizome/root)Booster 1,000mg †OrganicBlackPepper(fruit) 5mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Organic Acadia Gum, Lactobacillus Acidophilus Suggested usage: Add one serving daily to food or drink

Page 63: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

63www.LifesourceVitamins.com I 1-800-567-8122

Valerian Root 500 mg 100 Capsules - $9.99

Acalmingandrelaxingherbtorelievestressandcalmthebody. An effective sedative and sleep aid.

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:100

Amt/Serving DV%*ValerianRoot 500mg †

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished.

Vision Formula

LifeSource’sproprietaryblendisafullrangeofantioxidantnutrients which may aid in maintaining visual functions and complete eye health. Lutein, a carotenoid found in dark green leafy vegetables, is a dominant pigment in the macular regionoftheeye.Bilberryextractcontainsbiologicallyactiveflavonoids which support healthy vision. This formula is a must for people who have a history of eye problems in their family’s tree.

SUPPLEMENT FACTS

ServingSize:4Capsules ServingsPerContainer:30

Amt/Serving DV%*VitaminB12(Cyanocobalamin) 25mcg 416.5%PantothenicAcid(d-CalciumPanthotenate) 50mg 500%Calcium(asCalciumCitrate) 50mg 5%Iodine(fromPotassiumIodide) 10mcg 6.5%Magnesium(asMagnesiumCitrate)125mg 31.5%Zinc(ZincCitrate) 25mg 83.25%Selenium(l-Selenomethionine) 100mcg 143%Copper(CopperAminoAcidChelate) 1.5mg 75%Vitamin A 16250 IU 325%VitaminC(AscorbicAcid) 250mg 416.5%VitaminE(d-AlphaTocopherylAcetate) 100IU 333.5%Thiamine(ThiamineHCI) 10mg 666.5%Riboflavin 12.5 mg 735.5%Niacin(83%Niacinamide&17%Niacin) 30mg 150%

Amt/Serving DV%*VitaminB6(PyridoxineHCI 15mg 750%Folic Acid 400 mcg 100%Manganese(ManganeseCitrate) 5mg 250%Chromium 100mcg 83.5%Molybdenum 60mcg 80%Potassium 49.5mg 1.5%L-Taurine 250 mg *Quercetin 150mg †NAC(N-AcetylCysteine) 125mg †L-Methionine 100mg †GinkgoBilobaLeafExtract 30mg †GlutamicAcid 25mg †L-Glycine 25mg †Bilberry 25mg †Lutein 20mg †Silica(fromHorsetailHerb) 5mg †Boron(asBoronCitrate) 300mcg †

120 Capsules - $19.99 240 Capsules - $33.99

(SAVE $6)

*Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished.

Water Gone HerbalDiuretic 100 Veg Caps -$14.99

The term diuretic refers to any substance that helps to rid thebodyofexcessbodyfluidsandsaltsthroughurination.These can take the form of prescription or over-the-counter drugs, homeopathic and herbal remedies or certain foods with diuretic qualities that promote urine formation.

Whatever the source, diuretics help to prevent or treat a numberofconditionsincludingEdema,High-BloodPressure,Kidney Stones and Glaucoma.

SUPPLEMENT FACTS

ServingSize2VegCaps ServingsPerContainer50

Amt/Serving DV%*VitaminB-6(fromPyridoxineHCl) 25mg 1471%Potassium(fromPotassiumChloride) 99mg 2%UvaUrsiExtract(Arctostaphylosuva-ursi)(Leaf)(Standardizedtomin.20%Arbutin) 250mg †Dandelion(Taraxacumofficinale)(Leaf) 200mg †Juniper(Juniperuscommunis)(Berries) 120mg †Buchu(Agathosmaspp.)(Berries) 120mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished Other Ingredients:Cellulose(capsule),RiceFlour,StearicAcid(vegetablesource)andMagnesiumStearate(vegetablesource) Not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients. Non-GMO

Ultra Weight Loss 60 Capsules - $19.99

We have combined 7 different weight loss, fat burning and metabolism enhancing supplements in one amazing product. Our Ultra Weight Loss Liquid has helped thousands of people control their weight. Now reformulated in convenient capsule form,thisproduct(alongwithahealthy,well-balanceddiet)canhelp you support a healthy body weight.

•WeightLoss•BurnsFat•CurbsAppetite•HelpsReduceCaloricIntake•BoostMetabolism

SUPPLEMENT FACTSServing Size: 2 Capsules Servings per Container: 30

Amt/Serving DV%*RaspberryKetones 600mg †GreenTeaExtract 100mg †Resveratrol 100mg †AfricanMango(IrvingiaGabonensis) 100mg †AcaiFruitExtract 100mg †AppleCiderVinegarPowder 100mg †Kelp 100mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients: Vegetable Capsule, Microcrystalline Cellulose Suggested usage: Take 1 capsule twice daily

Ultra Dairy Digest 60 Veg Capsules - $13.99

•DigestiveAidforThoseLactoseIntolerant•PromotesDigestionofLactose,MilkProteins&Fats•ContainsEnzymesNeededtoBreakDownNutrients

SUPPLEMENT FACTS

Serving Size: 1 Vegetarian Capsule Servings per Container: 60

Amt/Serving DV%*ProprietaryDairyenzymeblend 200mg †Lactase 1,000ALU †Proteases 630BLGU/25,000HUT †Lipase 250FCCFIP †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished Other Ingredients: Vegetablecapsule(cellulose,water),cellulose,magnesiumstearateandsilica Contains No sugar, salt, daily, yeast, wheat, gluten, soy, preservatives, artificial colors or flavors Suggested usage: Take 1 tablet 1 to 3 times daily

Wheatgrass Powder 1 lb - $19.99

Organic Wheatgrass is a nutrient-rich grass containing 17 amino acids. Wheatgrass retains 92 of the 102 minerals foundinthesoilincludingCalcium,Phosphorus,Iron,MagnesiumandPotassium.ItisarichnaturalsourceofVitaminsAandC.ItisexceptionallyrichinVitaminsE,K andB-Complex.

LifeSource’sUSDAOrganicWheatgrass,designedtohelpsupport a normal inflammatory response, proper digestion and weight loss.

SUPPLEMENT FACTS

ServingSize:5g(1Tablespoons) Servings per Container: 90

Amt/Serving DV%*Calories 15.74 143%Energy 6.54KJ †TotalFat .12g .18%Sodium 7.1 mg .30%TotalCarbohydrates 2.64g .88%Protein .96g 1.92%

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Ingredients: 100%OrganicWheatgrassPowder Suggested usage: Take 1 tablespoon daily

NEW

Page 64: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

64 www.LifesourceVitamins.com I 1-800-567-8122

zinc Picolinate 50 mg 60 Capsules - $7.99

•Helpskidneysmaintainacidbasebalance&detoxify•Braindevelopment.•Thesensesofappetite,taste&smell.•Participatesinantioxidantenzymesystemsinyoureyes,

helping to prevent & slow the progression of macular degeneration.

SUPPLEMENT FACTS

ServingSize:1Capsule ServingsPerContainer:60

Amt/Serving DV%*Zinc(fromZincPicolinate) 50mg 333%

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:RiceFlour,Cellulose(capsule)andMagnesiumStearate(vegetablesource) Not manufactured with yeast, wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients.

zMA Sports Recovery800MG 90 Capsules - $19.99

ZMAisanaturalboostingtestosteronesupplement.Preferredby athletes in all sports who want to improve performance and accelerate healing and tissue repair.

Benefits of ZMA:•Faster&MoreEfficientRecovery•BetterSleep•IncreasedEndurance•IncreasedStrength/Gains•IncreasedTestosteroneLevels

SUPPLEMENT FACTS

ServingSize:3CapsulesMen/2CapsulesWomen ServingsperContainer:30/45

Amt/Serving DV%*AmountperServing: DV%VitaminB-6(fromPyridoxineHCI) 15mg 882%Magnesium(fromMagnesiumAspartate) 450mg 107%Zinc(fromZincMono-L-methionineandZincAspartate) 30mg 273%

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Gelatin(capsule),RiceFlourandMagnesiumStearate(vegetablesource) Not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients. Non-GMO

Ultra Women’s Vitality 60 Capsules - $9.99

Synergistic blend to help with Aging, Energy and Virility. The hormonal imbalances derived from menopause have been showntoleadmostwomentoexperiencesomeformofsexualdysfunction, whether it be lack of desire and or arousal. This unique blend promotes hormonal balance, with improved circulation,antioxidantsandadaptationsthathavebeenshownto support energy levels and libido.

SUPPLEMENT FACTS

ServingSize:2Capsules ServingsPerContainer:30

Amt/Serving DV%*HorneyGoatWeedExtract (providing10mgoficariins) 1,000mg †Proprietary Blend 560mg †MacaRootPowder,TongkatAliRootPowder,SawPalmettoBerryPowder,TribulusTerrestris40%extract,PolypodiumPowder,MuiraPuamaRootPowder,L-Arginine,andPanaxGinsengRootPowder

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Other Ingredients: RiceFlour,gelatin(bovine),andvegetablemagnesiumstearate

Women’s Balance PMSSupport 90 Capsules - $16.99

This product is a unique herbal support formula forwomen.WehavecombinedstandardizedherbalextractsofWildYamandVitexwithnutritionalsupportfromDongQuai, GLA, Vitamin B6 and Folic Acid to promote a healthyfeminine balance.

SUPPLEMENT FACTS

ServingsSize:1VegCapsule ServingsPerContainer:90

Amt/Serving DV%*VitaminB-6(asPyridoxineHCI) 17mg 850%Folate(asFolicAcid) 133mcg 33%BorageOilPowder(15mgGLA) 100mg †WildYamExtract(Dioscoreavillosa)(root)(6%Diosgenin) 75mg †DongQuai(Angelicasinensis)(root) 100mg †ChasteBerryTree(Vitex)Extract(agnuscastus)(fruit)(0.5%Agnusides) 50mg †

*PercentDailyValuesarebasedon2,000caloriediet.†DailyValuenotestablished. Other Ingredients:Cellulose(capsule),RiceFlour,MagnesiumStearate(vegetablesource),SilicaandBlackCohosh(Rhizome/Root)Not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients Directions: Take 1 capsule three times daily

GrASS-fEd WHEy CONCENTrATE Or GrASS-fEd WHEy ISOlATE?Both forms of Whey Protein have amazing sport & lifestyle benefits, but one may better suit your personal nutritional needs and fitness goals.Whey Protein Concentrate• After Whey Protein is removed from the milk, it needs to be processed. To make concentrate, the protein goes through a

micro-filtering process. The result is a protein powder that is pure and effective.  • The percentage of the Whey Protein you can get per serving varies depending on the quality of the product. This typically varies

from 30% to 80% depending on the company, ours is about 85%. Whey Protein Isolate• Although Whey Protein Isolate supplements are less common than Concentrate, they are more effective in certain ways. In fact,

Isolate contains more protein than concentrate per serving.• Whey Isolate goes through a cross-flow microfiltration process. The protein is separated from lactose, fat, and cholesterol.

By ingesting fewer carbs and calories, you don’t have to worry about your protein shakes hurting your diet. Bottom Line: Whey Concentrate: Great choice for Seniors due to the extra macronutrients, BCAA’s, and muscle assisting properties. Whey Isolate: We suggest this product for people in the gym, wanting to build lean muscle mass, want a few less calories and are lactose intolerant. Call us if you want to chat more about these or any products: 800.567.8122

Page 65: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

65www.LifesourceVitamins.com I 1-800-567-8122

1.1 lbs. — $24.99 (Chocolate & Vanilla)

3 lbs. — $59.99 (Chocolate, Vanilla, Unflavored)

6 lbs. — $102.99 (Chocolate, Vanilla, Unflavored) Free Shipping Over $99

(SAVE $17)

Our whey protein comes from grass fed U.S. raised dairy cows that are:•Diseasefree•Pesticide-free•Chemical-free•Hormonetreatmentfree•GMOfree

Why Whey Isolate?Our whey protein comes from grass fed U.S. raised dairy cows that are:•Diseasefree•Pesticide-free•Chemical-free•Hormonetreatmentfree•GMOfree

WheyProteinIsolateisoneofthegreatestwaystosupplementyournutritiontoday.Unlike regular protein powders, whey isolate contains more protein by weightthan anything else and is considered one of the best new forms of superfood thatis out there on the market today. The reason for it’s growing success is really thefact that whey protein isolate is a new scientific break through gaining tremendousrecognition and notoriety in the natural healthy industry. Now some of you might beasking the question, “What is the difference between an isolate and a concentrate?”For those of you who are lactose intolerant, isolates contain only 1% lactose whileconcentrates contain 5-6%. Really both are such incredibly small percentagesthatunlessyouhadanextremelysuperdelicatecaseoflactoseintolerance,yourbody won’t even be susceptible at all to this. This is why whey itself is incrediblybeneficial. Additionally, whey protein isolate has a higher BV, or biological value,becauseitcontainsmoreproteinwithlesslactose.Wheyisolatecontains90-98%proteinwhileconcentratescontainanywherefrom70-85%protein.Buttobecompletely honest, both isolates as well as concentrates help in such tremendousways that I recommend this for anybody to take. Not only does it reduce body fat,reduce food cravings, but it increases your immune system, reduces aging signs,lowers cholesterol levels and also helps fight the risk of getting cancer.

DO NOT BE FOOLED BY LOW COST PROTEIN POWDERS. IF IT IS A LOW COST PROTEIN YOU CAN BET THAT THEY USE HEAT TO PROCESS OR THEY USE DEAD PROTEINS!

•25GramsofourPureCleanProprietaryBlendProtein100%WheyProteinIsolatePerServing(Chocolate,Vanilla&Un-flavored).

•ItcomesfromRaw,unpasteurizedmilk.•Ourproteinpowderiseffective,period!•ContainsBCAAs,whicharemetabolizeddirectlyandabsorbedquicklyintomuscle

tissue, therefore providing the desired results quicker! Guaranteed.•Easilyuploadedtothebloodstream,unlikemostWheyProtein.•MicrofiltrationTechnologyisusedinprocessingourWheyProteinIsolate.•DriedatColdTemperaturesbecauseheatkillsprotein!•FatFree,LactoseFree&CarbohydrateFree.•Mixeseasilyandtastesamazing,ourDoubleChocolateFudgeactuallytastesasgood

as it sounds.•Nature’sHighestQualityProteinfromgrassfedcowsthataredisease-free,

pesticide-free, chemical-free, hormone treatment-free and GMO-free.•ContainsUndenaturedWheyMicrofractions

Whey Protein Isolate Double Chocolate Fudge, Creamy French Vanilla, & Unflavored

WE HAVE THE MOST ADVANCED WHEY PROTEIN ISOLATE AVAILABLE ANYWHERE!

25 GRAMS OF PROTEINCHOOSE FROM 3 VARIETIES

DOUBLE CHOCOLATE FUDGE, CREAMY FRENCH VANILLA & UNFLAVORED

NUTRITIONAL FACTS — DOUBLE CHOCOLATE FUDGE

ServingSize:1HeapingScoop(39g) ServingsperContainer:36

Amt/Serving DV%*Calories 120

Calories from Fat 4

Total Fat 1 g 1%

SaturatedFat 0g †

Cholesterol 0g †

Sodium 34 mg 1%

Total Carbohydrates 2 g 5%

DietaryFiber 1g 2%

Sugars 1g †

Protein 25g

Vitamin A 3%

Vitamin C 3%

Calcium 9%

Iron 1%

*PercentDailyValuesarebasedon2,000caloriediet.

†DailyValuenotestablished.

Ingredients: Cross-FilteredWheyProteinIsolate,L-Glutamine(notfoundinUnflavored),

Natural Cocoa and French Vanilla Flavoring, and Stevia

GRASS FED

NO PESTICIDESNO HORMONES

NO GMOS

Page 66: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

66 www.LifesourceVitamins.com I 1-800-567-8122

2 lbs. — $44.99

4 lbs. — $79.99 (SAVE $10)

Westartedwithour“Tried&True”formulaofGrass-Fed,ColdProcessed,Cross Filtered Whey Isolate. Then we packed it full of nutrition with our awardwinningPhytoNutrientPowders.OurGreenPhytoFoodsarethecombinationofthe best of green SuperFoods available anywhere in the world. LifeSource’s GreenPhytoSuperFoodscontainhighconcentrationsofnaturalchlorophyll.GreenSuperFoodsareacategoryofPhytonutrient-richnutritionalproductsderivedfrom green plants, algae and cereal grasses. They are harvested seasonally totake advantage of high potencies of naturally occurring vitamins, minerals, aminoacids,enzymes,plantsterolsandothernutritionalconstituents.PhytoRedsfrom LifeSource are an ideal nutritional boost for every individual who wants toensure that in one’s diet that one has the nutrients and phytonutrients needed foroptimumhealthespeciallyfromnaturalsuperfoods.OurPhytoRed’sarefortifiedwith key nutrients to enable the body to boost the immune system and protectthe body against free radical damages, all which have been associated withdegenerativediseases.OurPhytoRedsareideaforweightlossandoverallgreat health.Hands down – this is one the greatest products we have ever produced!•EasilyDigestibleforanyagegroupandexerciselevels.•SuperiorAminoAcidProfile,crucialforgrowthandretentionofmuscles.•SuperiorProteinforLeanMuscleGrowth,whichhelpswithlossofbodyfat.•Wholebodysupportwithvitamins,enzymes,fruits,andfiber.•Highinnaturalanti-oxidantsforhealthyaging,vascularandimmunesupport.•ProbioticSuperBlendtosupportdigestion

Whey Plus Greens & Reds

NUTRITIONAL FACTS — DOUBLE CHOCOLATE FUDGEServing Size: 1 Heaping Scoop = 39 g

Amt/Serving DV%*Calories 133Calories from fat 12Total Fat 1 g 2%Saturated Fat 0 gCholesterol 0 gSodium 45 mg 2%Total Carbohydrate 7 g 2%DietaryFiber 3g 12%Sugars 2 g <2%Protein 23g 46%Vitamin A 3256 iu 65%Vitamin B12 1 mcg 17%Vitamin C 2 mg 3%VitaminK 80mcg 100%Calcium 98mg 10%Iron 1 mg 5%Iodine(fromKelp) 75mcg 50%Magnesium 12 mg 3%Zinc 450 mcg <1%GreenPhytoFoodsLecithin(FinePowder) 1000mg †Spirulina(Hawaiian,Org.) 1000mg †AlfalfaJuiceConcentrate 350mg †WheatGrassPowder,Org. 250mg †PlantBasedEnzymes 175mg †BarleyGrassPowder,Org. 250mg †CarrotPowder 250mg †BarleyMaltPowder 200mg †BroccoliPowder 175mg †BrownRiceBran 175mg †AppleFiber 175mg †ApplePectin 150mg †OatBran 150mg †ChlorellaPowder 150mg †RedBeetPowder 150mg †PanaxGinsengRootPowder 125mg †(C.A.Mayer)(min.5%Ginsenosides)Eleuthero 50mg †(EleutherococcussenticosusRoot)PeppermintPowder 75mg †GreenTeaExtract(40%Catechins) 50mg †RoyalJellyPowder(min.5%10-HDA) 50mg †Fructooligosaccharides 50mg †TraceMineralConcentrate 50mg †MilkThistleExtract(80%Silymarin) 40mg †KelpPowder 25mg †GinkgoBilobaExtract 10mg †(24%GinkgoflavonglycosidesLeaves)GrapeseedExtract(95%Polyphenols) 10mg †

Amt/Serving DV%*WheyPlusGreens&RedsBilberryExtract(25%Anthocyanidins) 10mg †AlphaLipoicAcid 5mg †CoenzymeQ10(CoQ10) 5mg †RedPhytoFoodsProbioticBlend 50mg †L.Acidophilus,L.Casei,L.Rhamnosus,L.Plantarum,B.Breve,andB.LongumCarrotPowder 300MG †ApplePectin 125MG †FlaxSeed 125MG †OatBran 88MG †Lecithin 75MG †RiceBran 50MG †ORACBlend 25MG †JapaneseKnotweed 20MG †BilberryStd.Extract 25%20MG †GrapeSeedExtract 15MG †Lycopene 125MCG †Lutein 125MCG †Astaxanthin 10MCG †ProprietaryBlend 3338MG †Cherries,Nectarines,Peaches,Pears,GogiBerries,Mangos,Pomegranates,Papayas,BlackCurrants,andWatermelon.

**Dailyvaluesarebasedon2,000caloriediet.†Dailyvaluenotestablished. +Naturallyoccurring.

Ingredients:CrossFilteredWheyProteinIsolate,L-Glutamine(notinunflavored),AllNaturalCocoaandVanillaextractsandStevia.

Top Rated by Customers!Not 1, not 2 but 3 of our best-selling

products combined to create the World’smost nutritious and best tasting WheyProtein. This powerhouse product willgive you energy and stamina to tackle

anything during your day.____________________

Available in Double Chocolate Fudge

GRASS FED

NO PESTICIDESNO HORMONES

NO GMOS

Page 67: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

67www.LifesourceVitamins.com I 1-800-567-8122

3lb. — $59.99 (Chocolate, Vanilla, Unflavored)6lb. — $102.99 (Chocolate & Vanilla Only)

Free Shipping Over $99

(SAVE $17)

OUR WHEY PROTEIN COMES FROM CERTIFIED GRASS FED MIDWEST DAIRY COWS THAT ARE:

CERTIFIED DISEASE-FREE• PESTICIDE-FREE• CHEMICAL-FREE• HORMONE TREATMENT-FREE• RBGH FREE• CERTIFIED - GMO-FREE• SWEETENED WITH STEVIA, NOT SUCRALOSE!

EasilyDigestibleforanyagegroupandexerciselevels.

•PerfectforSenior’swhocan’tconsumeenoughprotein

•ProvidesMaximumNitrogenRetention,whichenhancesgrowthofmuscles.

•SuperiorProteinforLeanMuscleGrowth,whichhelpswithlossofbodyfat.*

•SupportsMuscleRepairandRecovery,inturnspeedsupmassandbuilding.*

•BoostsImmuneSystem,whichkeepsushealthyandactive.*

•Ourproteinpowderisbioabsorbableandeffective,period!

•ContainsBCAAs,whicharemetabolizeddirectlyandabsorbedquicklyintomuscle

tissue. Therefore providing the desired results quicker! Guaranteed.

•Easilyuploadedtothebloodstream,unlikemostWheyProtein.

•Micro-filtrationTechnologyusedinprocessingourWheyProteinConcentrate.

•DriedatColdTemperatures,heatkillsprotein,wewillneveruseheat!

WE DO NOT MASS-PRODUCE OUR PROTEIN AS MOST OTHER COMPANIES DO, WE MAKE SMALL BATCHES EVERY COUPLE OF WEEKS TO ENSURE THAT YOUR BODY RECEIVES THE FRESHEST PROTEIN WELL AND UTILIzES THE PROTEIN AS IT IS INTENDED TO THROUGH A FRESH PROTEIN BASE.

What’sthebigdealwithGrassFedWheyProtein?We have a very select few ranchers that we deal with that raise the cattle the way

we feel they should be raised. They raise them with Compassion and Humanely.

So we have had a tight knit group of ranchers that we have always bought

fromthatdonotuseanyhormones,chemicalsorGMO’s(GeneticallyModified

Organisms).Wealsomandatethecowsbegrassfedwhichiswhattheyshouldbe

ingesting for their long term health. With this process comes the most nutritiously

rich, nutrient packed milk which in turn means the best possible whey protein is

produced from this milk. Over 95% of all ranchers in the United States cannot

qualifyforustoworkwiththemforourWheyProteinduetowhattheyfeedthese

animals, the hormones and antibiotics they feed them. They also add GMO Corn

orfoodtocuttheirexpenses;thisissimplynotacceptableforLifeSource,sothis

really limits who we can work with. I guess that commercial really is right, Happy

CowsMakeHappyMilk,CheeseandWheyProtein!

Whey Protein Concentrate (Vanilla, Chocolate, Unflavored)

AVAILABLE IN DOUBLE CHOCOLATE FUDGE, CREAMY FRENCH VANILLA, AND UNFLAVOREDNUTRITIONAL FACTS — DOUBLE CHOCOLATE FUDGE

ServingSize:1HeapingScoop(39g) ServingsperContainer:36

Amt/Serving DV%*

Calories 120

Calories from Fat 4

Total Fat 1 g 1%

SaturatedFat 0g †

Cholesterol 0g †

Sodium 34 mg 1%

Total Carbohydrates 2 g 5%

DietaryFiber 1g 2%

Sugars 1g †

Protein 23g

Vitamin A 3%

Vitamin C 3%

Calcium 9%

Iron 1%

*PercentDailyValuesarebasedon2,000caloriediet.

†DailyValuenotestablished.

Ingredients: Cross-FilteredWheyProteinConcentrate,L-Glutamine(notfoundinUnflavored),

Natural Cocoa and French Vanilla Flavoring, and Stevia

GRASS FED

NO PESTICIDESNO HORMONES

NO GMOS

Page 68: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

68 www.LifesourceVitamins.com I 1-800-567-8122

INTRODUCING OUR NEW LINE LIQUID HERBAL EXTRACTSORGANIC & WILD HARVESTED

• Allergies, Hay Fever, Asthma, Sinus, Infections

• Works as Anti-Histamine & Decongestant

• Can Prevent Allergies and Help with Allergy Symptoms

1 fl. oz. - $11.99Aller-Calm Liquid Extract

• Each Serving Delivers the Extract from 5,000 mg of Fresh Fruit

• Acai Berry, Mangosteen Fruit Extract, Goji Berry, Pomegranate Fruit

• Powerful Combination of Nature’s Most Potent Plant Protectors

1 fl. oz. - $14.99Acai Super Berry Antioxidant Liquid Extract

• Used for Conditions Related to Respiratory Health

• Stomach & Intestinal Issues• Anti-Inflammatory with Immune

Boosting Properties

4 fl. oz. - $21.99Black Cumin Seed Oil (Organic)

• Homeopathic Medicine • Reduces Topical Pain • Calms Skin Inflammation

1 fl. oz. - $11.99Colloidal Silver Plus Topical Spray

• For Acute and Chronic Cough • Nasal Congestion or Discharge • Bronchitis, Emphysema,

Whooping Cough, Smoker’s Cough

4 fl. oz. - $12.99Bronchial Syrup Liquid Extract

• Liver Cooler for Elevated Liver Enzymes

• Calms the Liver to Prevent Liver Breakdown

• Cleansing Herb for Skin Conditions Such as Acne and Eczema

1 fl. oz. - $12.99Dandelion Liquid Extract

• Facilitates a Full Body Cleansing • Blood & Tissue Cleansing • Liver, Urinary Tract, Skin

and Lymph

1 fl. oz. - $11.99Detoxify Liquid Extract

• Can Help the Body Manage Stress

• Auto-Immune Disorders • Supports a Healthy Immune

System

1 fl. oz. - $11.99Ashwagandha Liquid Extract

• Alcohol-Free • Natural Peppermint Flavor • Herbal Remedy to Battle

Bad Breath

1 fl. oz. - $7.99Breath Freshener Spray

• Capable of Destroying Hundreds of Bacteria and Viruses

• Colloidal and Ionic Particles at 15 PPM

• Contains Olive Leaf and Oregano Oil for Added Immune Power

1 fl. oz. - $11.99Colloidal Silver Plus Oral Drops

• New Concentrated Formula in Delicious Citrus Flavor

• Rose Hips and Bioflavonoids to Ensure Absorption and Efficacy

• Vitamin C Plays an Essential Role in Strengthening Blood Vessels and Bones

4 fl. oz. - $9.99Liquid Vitamin C 500mg

• Stimulate the Body’s Ability to Secrete More Digestive Enzymes

• Can be Used for Chronic Indigestion

• Contains Fennel and Peppermint to Sooth Digestive System

1 fl. oz. - $11.99Digest-Ease Liquid Extract

Page 69: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

69www.LifesourceVitamins.com I 1-800-567-8122

• Use as a Preventative for Colds or the Flu

• Take at the First Sign of Immune Breakdown

• Immune Booster for Those with Immune Deficiency

1 fl. oz. - $11.99Echinacea-Goldenseal Liquid Extract

• One of the Most Effective Herbs for the Flu

• Power Antioxidant • Can Reduce Oxidation of

LDL Cholesterol

1 fl. oz. - $12.99Elderberry Liquid Extract

• Menopausal Formula for Long-Term Use

• Minimize Hot Flashes, Mood Swings and Swelling

• Maximize the Use of Residual Estrogen and Progesterone

1 fl. oz. - $11.99Fem Silver Liquid Extract

• Combines Red Chinese and American Ginseng Along with Other Herbs

• Combined to Help with Stress, Fatigue and Immune Deficiency

• May Enhance Adrenal Function

1 fl. oz. - $13.99Ginseng Master/Energy Liquid Extract

• Can Alleviate Nausea Due to Motion Sickness or Chemotherapy

• Useful Aid to Increase Digestive Enzymes

• Helps You Digest Foods and Move Them Through the Digestive Tract

1 fl. oz. - $11.99Ginger Fresh Liquid Extract

• Preventative for Gum Disease • Helps to Kill Bacteria in the Mouth

and Gums • Tightens Gums that are Puffy

and Bleeding

1 fl. oz. - $11.99Gum Tonic Liquid Extract

• Immune Enhancement • Avoid Getting Sick or Push Your

Illness Out of your Body • Stimulate Immune Activity and

Fight Bacteria and Viral Conditions

1 fl. oz. - $13.99Immuno Well Rx Liquid Extract

• For Hypothyroidism and Goiter Caused by Iodine Deficiencies

• Increase Energy Levels • Reduce Fatigue, Mental

Sluggishness and Weight Gain

2 fl. oz. - $8.99Iodine (W/ Kelp) Liquid Extract

• Natural Way to Address Headaches of All Kinds

• Pain Reliever, Decrease Inflammation & Throbbing

• Migraines, Sinus, Allergy and Tension Headaches

1 fl. oz. - $11.99Head-Aid Liquid Extract

• Circulatory Support• Supports Heart Health• Antioxidant Properties

1 fl. oz. - $11.99Hawthorn Liquid Extract

• Anti-depressant that Elevates Moods and Sensory Perception

• Can Diminish Pain and Decrease Adrenaline

• Sedative, Muscle Relaxant and Promotes REM Sleep

1 fl. oz. - $13.99Kava Root Liquid Extract

• Ideal for Hay Fever, Asthma or Other Environmental Allergies

• Use as a Preventative or when Acute with Allergy Symptoms

• For Ages 1 and Up. Ideal for Children, Teens and Adults

1 fl. oz. - $11.99Kid’s Aller-Calm Alcohol-Free Liquid Extract

Driven by Faith • Powered by God

Page 70: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

70 www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • Powered by God

• Effective for Increasing Cognitive Ability

• Helping with Attention, Memory and Focus

• For Ages 2 and Up. Ideal for Children, Teens and Adults

1 fl. oz. - $11.99Kid’s Attention Plus Alcohol-Free Liquid Extract

• Echinacea-Goldenseal Formula with Other Child-Friendly Herbs

• For Use when Your Little One Feels a Cold/Flu Coming On

• For Ages 2 and Up. Ideal for Children, Teens and Adults

1 fl. oz. - $11.99Kid’s Biotic Alcohol-Free Liquid Extract

• For Acute and Chronic Ear Infections

• Gently Drop Oil into Ear to Reduce Pain and Discomfort Due to Infection

• Removes Extra Fluid Buildup

1 fl. oz. - $11.99Kid’s Ear Clear Oil Alcohol-Free Liquid Extract

• Acute Formula to Help Kids Resolve their Respiratory Congestion

• Makes a Cough More Productive to Clear Out the Lungs

• For Ages 2 and Up. Ideal for Children, Teens and Adults

1 fl. oz. - $11.99Kid’s Bronchial Alcohol-Free Liquid Extract

• Boost Immune Function When Low or Deficient

• Added Elderberry Increases Efficacy for Use for Symptoms of a Cold/Flu

• For Ages 2 and Up. Ideal for Children, Teens and Adults

1 fl. oz. - $11.99Kid’s Echinacea Plus Alcohol-Free Liquid Extract

• Can be Used During the Day to Help Calm Down an Excitable Child

• Use 10-30 Minutes Before Bedtime to Bring on Sleep

• For Ages 2 and Up. Ideal for Children, Teens and Adults

1 fl. oz. - $11.99Kid’s Mellow Plus Alcohol-Free Liquid Extract

• For Female Hair Loss, Cracked or Brittle Hair or Premature Graying

• Beneficial for Cracked or Weak Nails and Dry Skin

• Helpful for Weakened Thyroid Function

2 fl. oz. - $19.99Lustrous Hair Liquid Extract

• For Stagnant Lymph Conditions that Result in Swollen Lymph Nodes

• Can Address Viral Problems Such as Mono, Chronic Tonsillitis, and Recurring Respiratory Virus

1 fl. oz. - $11.99Lymph Tonic Liquid Extract

• Kids Need D3 to Build Strong Bones and to Heal After Injury

• Promotes the Absorption of Calcium and Phosphorus

• Strengthens the Immune System and Regulates Cell Growth

1 fl. oz. - $9.99Kid’s Vitamin D3 400 IU Grape Flavor Alcohol-Free

• Mild Laxative Formula• For Occasional Constipation or

Sluggish Bowels• Safe for Children, the Elderly and

Anyone with a Sensitive System• For Ages 2 and Up. Great for Kids,

Teens and Adults

1 fl. oz. - $11.99Kid’s Potty Helper Alcohol-Free Liquid Extract

• Supports Healthy Sexual Function & Activity

• Strengthens & Enhances Libido• L-Arginine, Maca, Yohimbe,

Tribulus, Saw Palmetto & More

1 fl. oz. - $11.99Male Virility Liquid Extract

• Male Prostate Tonic to Help Prevent Benign Prostatic Hyperplasia

• Helps to Reduce Prostate Swelling• Keeps Testosterone Healthy and

Maintain a Healthy Libido

1 fl. oz. - $11.99Men’s Silver (Prostate Formula) Liquid Extract

Page 71: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

71www.LifesourceVitamins.com I 1-800-567-8122

• Herbal Remedy to Quickly Combat Bad Breath

• Peppermint is Known to have Antiviral and Antibacterial Properties

• Contains Chlorophyll Which Cleanses and Detoxifies the Digestive Tract

1 fl. oz. - $7.99Peppermint Breath Spray-Peppermint Plus

• Valerian Formula, Helps with Insomnia, Anxiety, Headaches and Pain

• Helps Reduce Emotional and Mental Drama

• Addiction Recovery from Alcohol, Drugs, Cigarettes or other Addictions

1 fl. oz. - $11.99Relax Liquid Extract

• Respiratory Remedy for Acute Colds, Flu, Sinus Infections

• Ideal for Asthma, Bronchitis, Pneumonia, and General Lung Infections

• Clear the Lungs of Congestion in Order to Resolve Lingering Mucus

1 fl. oz. - $11.99Respir-Ease Liquid Extract

• Has an Immediate, Dramatic and Direct Impact on the Sinus

• Helps to Deepen Breathing and Helps to Kill Microbial Inundation

• Use for Sinus Infections, Colds and Flus, Congestion from Allergies

• Can Helps Smokers Decongest

1 fl. oz. - $16.99Sinus Blaster Spray

• Throat Spray for Sore and Irritated Throats Due to Illness or Overuse

• Warms the Lungs and Sooths the Throat• Respiratory Remedy for Acute Colds,

Flu, Sinus Infections, Asthma, Bronchitis, Pneumonia, Smoker’s Cough

1 fl. oz. - $11.99Throat Spray Relief

• General Female Tonic that Helps Balance Hormones and Increase Energy

• Protects the Body Against the Negative Impacts of Stress

• Can Assist with Mood Swings, Irritability, Fatigue, PMS, Stress and Depression

1 fl. oz. - $11.99Woman’s Energy Balance Liquid Extract

• Long History of Use as a Sedative and Sleep Aid

• Will Quite a Busy Mind • Promotes Sleep for Those Who

Cannot Fall or Stay Asleep

1 fl. oz. - $11.99Valerian Liquid Extract

• Available in Caramel, Chocolate, Cinnamon, Hazelnut, Orange, Peppermint and Vanilla

• All-Natural Sweetener

2 fl. oz. - $12.99Stevia Extract Liquid

• Topical Formula to Treat Skin Irritations (Poison Oak & Poison Ivy)

• Also Can be Used on Bug Bites, Bee Stings, Hives and Minor Burns

• Reduce Redness and Swelling, Relieve Itching and Reduce Pain

2 fl. oz. - $12.99Oak & Ivy Topical Spray

• Virus Protection• Blood Pressure Support• Brain – Neuroprotection• Arterial Health

1 fl. oz. - $14.99Olive Leaf Liquid Extract

• One of the Most Potent Anti-Inflammatory Herbs

• Keeps Naturally Occurring Levels of Cortisone at Higher Blood Levels

• Can Help Auto-Immune Disorders Such as Asthma, Arthritis, MS and Lupus

1 fl. oz. - $11.99Turmeric Liquid Extract

• Formula for Urinary Tract Infections

• Can Assist in the Passing of Kidney Stones

• Uva Ursi Leaf, Nettle Leaf, Dandelion Root & More

1 fl. oz. - $11.99UT Balance Liquid Extract

Driven by Faith • Powered by God

Page 72: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

72 www.LifesourceVitamins.com I 1-800-567-8122

WhatsetsLifeSourceVitaminsDog&PuppyVitaminsapartfromothermultivitaminsonthemarket is our ingredients. Our ingredients are the best we can find anywhere. They contain 35 synergistic nutrients including a perfect balance of fat and water soluble vitamins to maintain the physical well-being of your dog, digestive enzymes to improve absorption, Omega3forhealthyskinandcoat,andantioxidantsforimmunesystemsupport.

DAILY FEEDING GUIDELINES

Guaranteed Analysis Per 1 oz.Moisture(Max) 84.6%Vitamin A 500 IUVitamin B Complex(B1,B2,B3,B5,B6,B12, FolicAcid,Biotin,Choline,Inositol,PABA) 20mgCalcium Ascorbate 150 mgVitaminD 50IUVitamin E 20 IUVitamin K 10 mcgCoQ10 200 mcgCalcium 150 mgCopper 2 mgIodine 50 mcgChromium 100 mcgIron 10 mgMagnesium 25 mgManganese 4 mgChloride 2 mgSilicon 1 mgMolybdenum 50 mcgPhosphorus 100mgPotassium 30mgZinc 2 mgSodium 10 mg

Lutein 3 mgCobalt 10 mcgSelenium 75 mcgGlucosamine 100 mgMSM 500 mgAloe Vera 10 gSeaweed Blend(Bladderwrack,AlariaValida, Costania Costata, Fucus Gardneri, Gigartina, Laminaria, Nereocystis, Ulva Latuca, UlvaLinza) 200mgHoney 2 gApple Cider Vinegar 3 gFatty Acids (LinoleicAcid) (BorageOilandPumpkinSeed) 25mgAmino Acids (from Seaweed Blend) Alanine, Arginine, Aspartic Acid, Cystine, Glutamic Acid, Glycine, Histidine, Isoleucine, Leucine,Lysine,Methionine,Phenylalanine, Proline,Serine,Threonine,Tyrosine,ValineProprietary Blend(BlackWalnutPowder, GrapefruitSeedExtract,EyebrightPowder, BroccoliPowder,BilberryPowder, GrapeSeedExtract)63 Trace Minerals Plus Amylase, Lipase and Protease Digestive Enzymes

Liquid Multi Vitamin & Minerals (Dogs & Puppies)

*PercentDailyValuesarebasedon2,000caloriediet.†Dailyvaluenotestablished. Other Ingredients: Natural orange and vanilla flavors, banana powder, citric acid Productcontainsnaturalsourcesofironandsodium

32 fl. oz. - $29.99

Guaranteed Analysis

Moisture(Max) 8%

Methionine 10 mg

Calcium(3.2%)(max3.52%) 112mg

Phosphorus(1.6%)(max1.76%) 56mg

Potassium(.43%) 15mg

Magnesium(.14%) 5mg

Iron(857ppm) 3mg

Copper(86ppm) .3mg

Manganese(286ppm) 1mg

Zinc(857ppm) 3mg

Iodine(14.3ppm) .05mg

Guaranteed Analysis

Vitamin A 1000 IU

VitaminD3 100IU

Vitamin E 15 IU

Thiamine(VitaminB1) .2mg

Riboflavin(VitaminB2) 1mg

PantothenicAcid 4mg

Niacin 5 mg

Pyridoxine(VitaminB6) .4mg

FolicAcid .08mg

VitaminB12 .008mg

AscorbicAcid(VitaminC) 25mg

Dog & Puppy Multi Vitamin Chewable

•Dogsbenefitfromamulti-vitaminmuchthesamewaypeopledo

•Featuresawiderangeofnutrientstocomplementtoday’sdiets

•Deliciousvegetableflavorperfectfordogswithproteinsensitivities

60 Chewables - $12.99NEW

Page 73: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

73www.LifesourceVitamins.com I 1-800-567-8122

LifeSourceVitaminscaresaboutourpetsandthequalityoflifetheyareliving.DogsandCatscansuffergreatlywhentraveling,goingtothevet,orevenexperiencingloudnoisesinyour home. Wehave developed a natural way to help your pet maintain calm behavior during stressfulsituationswithoutreducingalertness.Designedfordogs,cats,orothersmallcompanionanimals.This product contains 100% human grade ingredients, and is a natural blend of herbs,vitamins and amino acids in a delicious organic beef flavor.

PRODUCT FACTS

ActiveIngredientsPer1ml

Amount per Serving:Proprietary Blend:L-Theanine,GABA,ValerianRoot,Chamomile,LemonBalm,Passionflower,Hops,Lithothamnion, Ashwagandharootandleafextract,Maitakefruitbodyextract 250mgThiamine HCL 50 mgAscorbicAcid(VitaminC) 10mgInactiveIngredients:BeefLiverPowder,CitricAcid,OrganicBeefFlavor,PotassiumSorbate,PurifiedWater,VegetableGlycerinUSP,XanthanGum

Contains no sugar, wheat, gluten, yeast, milk or soy derivatives

Suggested usage: Take during times of increased stress

Liquid Stress Relief For Pets (Dogs & Cats) 2 fl. oz. - $19.99

Withvirtuallyeverymovethatwemake,ourjointsarebeingstressed.Thesameistrueforyourdog.LifeSourceVitaminsGlucosamineforDogsprovidesafastandconvenientwaytoreplenishjointtissuesandpromotenormalmovementwhileprotectingtheirhealthycartilagefrompotential future damage. To increase absorption and functionality, we’ve added ultra-purifiedMSMtoprovidethepurestformofsulfurneededforstructuralintegrityofjointcartilage.

Petsarefamilymemberstoo,andweknowhowimportantitisforeveryoneinyourfamilytobehealthy. Young or old, big or small, this dog supplement is shown to absorb more quickly andefficientlythanpillsortablets,offeringfasterresults.Justmixintheirfood,waterorundilutedfor the long-term mobility and health of your dog.

PRODUCT FACTS

ActiveIngredientsPerFluidOunce Amount per Serving: DV%GlucosamineHCL(shellfish) 1,600mgChondroitinSulfate(beefand/orporcine) 1,200mgMSM(Methyl-sulfonylmethane99.9%) 1,000mgManganese Chelate 7 mg HyaluronicAcid(asSodiumHyaluronate) 10mg

*PercentDailyValuesarebasedon2,000caloriediet. †DailyValuenotestablished. Inactive Ingredients: 100%PureAloeVeraJuice,CitricAcid,PotassiumSorbate,PurifiedWater,Sodium Benzoate, Stevia, Vegetable Glycerin Contains no sugar, starch, salt, wheat, gluten, yeast, corn, milk or soy derivatives Suggested usage: Take directly before or after a meal

Liquid Glucosamine For Dogs 32 fl. oz. - $24.99

Page 74: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

74 www.LifesourceVitamins.com I 1-800-567-8122

ESSENTIAl OIlSSINGlE OIlS:

Cinnamon Leaf Oil .5 fl oz - $6.99

Ingredients: Cinnamon LeafAroma: SpicyBenefits: Immunostimulant, Antibacterial, Anti-inflammatoey

Turmeric Oil .5 fl oz - $11.99

Ingredients:100%PureTurmericOilAroma: Warm, Spicey, EarthyBenefits: PotentImmunostimulantandHasAnalgesic and Anti-InflammatoryProperties

Oregano Oil 1 fl oz - $17.99

Ingredients: 100%PureOreganoOil

Aroma: Spicy, Camphoraceous

Benefits: Purifying,Comforting,Invigorating

Lemon Oil 1 fl oz - $8.99

Ingredients: 100%PureLemonOilAroma: FreshLemonPeelBenefits: Refreshing, Cheerful, Uplifting

Orange Oil 1 fl oz - $8.99

Ingredients: 100%PureOrangeOilAroma: Fresh, SweetOrangePeelBenefits: Refreshing, Uplifting, Invigorating

Clary Sage Oil .5 fl oz - $22.99

Ingredients: Clary SageAroma: HerbaceousBenefits: Antidepressant, Antibacterial, Anti-inflammatory, Analgesic

Clove Oil 1 fl oz - $8.99

Ingredients:100%PureCloveOilAroma: Warm,PungentBenefits: Warming, Soothing, Comforting

Peppermint Oil 1 fl oz - $8.99

Ingredients: 100%PurePeppermintOilAroma: Fresh, Strong MintBenefits: Revitalizing, Invigorating, Cooling

Eucalyptus Oil 1 fl oz - $6.99

Ingredients: 100%PureEucalyptusOilAroma: Strong Aromatic, CamphoraceousBenefits: Revitalizing, Invigorating, Clarifying

Tea Tree Oil 1 fl oz - $9.99

Ingredients: 100%PureTeaTreeOilAroma: Potent,Warm,SpicyBenefits: Cleansing,Purifying, Renewing

Lavender Oil 1 fl oz - $11.99

Ingredients: 100%PureLavenderOilAroma: FloralBenefits: Soothing, Normalizing, Balancing

Frankincense & Myrrh Oil .5 fl oz - $22.99

Ingredients: Omani Frankencense & DarkKenyanMyrrhBenefits: Antifungal, Analgesic, Cicatisant (skinhealing)

Page 75: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

75www.LifesourceVitamins.com I 1-800-567-8122

BlENdS:

Allergy Assist Blend .5 fl oz - $11.99

Ingredients: FirBalsam,Peppermint,Eucalyptus, Cedarwood BloodBenefits: DiffuseorInhaletoPreventNasalAllergies

Lemon Eucalyptus Blend 1 fl oz - $8.99

Ingredients: PureLemon,Eucalyptus,and Lemongrass OilBenefits: Clarifying, Cleansing, Invigorating

Sleepy Time Blend .5 fl oz - $9.99

Ingredients: Marjoram,Cedarwood Blood, & LavenderBenefits: Sleep Aid

Healthy Home Blend .5 fl oz - $16.99

Ingredients: Clove, Lemon, Cinnamon Bark, Eucalyptus & RosemaryBenefits: Antiviral, Immunosuppressant

Heart To Heart Blend .5 fl oz - $16.99

Ingredients: Black Spruce, Bergamot, Corlander, Lemon, & Black SpruceBenefits: Aphrodisiac

Cheerful Mind Blend .5 fl oz - $9.99

Ingredients: CitrusOils,FloralExtracts,Peppermint&aHintofMelissaOilBenefits: Lifts Your Spirits and Makes You Smile

Peaceful Heart Blend .5 fl oz - $11.99

Ingredients: Mandarin Red, Bergamot, & LavenderBenefits: Helps to Calm the Mind

Headache Relief Blend .5 fl oz - $9.99

Ingredients: Peppermint,Lavender,&BirchBenefits: HelpsRelievethePainAssociatedwith Headaches

Sharp Mind Blend .5 fl oz - $9.99

Ingredients: Peppermint,Lemon, & RosemaryBenefits: Mental Clarity

Endless Energy Blend .5 fl oz - $11.99

Ingredients: Rosemary, Eucalyptus, Peppermint,RavensaraBenefits: Energy Booster

Quiet Tummy Blend .5 fl oz - $11.99

Ingredients: Ginger,Lavender,Peppermint,& SpearmintBenefits: Helps to Calm the Stomach

Breath Deep Blend .5 fl oz - $9.99

Ingredients: Camphor,Eucalyptus,Peppermint,Thyme,PineBenefits: Helps to Open up the Bronchial Airways

Page 76: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

76 www.LifesourceVitamins.com I 1-800-567-8122

CArrier oiLs:Carrier Oils are used in aromatherapy to dilute essential oils

GoldenJojoba Oil4 oz - $16.99

SweetAlmond Oil4 oz - $7.99

rOll-ON’S:

GrapeseedOil4 oz - $6.99

FractionatedCoconutOil4 oz - $8.99

Women’s Best Friend .3 fl. oz. $12.99

Ingredients: Bergamot, Lavender, Cypress and Marjoram

Uses: Apply directly to the abdomen for the relief of menstrual cramping

Breathe Deep .3 fl oz - $9.99

Ingredients: Camphor,Eucalyptus, Peppermint,Thyme&Pine(CoconutBase)Uses: Roll Onto Chest to Ease Breathing

Bug Free .3 fl oz - $11.99

Ingredients: Lemongrass, Eucalyptus, Lavender, Citronella&Palmarosa(CoconutBase)

Uses: ApplytoPulsePointsandSkinthatisExposedandPronetoInsect Bites

Lavender .3 fl oz - $11.99

Ingredients: Lavender(CoconutBase)

Uses: Apply to Insect Bites, Cuts, or Scrapes

Migraine Rescue .3 fl oz - $11.99

Ingredients: Bergamot,Frankincense, Peppermint,Lavender & Calamus(CoconutBase)

Uses: Roll onto Fingertips to Apply to Temples, Jawline, and Back of Neck

Muscle Soother .3 fl oz - $9.99

Ingredients: Eucalyptus, Peppermint&Camphor(CoconutBase)Uses: Roll onto Affected Area & Massage Gently

Skin Healer .3 fl oz - $8.99

Ingredients: Lavender,Peppermint,Palmarosa&Patchouli(CoconutBase)

Uses: Apply to Insect Bites, Skin Rashes, or ItchyDry Skin

Stress Detox .3 fl oz - $11.99

Ingredients: Wild Crafted Lavender, Peppermint,Rosemary,Eucalyptus, Fir, Niaouliu & Tea Tree (Cocount Base)

Use: To Relieve Tension, which the Body Usually Stores in the Neck, Shoulders, or Near the Jawline

Page 77: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

77www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoDINDEX

77

Page 78: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

78 www.LifesourceVitamins.com I 1-800-567-812278

Page 79: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

79www.LifesourceVitamins.com I 1-800-567-8122 79

Page 80: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

80 www.LifesourceVitamins.com I 1-800-567-812280

Page 81: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

81www.LifesourceVitamins.com I 1-800-567-8122

Driven by Faith • PowereD by GoD

81

lIfESOUrCE ESSENTIAlS HAIr & BOdy CArE Daily Rejuvenation Omega-3 Shampoo

Sulfate Free and Paraben free12 fl oz / 354 ml - $14.99

Tested&ProvenTrichogen!

An amazing stimulating shampoo that is tested and proven to get hair healthy and growing. Great for thinning hair, hair lossandproblemhair.BlocksDHThormonethatcauseshairloss.Allhairtypes.DailyRejuvenationShampooisscientificially designed to help men & women Retain and Regrowtheirhair.”ForDailyRejuvenationShampoo,2ndparagraph,changeto“DailyRejuvenationShampooisscientificially designed to help men & women Retain and Regrow their hair..

*Ingredients:Water,DisodiumLaurethSulfosuccinate(and)DisodiumCocoamphodiacete,CocomidylPropylBetaine,CocomideDEA,DLPanthenol,AcetamideMEA,HydrolyzedKeratin, Sorbitol, Sodium Cocoyl Collagen Amino Acid, Cocoyl Sarcosine, Wheat Germ Acid, Wheat Germ Oil, Linolenic Acid, LinoleicAcid,Sulfur,Polysorbate80,Oleth-10,JojobaOil,Tocopheryl Acetate, Hydrolyzed Glycosaminoglycans, Glycerin, GlycolStearate,PanaxGinsengRootExtract(and)Arginine(and)AcetylTyrosine(and)ArticumMajusRootExtract(and)HydrolyzedSoyProtein(and)Polyquaternium-11(and)PEG12Dimethicone(and)CalciumPantothenate(and)ZincGluconate(and)Niacinamide(and)OrnithineHCL(and)Citrulline(and)GlucosamineHCI(and)Biotin,HydrolyzedSilkProtein,JojobaOil,EmuOil,FragranceOil,EssentialOil,TetrasodiumEDTA,CitricAcid,PEG-150,PEG-6Capric/CaprylicGlycerides,GermallPlus(Paraben-FreePreservative)unflavored),AllNaturalCocoaandVanillaextractsandStevia.

RE-GROWTH FOR FINE AND/ORTHINNING HAIR FOR MEN AND WOMEN.

Heavenly Scented Gourmet Soaps

LifeSource makes all of our old-fashioned high quality soaps by hand using only the finestingredients.Weblendolive,palmandcoconutoilswithextraemollientssuchasavocadooil,cocoabutter,sheabutterandjojobaoiltocreategentlebarswhichgive a silky feeling to your skin. You’ll definitely notice the difference! Great for men, womenandchildren,theentirefamily!Experienceasimplepleasurefromasimplertime. LifeSource’s Gourmet Soap is truly skin nutrition!

Our Gourmet Soaps use organically-grown herbs from the garden and pure essential oils to provide color, special healing qualities and fragrance. LifeSource’s Gourmet Soaps are created using the highest quality cosmeceutical grade fragrance oils providing unique soaps that would generally only be found in high end boutiques. Eachhand-cutbarisuniqueinshape,colorandtexture,makingoursoapsadelighttoall of the senses.

•Noharmfulchemicalsordetergents•Lastlongerthanotherstoreboughtbrands•Actuallynutritiousfortheskin•Clearsupitchyspots,soresandskinirritations•SafeforRosacea•NoSodiumLaurylSulfates•Nosodiumofanykind.•Soapsthatarebeneficialtoyouandyourfamilieshealth,notharmful!

1 BAR - $5.99 EA

4 + BARS - $4.79 EA - SAVE 20%

CHOOSE FROM 30+ AMAZING SCENTS

APPLEJACKBAY RUMCLEAN BREEZECOCONUT BLISSCOOL WATEREUCALYPTUSTHYMEFRANKINCENSE & MYRRHFLORIDABEACHFRESH LINENGARDENIAGREEN TEALAVENDERLAVENDERLEMONPATCHOULILEMONGRASSLILAC

NEEMPLUS

OATMEALALMOND

OATMEAL MILK & HONEY

PUMPKINSPICE

SANDALWOOD

SIMPLYCITRUS

SPABLISS

STRESS RELIEF

SWEET BERRIES

TEATREE&PEPPERMINT

UNSCENTEDW/OATMEAL

VANILLALAVENDER

VICTORIAN ROSE

Daily Rejuvenation Omega-3 Conditioner

12 fl oz / 354 ml - $14.99

This is a light, everyday conditioner that will not weigh your hair down. Great for thinand/orfinehair.Makescombingeasierand gives your hair a healthy shine.

Ingredients: Water, Behentrimonium Methosulfate, Cetearyl Alcohol,Panthenol,EmuOil,SimmondsiaChinensis(Jojoba)SeedOil,PanaxGinsengRootExtract(and)Arginine(and)AcetylTyrosine(and)ArticumMajusRootExtract(and)HydrolyzedSoyProtein(and)Polyquaternium-11(and)PEG12Dimethicone(and)CalciumPantothenate(and)ZincGluconate(and)Niacinamide(and)OrnithineHCL(and)Citrulline(and)GlucosamineHCI(and)BiotinFragranceOilDerivative,GermallPlus(Paraben-FreePreservative)

EVERYDAY USE FOR MEN & WOMEN.

OUR HAND MADE HAIR CARE,SKIN CARE & SOAPS ARE FREE OFHARMFUL CHEMICALS,SULFATES AND PARABENS.THE WAY IT SHOULD BE!

www.LifesourceVitamins.com I 1-800-567-8122

Page 82: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

82 www.LifesourceVitamins.com I 1-800-567-8122

INDEX

82 www.LifesourceVitamins.com I 1-800-567-8122

NEW fOr 2019-2020 PAGE7-Keto Fitness 3AcaiSuperBerryAntioxidantLiquidExtract 68AdrenalRX(Organic) 4Aller-CalmLiquidExtract(Organic) 68AloeVeraJuice(Concentrate) 4AshwagandhaPowder(Organic) 6AshwagandhaLiquidExtract(Organic) 68SuperiorMethyl-BComplex 7BarleyGrassPowder(Organic) 7BitterMelon(Organic) 9BlackCuminSeedOilLiquid(Organic) 68BreathFreshenerSpray 68BreathSpray-PeppermintPlus 71BronchialSyrup(Organic) 68VitaminCLiquid 68CBDOil(FullSpectrum)500mgLiquid(Organic) 10CBDBalm-Lavender500mg 10ColloidalSilverPlusOralDrops 68ColloidalSilverPlusTopicalSpray 68Congest-Eeze(Organic) 15Cranberry&D-Mannose 16DandelionLiquidExtract(Organic) 68DetoxifyLiquidExtract(Organic) 68Digest-EaseLiquidExtract(Organic) 68DongQuai(Organic) 19Echinacea-GoldensealLiquidCapsules(Organic) 19Echinacea-GoldensealLiquidExtract(Organic) 69ElderberryPlus(Organic) 19ElderberryPlusGummies(Organic) 19ElderberryLiquidExtract(Organic) 69FemSilverLiquidExtract(Organic) 69Fenugreek(Organic) 21GingerFreshLiquidExtract(Organic) 69GinsengMasterLiquidExtract(Organic) 69GlucosamineChondroitinPlus 23GotuKola(Organic) 24GumTonicLiquidExtract(Organic) 69Hair Skin & Nails Liquid - Ultra 25HawthornLiquidExtract(Organic) 69Head-AidLiquidExtract(Organic) 69HolyBasil(Organic) 26Immuno-WellRXLiquidExtract 69Inflacalm 27Iodine(w/Kelp)LiquidExtract(Organic) 69Kava Root Capsules 27KavaRootLiquidExtract 69Kid’sAllerCalmLiquidExtract(Organic) 69Kid’sAttentionPlusLiquidExtract(Organic) 70Kid’sBioticLiquidExtract(Organic) 70Kid’sBronchialLiquidExtract(Organic) 70Kid’sEarClearLiquidExtract 70Kid’sEchinaceaPlusLiquidExtract(Organic) 70Kid’sMellowPlusLiquidExtract(Organic) 70Kid’sPottyHelperLiquidExtract(Organic) 70Kid’sVitaminD3400IU 70LustriousHairLiquidExtract 70LymphTonicLiquidExtract(Organic) 70MacaPowder(Organic) 30Calming-MagnesiumPowder(Organic) 30MaleVirilityLiquidExtract 70Men’sSilverLiquidExtract(Organic) 70Oak&IvyTopicalSpray(Organic) 71OliveLeafLiquidExtract(Organic) 71Pets-Dog&PuppyChewableMultiVitamins 72Pre-WorkoutFormula 56ProbioticGummies(Organic) 57RelaxLiquidExtract(Organic) 71Respir-EaseLiquidExtract(Organic) 71SinusBlasterSpray(Organic) 71SpirulinaPowder(Organic) 60Stevia Liquid - Caramel 71Stevia Liquid - Chocolate 71Stevia Liquid - Cinnamon 71Stevia Liquid - Hazelnut 71Stevia Liquid - Orange 71SteviaLiquid-Peppermint 71Stevia Liquid - Vanilla 71TartCherryw/Turmeric 61ThroatSprayRelief(Organic) 71Triphala(Organic) 62TurmericLiquidExtract(Organic) 71

NEW fOr 2019-2020 PAGE

Turmeric Root Liquid Capsules 62UTBalanceLiquidExtract(Organic) 71ValerianLiquidExtract(Organic) 71WheatgrassPowder(Organic) 63Women’sBestFriendEssentialOil(Roll-on) 76Women’sEnergyBalanceLiquidExtract(Organic) 71

AmINO ACIdS PAGE

Aminos, Ultra 5BranchedChainAminoAcids(BCAA) 8L-CarnitineLiquid 28L-Arginine 28L-Glutamine 28L-Glutathione 22L-Lysine 28L-Taurine 61L-Theanine 28L-Tryptophan 29MaximumHGHPowder 26

ANTIOXIdANTS PAGE

AcaiPlusLiquid 3AcaiSuperBerryAntioxidantLiquidExtract 68Alpha Lipoic Acid 5AntioxidantSupreme 5Astaxanthin(ExtraStrength)10mg 6Astaxanthin4mg 6BarleyGrassPowder(Organic) 7BeePollen 8BeetRootPowder(Organic) 8BetaCarotene 8BetaGlucanwithMaitakeExtract 8Blue&PurplePhytoFoodsPowder 54VitaminCLiquid 68Superior C 500mg 10Vitamin C 1000 mg 10Vitamin C 250mg Gummies 10Vitamin C Crystals 10Vitamin C with Rose Hips, 500mg 10Cinnamon Bark 13CoQ10 100mg plus Vitamin E 16CoQ10 50mg plus Vitamin E 16CoQ10HighPotency400mg 16CurcuminExtract 17Vitamin E 400 IU 19Ginkgo Biloba 22L-Glutathione 24GrapeSeedExtract 24GreenPhytoCapsules 53GreenPhytoFoodsPowder 53GreenTeaExtract 24Lutein Esters 29Lycopene 29NAC 35OrangePhytoFoodsw/CoQ10 54Oregano Oil 50Pycnogenol 58QuercetinComplex 59RedPhytoFoodsPowder 53ResveratrolPlus 59Selenium 60Silymarin(MilkThistleExtract) 34Spirulina Tablets 60SpirulinaPowder(Organic) 60TartCherryw/Turmeric 61Turmeric Advanced 62TurmericAdvancedPowder1,000mg 62Ubiquinol 16WheatgrassPowder(Organic) 63ZincPicolinate50mg 64

BrAIN HEAlTH PAGEAcetyl L-Carnitine 3Ashwagandha Capsules 6AshwagandgaLiquidExtract 68AshwagandhaPowder(Organic) 6Blue&PurplePhytoFoodsPowder 54Choline Bitartrate 13Gaba+B6 22Ginkgo Biloba 22PanaxGinseng 23L-Glutathione 24Lecithin 29Memory Enhancer & Brain Connector 33Memory Enhancer & Brain Connector Liquid 33CodLiverOil(DoubleStrength) 14DHA500 51Neptune Krill Oil 51Omega3SuperEPA/DHA 50Omega3w/DHAGummies 51SUPEROmega3-6-9 50Omega3HighPotencyLiquid(LightlySweet) 51ULTRA Omega 3 50PhosphatidylSerineComplex 52

CHIldrEN & TEENS PAGEVitamin C 250mg Gummies 10ElderberrySyrup(Organic) 19Ultra Fiber Gummies 21Kid’s & Teen’s Chewable Enzymes 20Kid’s & Teen’s Multi Vitamin & Mineral Chewable Tablets 46Kid’s & Teens Multi Vitamin & Mineral Liquid 47Kid’s & Teen’s Multivitamins Gummies 46TeenMultivitamin(Ultra) 47Kid’sAllerCalmLiquidExtract 69Kid’sAttentionPlusLiquidExtract 70Kid’sBioticLiquidExtract 70Kid’sBronchialLiquidExtract 70Kid’sEarClearLiquidExtract 70Kid’sEchinaceaPlusLiquidExtract 70Kid’sMellowPlusLiquidExtract 70Kid’sPottyHelperLiquidExtract 70Kid’sVitaminD3400IU 70Oak & Ivy Spray 71Omega3w/DHAGummies 51Kid’sDHA 52Kid’sDophilusExtraStrengthProbioticChewables 57Kid’sDophilusProbioticChewables 57ProbioticGummies 57

EyE HEAlTH PAGEAstaxanthin(ExtraStrength)10mg 6Astaxanthin4mg 6BetaCarotene 8BilberryExtractPlus 8Hyaluronic Acid 26Lutein Esters 29Lycopene 29Vision Formula 63

fOrmUlAS PAGEAllergy Support 4Antibiotic, All Natural 4AntioxidantSupreme 5Arthritis Relief & Joint Rebuilder 5Aspirin, All Natural 5Blood Sugar Control 5Bronchial Support 9Cholesterol Support 13Diet&Energy 18Fibroid Formula 21G.I. & Colon Support 23GreenPhytoCapsules 53GreenPhytoFoodsPowder 53Heart & Vascular Support 25

82 www.LifesourceVitamins.com I 1-800-567-8122

Page 83: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

83www.LifesourceVitamins.com I 1-800-567-8122www.LifesourceVitamins.com I 1-800-567-8122 83

INDEX

fOrmUlAS PAGEHGH Formula Tablets 26HoodiaComplex 26Memory Enhancer & Brain Connector 33Memory Enhancer & Brain Connector Liquid 33Men’sPotency 34PancreasHealth 52ProstaPlex 58RedPhytoFoodsPowder 53Stress Relief Formula 53Thermo Lean 61Vision Formula 63WheyPLUSGreen&RedPhytos 66

GUmmIES PAGEVitamin C 250mg Gummies 10VitaminD-32000IUGummies 17Ultra Fiber Gummies 19Ultra Hair, Skin & Nails Gummies 25Adult Multivitamin Gummies 39Kid’s & Teen’s Multivitamins Gummies 46Omega3w/DHAGummies 51ProbioticGummies 57

GUT HEAlTH PAGEAcid Reducer with Enzymes 3Aloe Vera Juice Concentrate 4Aloe Vera Softgels 4Black Seed Oil Liquid Capsules 9BlackCuminSeedOil4oz. 68Candida Cleanse 12Charcoal 12Chlorella 12Chlorophyll Liquid 13Colon Cleanse 15VitaminD-31000IU 17VitaminD-35000IU 17VitaminD3Liquid,1000IU 17DairyDigest(Ultra) 63Digest-EaseLiquidExtract 65PapayaEnzymesAdvanced 20Super Enzyme Caps 20Clear Fiber 21Ultra Fiber Gummies 21GI & Colon Support 23Ginger Root 22GingerFreshLiquidExtract 69Gluten-Ade 24L-Glutamine 28MaxMushroomWellness 35MSM 35MSMPowder 3535BillionProbiotic 56100BillionProbiotic 57DophilusPlusProbiotic 56Kid’sDophilusExtraStrengthProbioticChewables 57Kid’sDophilusProbioticChewables 57ProbioticDigestiveSupport 58ProbioticGummies 57PsylliumHuskPowder 58Triphala 62WheatgrassPowder(Organic) 63Women’s50BillionProbiotic 57

HEArT HEAlTH PAGEAspirin, All Natural 5Astaxanthin(ExtraStrength)10mg 6Astaxanthin4mg 6BeetRootPowder 8BloodPressureSupport 9Blood Sugar Control 9Cayenne 12Cholesterol Support 13Cinnamon Bark 13

HEArT HEAlTH PAGECoQ10 100mg plus Vitamin E 16CoQ10 50mg plus Vitamin E 16CoQ10HighPotency400mg 16FlaxOilLiquid 21FlaxOilSoftgels 22Garlic(Odorless) 22GrapeSeedExtract 24Hawthorn Berry 25Heart & Vascular Support 25VitaminK2w/VitD3 27L-Arginine 28L-CarnitineLiquid 28CodLiverOil(DoubleStrength) 14DHA500 51Neptune Krill Oil 51Omega3SuperEPA/DHA 50Omega3w/DHAGummies 51SUPEROmega3-6-9 50Omega3HighPotencyLiquid(LightlySweet) 51ULTRA Omega 3 50Policosanol 56Red Yeast Rice 59RedYeastRicew/CoQ10 59ResveratrolPlus50mg60VegCaps 59Ubiquinol 16

INflAmmATION PAGEAllergy Support 4Aspirin, All Natural 5Arthrigone Cream 5Arthritis Relief & Joint Rebuilder 5Black Seed Oil Liquid Capsules 9BlackCuminSeedOil4oz. 68Cayenne 12CodLiverOil(DoubleStrength) 14Collagen & Elastin Cream 15Collagen Liquid 14CollagenPeptidesPowder 15Collagen Tablets 14CurcuminExtract 17FlaxOilLiquid 22FlaxOilSoftgels 21Ginger Root 22GingerFreshLiquidExtract 69Glucosamine & Chondroitin Tablets 23GlucosamineSulfate&MSM(Vegetarian),120Tablets 23Glucosamine, Chondroitin & MSM Liquid 23GlucosamineChondroitinPlus 23Glucosamine, MSM, & Arnica Cream 23Inflacalm 27MellowMag(MagnesiumCarbonatePowder) 30Calming-MagnesiumPowder 30Magnesium Citrate 30Magnesium Glycinate 30MSM 35MSMPowder 35DHA500 51Neptune Krill Oil 51Omega3SuperEPA/DHA 50Omega3w/DHAGummies 51SUPEROmega3-6-9 50Omega3HighPotencyLiquid(LightlySweet) 51ULTRA Omega 3, 90 Softgels 5035BillionProbiotic 56100BillionProbiotic 57DophilusPlusProbiotic 56Pycnogenol 58QuercetinComplex 59ResveratrolPlus 59Shark Cartilage 60Spirulina Tablets 60SpirulinaPowder(Organic) 60Turmeric Advanced 62Turmeric Root Liquid Capsules 62TurmericAdvancedPowder1,000mg 62WheatgrassPowder(Organic) 63

ImmUNE SySTEm SUPPOrT PAGEAlfalfa Tablets 4Allergy Support 4Antibiotic, All Natural 4Aspirin, All Natural 5Astaxanthin(ExtraStrength)10mg 6Astaxanthin4mg 6Astragalus Root 6BetaGlucanwithMaitakeExtract 8Black Seed Oil Liquid Capsules 9Black(Cumin)SeedOil4oz. 68Blue&PurplePhytoFoodsPowder 54Bronchial Support 9BronchialSyrup 68LiquidVitaminC 68Superior C 500mg 10Vitamin C 1000 mg 10Vitamin C 250mg Gummies 10Vitamin C Chewables 10Vitamin C Crystals 10Vitamin C with Rose Hips, 500mg 10Congest-Eeze 15CurcuminExtract 17VitaminD-31000IU 17VitaminD-32000IUGummies 17VitaminD-35000IU 17VitaminD3Liquid,1000IU 17Echinacea 1,000mg 19Echinacea&GoldensealLiquidExtract 69Echinacea & Goldenseal Liquid Capules 19ElderberryLiquidExtract 69ElderberryPlus 19ElderberryPlusGummies 19ElderberrySyrup(Organic) 19Esiak(CanadianTea) 20GreenPhytoCapsules 53GreenPhytoFoodsPowder 53L-Glutathione 24ImmunoWellRxLiquidExtract 69LymphTonicLiquidExtract 70L-Lysine 28MaxMushroomWellness 35MoringaLeafExtract 34MoringaLeafPowder(Organic) 35MultiVitamins(allvarieties) 36-49NAC 35OliveLeafExtract 50OliveLeafLiquidExtract 71OrangePhytoFoodsw/CoQ10 54Oregano Oil 5035BillionProbiotic 56100BillionProbiotic 57DophilusPlusProbiotic 56ProbioticDigestiveSupport 58ProbioticGummies 57QuercetinComplex 59RedPhytoFoodsPowder 53Respir-EaseLiquidExtract 71Sinus Blaster Spray 71Spirulina Tablets 60SpirulinaPowder(Organic) 60Throat Spray Relief 71Turmeric Advanced 62TurmericAdvancedPowder1,000mg 62ZincPicolinate50mg 64

JOINT SUPPOrT PAGEArthrigone Cream 5Arthritis Relief & Joint Rebuilder 5Collagen & Elastin Cream 14Collagen Liquid 14CollagenPeptidesPowder 15Collagen Tablets 14Glucosamine & Chondroitin Tablets 23GlucosamineSulfate&MSM(Vegetarian),120Tablets 23Glucosamine, Chondroitin & MSM Liquid 23GlucosamineChondroitinPlus 23Glucosamine, MSM, & Arnica Cream 23Hyaluronic Acid 26MSM 35MSMPowder 35Shark Cartilage 60

83www.LifesourceVitamins.com I 1-800-567-8122

Page 84: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

84 www.LifesourceVitamins.com I 1-800-567-8122

INDEX

84 www.LifesourceVitamins.com I 1-800-567-8122

lETTErEd VITAmINS PAGEBetaCarotene(VitaminA) 8Vitamin B6 100mg 6B-12LiquidComplex 6SuperiorMethyl-BComplex 7MethylB-121,000mcg(Lozenges) 7Methyl B-12 Liquid 2,500 mcg 7Methyl-B-125000mcg(Lozenges) 7VitaminB-50Complex 7VitaminB-100Complex 7Biotin(VitaminB7) 8FolicAcid(B9)plusB-12 22MethylFolate400mcg(B9) 22Niacin(FlushFree)(B3) 35LiquidVitaminC 68Superior C 500mg 10Vitamin C 1000 mg 10Vitamin C 250mg Gummies 10Vitamin C Chewables 10Vitamin C Crystals 10Vitamin C with Rose Hips, 500mg 10VitaminD-31000IU 17VitaminD-32000IUGummies 17VitaminD-35000IU 17VitaminD3Liquid,1000IU 17Vitamin E 400 IU 19VitaminK2w/D3 27

lIQUId SUPPlEmENTS PAGEAcaiPlus-32fl.oz. 3AcaiSuperBerryAntioxidantLiquidExtract-1fl.oz. 68Aller-CalmLiquidExtract(Organic)-1fl.oz. 68AloeVeraJuice(Concentrate)-32fl.oz/128fl.oz. 4AshwagandhaLiquidExtract(Organic)-1fl.oz. 68B12LiquidComplex-2fl.oz. 6B12 Methyl-B 2,500 mcg - 2 fl. oz. 7BlackCuminSeedOilLiquid(Organic)-4fl.oz. 68BreathFreshenerSpray-1fl.oz. 68BreathSpray-PeppermintPlus-1fl.oz. 68BronchialSupport-8fl.oz. 9BronchialSyrup(Organic)-4fl.oz. 68VitaminCLiquid-4fl.oz. 68CBDOil(FullSpectrum) 500mgLiquid(Organic)-1fl.oz. 10Colloidal Minerals - 32 fl. oz. 15ColloidalSilverPlusOralDrops-1fl.oz. 68ColloidalSilverPlusTopicalSpray-1fl.oz. 68LiquidCal/Mag(Blueberry)-16fl.oz. 11LiquidCal/Mag(Orange/Vanilla)-32fl.oz. 11Chlorophyll Liquid - 16 fl. oz. 13Collagen Liquid - 16 fl. oz. 14D3Liquid1,000IU-1fl.oz. 17DandelionLiquidExtract(Organic)-1fl.oz. 68DeerAntlerSpray-2fl.oz. 18DetoxifyLiquidExtract(Organic)-1fl.oz. 68Digest-EaseLiquidExtract(Organic)-1fl.oz. 68Echinacea-GoldensealLiquidExtract (Organic)-1fl.oz. 69ElderberrySyrup(Organic)4fl.oz. 19ElderberryLiquidExtract(Organic)-1fl.oz. 69FemSilverLiquidExtract(Organic)-1fl.oz. 69FlaxSeedOil(Organic)-16fl.oz. 22GingerFreshLiquidExtract(Organic)-1fl.oz. 69GinsengMasterLiquidExtract(Organic)-1fl.oz. 69Glucosamine, Chondroitin & MSM Liquid - 16 fl. oz. 23GumTonicLiquidExtract(Organic)-1fl.oz. 69Hair Skin & Nails Liquid - Ultra - 16 fl. oz. 25HawthornLiquidExtract(Organic)-1fl.oz. 69Head-AidLiquidExtract(Organic)-1fl.oz. 69Immuno-WellRXLiquidExtract-1fl.oz. 69Iodine(w/Kelp)LiquidExtract(Organic)-2fl.oz. 69KavaRootLiquidExtract-1fl.oz. 69Kid’s & Teen’s Liquid Multi Vitamin - 16 fl. oz. 47Kid’sAllerCalmLiquidExtract(Organic)-1fl.oz. 69Kid’sAttentionPlusLiquidExtract(Organic)-1fl.oz. 70

lIQUId SUPPlEmENTS PAGE

Kid’sBioticLiquidExtract(Organic)-1fl.oz. 70Kid’sBronchialLiquidExtract(Organic)-1fl.oz. 70Kid’sEarClearLiquidExtract-1fl.oz. 70Kid’sEchinaceaPlusLiquidExtract(Organic)-1fl.oz. 70Kid’sMellowPlusLiquidExtract(Organic)-1fl.oz. 70Kid’sPottyHelperLiquidExtract(Organic)-1fl.oz. 70Kid’sVitaminD3400IU-1fl.oz. 70L-CarnitineLiquid-16fl.oz. 28Liquid Essentials Multi Vitamin - 16 fl. oz. 39Liquid Multi Vitamin & Immune Booster - 32 fl. oz. 37LustriousHairLiquidExtract-2fl.oz. 70LymphTonicLiquidExtract(Organic)-1fl.oz. 70MaleVirilityLiquidExtract-1fl.oz. 70Memory Enhancer & Brain Connector Liquid - 32 fl. oz. 33Men’sSilverLiquidExtract(Organic)-1fl.oz. 70MCT Oil - 32 fl. oz. 30Oak&IvyTopicalSpray(Organic)-2fl.oz. 71OliveLeafLiquidExtract(Organic)-1fl.oz. 71Omega-3,LiquidHighPotency-8.5fl.oz. 51RelaxLiquidExtract(Organic)-1fl.oz. 71Respir-EaseLiquidExtract(Organic)-1fl.oz. 71SinusBlasterSpray(Organic)-1fl.oz. 71SteviaLiquid-Pure2fl.oz. 60Stevia Liquid - Various Flavors - 2 fl. oz. 71ThroatSprayRelief(Organic)-1fl.oz. 71TurmericLiquidExtract(Organic)-1fl.oz. 71UTBalanceLiquidExtract(Organic)-1fl.oz. 71ValerianLiquidExtract(Organic)-1fl.oz. 71Women’sEnergyBalanceLiquidExtract (Organic)-1fl.oz 71

mENS HEAlTH PAGE

Beta-SitosterolPlantSterols 8DeerAntlerVelvetwithIGF-1Spray(NewFormula) 18HGH Formula 16MaximumHGHPowder 16Lycopene 29Maca 29MacaPowder(Organic) 30MaleVirilityLiquidExtract 70Men’sOnceDailyAdvanced 43Men’sPotency 34Men’sSeniorMulti,180Tablets 48Men’sSilverLiquidExtract 70Men’s Superior Multi Vitamin 42Men’sUltraDailyPack 40Men’s Ultra Sports Multi 43Men’s Vitality, Ultra 34ProstaPlex 58SawPalmetto 60Tribulus 62

mINErAlS PAGE

Ultra Bone Builder 11CalciumCitratePlus 11ColloidalSilverPlusOralDrops 68ColloidalSilverPlusTopicalSpray 68Coral Calcium Advanced 11LiquidCal/Mag(Blueberry) 11LiquidCal/Mag(Orange/VanillaFlavor) 11OysterCalcium,Magnesium&VitaminD 11ChromiumPicolinate 13Colloidal Minerals Liquid 15IronComplex 27Magnesium Citrate 30Magnesium Glycinate 30MellowMag(MagnesiumCarbonatePowder) 30Calming-MagnesiumPowder 30Potassium 56Selenium 60ZincPicolinate50mg 64

mOOd & STrESS PAGE

5-HTP 3AdrenalRx 4Ashwagandha 6AshwagandhaPowder(Organic) 6CBDOil(FullSpectrum)500mgLiquid 10Cortisol Support 16Gaba+B6 22KavaRootLiquidExtract 69Kava Root Capsules 27RelaxLiquidExtract 71SAM-e 59St. John’s Wort 61Stress Relief Formula 61L-Theanine200mg 28L-Tryptophan 29Valerian Root 63ValerianRootLiquidExtract 71

mUlTI VITAmINS PAGE

Adult Multivitamin Gummies 39LifeSource Multi-Vitamin & Mineral Tablets 36Ultra Multi Liquid Vitamin & Immune Booster 37Liquid Essentials Multi Essential 39UltraMultiVitamin&MineralPowder 38UltraMultiVitamin&MineralPowder withPhytoFoods 38Kid’s & Teen’s Multi Vitamin & Mineral Chewables 46Kids & Teens Multi Vitamin & Mineral Liquid 47Kid’s & Teen’s Multivitamins Gummies 46Ultra Teen Multivitamin 47Men’sOnceDailyAdvanced 43Men’s Superior Multi Vitamin 42Men’sUltraDailyPack 40Men’s Ultra Sports Multi 43Senior Ultra Multi Vitamin & Mineral 49Women’sSeniorMulti-180Tablets 48Men’sSeniorMulti,180Tablets 48PrenatalMultiVitamin&Mineralw/DHA 45Women’sOnceDailyAdvanced 45Women’s Superior Multi Vitamins 44Women’sUltraDailyPack 41

OmEGA PAGES

CodLiverOil(DoubleStrength) 14DHA500 51EveningPrimroseOil 21FlaxOilLiquid 22FlaxOilSoftgels 21Hemp Seed Oil 26Kid’sDHA 52Neptune Krill Oil 51Omega3SuperEPA/DHA 50Omega3w/DHAGummies 51SUPEROmega3-6-9 50ULTRA Omega 3 50Omega3HighPotencyLiquid(LightlySweet) 51

PHyTO POWdErS PAGE

BarleyGrassPowder(Organic) 7BeetRootPowder(Organic) 8Blue&PurplePhytoFoodsPowder 54GreenPhytoFoodsPowder 53MoringaLeafPowder(Organic) 35OrangePhytoFoodsw/CoQ10 54RedPhytoFoodsPowder 53SpirulinaPowder(Organic) 60WheatgrassPowder(Organic) 63WheyPLUSGreen&RedPhytos 66

84 www.LifesourceVitamins.com I 1-800-567-8122

Page 85: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

85www.LifesourceVitamins.com I 1-800-567-8122www.LifesourceVitamins.com I 1-800-567-8122 85

INDEX

PrOTEIN & mEAl rEPl. PAGECollagenLiquid(Grass-Fed) 14CollagenPeptidesPowder(Grass-Fed) 15UltraMealReplacement(Grass-Fed) 31Plant-BasedBalancedMealCompleteNutritionalShake 32UltraPlantProtein 55WheyIsolateProtein(Grass-Fed) 65WheyPLUSGreen&RedPhytos(Grass-Fed) 66WheyConcentrateProtein(Grass-Fed) 67

SKIN & HAIr CArE PAGEBiotin 8CBDBalm-Lavender500mg 10Collagen & Elastin Cream 15Collagen Liquid 14CollagenPeptidesPowder 15Collagen Tablets 14ColloidalSilverPlusTopicalSpray 68DailyRejuvenationOmega3Conditioner 81DailyRejuvenationOmega3Shampoo 81Ultra Hair, Skin & Nails Gummies 25Ultra Hair, Skin & Nails, 60 Tablets 25Ultra Hair, Skin & Nails Liquid 25LifeSourceEssentialsAniseFoamingWash 78LifeSourceEssentialsAvocadoWhipBasilMoisturizer 80LifeSourceEssentialsCoconutLimeBalancingCleanser 78LifeSource Essentials Grape Skin Gotu Kola Anti-agingSerumPM 80LifeSourceEssentialsHydratingPearlSerum 79LifeSourceEssentialsJojobaRaspberry GrapeMoisturizer 80LifeSource Essentials Kakadu Hibiscus Eye Serum 79LifeSource Essentials Marshmallow 23 Karat Eye Cream 79LifeSourceEssentialsSolarDefenseMineral MoistureCrème 80LifeSourceEssentialsSuperC+TripeptideAnti-AgingSerumAM 80LifeSourceEssentialsSweetOrangeBalancingToner 78LifeSourceHandmadeSoaps 81LustriousHairLiquidExtract 70Oak & Ivy Topical Spray 71

SPOrTS NUTrITION PAGE7-KetoDHEA 37-Keto Fitness 3Aminos, Ultra 5BranchedChainAminoAcids(BCAA) 8C.L.A.(ConjugatedLinoleicAcid) 14CreatineMonohydratePowder 17DeerAntlerVelvetwithIGF-1Spray 18Electrolyte Balance 20GABAw/B6 22HGH Formula Tabs 26MaximumHGHPowder 26L-Arginine 28L-CarnitineLiquid 28L-Glutamine 28MCT Oil 32 fl. Oz. 30MCT Oil Liquid Softgels 30MealReplacement(Whey) 31Men’s Ultra Sports Multi 43Niacin(FlushFree) 35UltraPlantProtein 55Plant-BasedBalancedMealComplete Nutritional Shake 32Pre-WorkoutFormula 56Taurine 61Tribulus 62WheyISOLATEProtein(Grass-Fed) 65WheyPLUSGreen&RedPhytos(Grass-Fed) 66WheyProteinCONCENTRATE(Grass-Fed) 67ZMA Sports Recovery 64

SENIOrS PAGE

7-KetoDHEA 37-Keto Fitness 3Acetyl L-Carnitine 3Arthrigone Cream 5Arthritis Relief & Joint Rebuilder 5Aspirin, All Natural 5Astaxanthin(ExtraStrength)10mg 6Astaxanthin4mg 6BetaCarotene 8Beta-SitosterolPlantSterols 8BilberryExtractPlus 8Biotin 8Ultra Bone Builder 11CalciumCitratePlus 11Coral Calcium Advanced 11OysterCalcium,Magnesium&VitaminD 11LiquidCal/Mag(Blueberry) 11LiquidCal/Mag(Orange/VanillaFlavor) 11Choline Bitartrate 13Collagen & Elastin Cream 15Collagen Liquid 14CollagenPeptidesPowder 15Collagen Tablets 14CoQ10 100mg plus Vitamin E 16CoQ10 50mg plus Vitamin E 16CoQ10HighPotency400mg 16DailyRejuvenationOmega3Conditioner 81DailyRejuvenationOmega3Shampoo 81FemSilverLiquidExtract 69Ginkgo Biloba 22Glucosamine & Chondroitin Tablets 22GlucosamineSulfate&MSM(Vegetarian),120Tablets 22GlucosamineChondroitinPlus 22Glucosamine, Chondroitin & MSM Liquid 22Glucosamine, MSM, & Arnica Cream 22L-Glutathione 24Ultra Hair, Skin & Nails Gummies 25Ultra Hair, Skin & Nails Tablets 25Ultra Hair, Skin & Nails Liquid 25Heart & Vascular Support 25HGH Formula Tabs 26MaximumHGHPowder 26LustriousHairLiquidExtract 70Lutein Esters 29Lycopene 29Ultra Meal Replacement 31Melatonin 1mg Lozenge 33Melatonin 3mg Capsules 33MelatoninPlus(5mg)Tablets 33Memory Enhancer & Brain Connector 33Memory Enhancer & Brain Connector Liquid 33Menopause Support 34Men’sPotency 34Ultra Men’s Vitality 34Senior Ultra Multi Vitamin & Mineral 49Men’sSeniorMulti 48Women’sSeniorMulti 48MSM Tablets 35MSMPowder 35PhosphatidylSerineComplex 52UltraPlantProtein 55Plant-BasedBalancedMealCompleteNutritionalShake 32ProgesteroneLiposomalSkinCream 58ProstaPlex 58SAM-e 59SawPalmetto 60Shark Cartilage 60Sleep Formula Advanced 60Tribulus 62Ubiquinol 16Vision Formula 63WheyISOLATEProtein 65WheyPLUSGreen&RedPhytos 66WheyProteinCONCENTRATE 67Ultra Women’s Vitality 64

SlEEP AIdS PAGE5-HTP 3CBDOil(FullSpectrum)500mg 10Gaba+B6 22KavaRootLiquidExtract 69Kava Root Capsules 27Melatonin 1mg Lozenge 33Melatonin 3mg Capsules 33MelatoninPlus(5mg)Tablets 33RelaxLiquidExtract 71Sleep Formula Advanced 60L-Tryptophan 29Valerian Root Capsules 63ValerianRootLiquidExtract 71

WEIGHT lOSS & dIET PAGE7-KetoDHEA 37-Keto Fitness 3Cayenne 12Chitosan Advanced 12ChromiumPicolinate 13CiderVinegarDiet 13C.L.A.(ConjugatedLinoleicAcid) 14DeerAntlerVelvetwithIGF-1Spray 18Diet&Energy 18GarciniaCambogiaSuperCitriMax 22GreenCoffeeBeanExtractw/Svetol 24GreenTeaExtract 24HoodiaComplex 26L-CarnitineLiquid 28Ultra Meal Replacement 31Plant-BasedBalancedMealCompleteNutritionalShake 32Thermo Lean 61Thyroid Energy 62Ultra Weight Loss Capsules 63

WOmENS HEAlTH PAGEBlackCohoshExtractPlus 9Cranberry Concentrate 16Cranberry&D-Mannose 16D-Mannose 18EveningPrimrose 21FemSilverLiquidExtract 69Fibroid Formula 21FolicAcid(800mcg)plusB-12 22Methyl Folate 400 mcg 22Maca(Organic) 29MacaPowder(Organic) 30Menopause Support 34Women’sOnceDailyAdvanced 45Women’sSeniorMulti-180Tablets 48Women’s Superior Multi Vitamins 44Women’sUltraDailyPack 41PrenatalMultiVitamin&Mineralw/DHA 45Women’s50BillionProbiotic 57ProgesteroneLiposomalSkinCream 58UTBalanceLiquidExtract 71Water Gone 63Women’sBalancePMSFormula 64Women’sEnergyBalanceLiquidExtract 71Ultra Women’s Vitality 64

OTHEr BrANdS (Please call for current inventory)Alba BotanciaAleaviaAncient NutritionBarlean’sBaxylBlender BottleBluebonnet NutritionGood GumsHealthy‘NFitJasonJesusFilmDVD’s

LifeExtensionMegaFoodNature’s TearsNutraKeyOne BarsPetBioticsQuest BarsThayer’sTom’s of Maine

85www.LifesourceVitamins.com I 1-800-567-8122

Page 86: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Driven by Faith • PowereD by GoD

86 www.LifesourceVitamins.com I 1-800-567-8122

FUNDRAISINGMADE EASY!

When your Referred Customers order, your ministry will receive 20% from that order and every order

after that automatically.This program can help fundraising for:

Worldwide Mission Trips Youth Group Camps Elderly Care for Church Ministry Kids Programs in Church

Local Food Mission Help Marriage & Family Workshop Needs Supplies for your Church, Youth Group, Bible Study Group

Men’s/Women’s Breakfast and so much more

CALL US TODAY:800.567.8122

Page 87: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

Vitamins & Body Care for The Entire Family

ORDER FORM

Total

Shipping

o Check EnclosedMake all checks payable to: LifeSource Vitamins

Name and Address:

Phone Number:

Total

Mailing address:LifeSource Vitamins7006 Stapoint Ct., Suite AWinter Park, FL 32792

Toll Free: (800) 567-8122

Business Hours: Monday-Friday 10am-7pm EST, Closed Saturday/Sunday

ITEM DESCRIPTION QTY PRICEEA.

TOTALPRICE

USA Shipping charges

PRODUCT TOTAL$0 - $34.99$35 - $59.99$60 - $98.99

$5.99$7.99$9.99

SHIPPING

Free Shipping Over $99

A Company that Answers to God in all We Do!

THESTATEMENTSINTHISCATALOGHAVENOTBEENEVALUATEDBYTHEFDA.WEBELIEVETHENUTRITIONALSUPPLEMENTSANDINFORMATIONOFFEREDINTHISCATALOGCANBENEFITYOURATHLETICPERFORMANCEANDLONGTERMHEALTH.OURPRODUCTSDONOTSERVEASAREPLACEMENTFORANYTREATMENTPROGRAMPRESCRIBEDORRECOMMENDEDBYAPHYSICIANORHEALTHCAREPROFESSIONAL.COMBINEDWITHFUNCTIONALFOODS,LIFESOURCEPRODUCTSAREAMOUNGTHEBESTDIETARYSUPPLEMENTSAVAILABLE.HEALTHYNUTRITIONANDPHYSICALEXERCISEAREKEYSTOLONGTERMHEALTHYLIVING.ALLPRICESSUBJECTTOCHANGEWITHOUTNOTICE.

Page 88: Bruce Brightman, Founder · 2019-10-04 · Bruce Brightman, Founder. DRIVEN BY FAITH • POWERED BY GOD I 1-800-567-8122 3 5-HTP 60 Veg Caps - $19.99 • Enhances sleep • Relieves

1-407-960-6980 I www.LifesourceVitamins.com I 1-800-567-812280

Driven by Faith • Powered by God

TOLL FREE: [email protected]

LIFESOURCEVITAMINS.COM