Upload
others
View
2
Download
0
Embed Size (px)
Citation preview
1
GENOMICS AND EFFECTOROMICS OF XANTHOMONADS
By
NEHA POTNIS
A DISSERTATION PRESENTED TO THE GRADUATE SCHOOL OF THE UNIVERSITY OF FLORIDA IN PARTIAL FULFILLMENT
OF THE REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY
UNIVERSITY OF FLORIDA
2011
2
© 2011 Neha Potnis
3
To my husband, Deepak, and my parents for their unconditional love and support
4
ACKNOWLEDGMENTS
I would like to express my gratitude to Dr. Jeffrey B. Jones, my committee chair for
his constant support and encouragement. I am thankful to him for sharing his expertise
and his ideas at every step during this project. I would also like to thank my co-chair, Dr.
David Norman for his guidance and financial support during my graduate studies. I
would also like to extend my gratitude to my committee members, Dr. Boris Vinatzer,
Dr. Jim Preston, and Dr. Jeffrey Rollins for their valuable suggestions in my project and
support. I really appreciate valuable guidance from Dr. Robert Stall. I would like to thank
Jerry Minsavage for technical help during the experiments, helpful suggestions and
constructive criticism. Virginia Chow contributed to the identification of genes encoding
glycohydrolases involved in cell wall deconstruction and their respective genome
organizations. During research work, I collaborated with Dr. Frank White, Dr. Ralf
Koebnik, Dr. Brian Staskawicz, and Dr. Joao Setubal to write research articles and
reviews. I would like to thank them all for giving me the opportunity.
I thank my labmates Jose Figueiredo, Franklin Behlau, Jason Hong, Mine Hantal,
and Hu Yang for co-operation and assistance and for making the lab, a pleasant place,
to work. I would also like to thank faculty and staff of the Plant Pathology department. I
am grateful to my Indian friends here in Gainesville for their support and lively company
during my stay here.
I warmly thank my loving husband, Deepak, who has been supportive throughout
my PhD, with all his love and encouragement. My heartfelt thanks go to my parents for
supporting my decision to fly here away from them, who have been so caring and
loving. They helped me to shape my career and always guided me at every step in my
life. Thank you all for making this possible.
5
TABLE OF CONTENTS
page
ACKNOWLEDGMENTS .................................................................................................. 4
LIST OF TABLES ............................................................................................................ 9
LIST OF FIGURES ........................................................................................................ 10
ABSTRACT ................................................................................................................... 12
CHAPTER
1 XANTHOMONAS-PLANT INTERACTIONS AND GENOMICS .............................. 14
Background ............................................................................................................. 14 Type III Secreted Effectors and Their Role in Plant-Pathogen Interactions ............ 14 Avirulence Genes ................................................................................................... 17 Contributions of Comparative Genomics Era .......................................................... 19 Project Goal and Objectives ................................................................................... 20
2 COMPARATIVE GENOMICS REVEALS DIVERSITY AMONG XANTHOMONADS INFECTING TOMATO AND PEPPER ..................................... 21
Background ............................................................................................................. 21 Materials and Methods ............................................................................................ 24
Genome Sequencing ........................................................................................ 24 Assembly and Annotation ................................................................................. 25 Whole Genome Comparisons .......................................................................... 25 Phylogenetic Analysis ...................................................................................... 26 Phylogeny Reconstruction ................................................................................ 26 Prediction of Effector Repertoires, Cloning of Candidate Effectors and
Confirmation Using AvrBs2 Reporter Gene Assay ........................................ 27 Cloning of Pepper Specificity Genes in Xp. ...................................................... 28
Results .................................................................................................................... 28 Draft Genome Sequences of Xv Strain 1111, Xp Strain 91-118 and Xg
Strain 101 were Obtained by Combining Roche-454 (Pyrosequencing) and Illumina GA2 (Solexa) Sequencing Data. ............................................... 28
Relationships of the Strains to Other Xanthomonads using Whole Genome Comparisons ................................................................................................. 29
Four Xanthomonads Show Variation in the Organization of the Type III Secretion Gene Clusters ............................................................................... 30
A Reporter Gene Assay Confirms Translocation of Novel Type III Effectors .... 30 Core Effectors among Four Xanthomonads Give Insights into Infection
Strategies of the Pathogen ............................................................................ 31
6
Effectors Unique to Xp Might be Responsible for Restricting Growth on Pepper........................................................................................................... 32
Species-Specific Effectors ................................................................................ 33 Few Effectors are Shared among Phylogenetically Related Group Strains ...... 35 Xg Shows Evidence of Effector Acquisition by Horizontal Gene Transfer. ....... 35 All Four Xanthomonads Contain Ax21 Coding Gene but Only Xcv Contains
a Functional Sulfation Gene. ......................................................................... 36 Two Type II Secretion Systems are Conserved in All Four Xanthomonas
Genomes. ...................................................................................................... 37 Xanthomonads Possess Diverse Repertoires of Cell-Wall Degrading
Enzymes, which are Present in Diverse Genomic Arrangement Patterns. .... 38 Genes Involved in Several Type IV Secretion Systems are Present in
Genomes and Plasmids ................................................................................ 40 Type V Secreted Adhesins Function in Synergism During Pathogenesis ........ 41 Type VI Secretion System is Present in Xcv, Xv and Xp .................................. 42 LPS Locus Displays Remarkable Variation In Sequence and Number of
Coding Genes and Shows Host Specific Variation ........................................ 43 Analysis of DSF Cell-Cell Signaling System ..................................................... 44 Cyclic Di-GMP Signaling .................................................................................. 45 Copper Resistance (cop) Genes are Present in Xv and Copper
Homeostasis (coh) Genes are Present in All Strains .................................... 46 Genes Unique to Xp as Compared to Pepper Pathogens Give Clues to its
Predominance over Xcv in the Field and Host Specificity ............................. 47 Pepper Pathogenicity/Aggressiveness Factors Increased In Planta Growth
of Xp .............................................................................................................. 48 Genes Specific to Xg as Compared to Other Tomato/Pepper Pathogens
may Explain its Aggressive Nature on Tomato and Pepper .......................... 48 Genes Common to All Tomato Pathogens but Absent from Other
Sequenced Xanthomonads ........................................................................... 49 The Evolution of Pathogenicity Clusters Corresponds to the MLST-Based
Phylogeny ..................................................................................................... 50 Concluding Remarks .............................................................................................. 50
3 AVIRULENCE PROTEINS AVRBS7 FROM XANTHOMONAS GARDNERI AND AVRBS1.1 FROM XANTHOMONAS EUVESICATORIA ELICIT HYPERSENSITIVE RESISTANCE RESPONSE IN PEPPER ................................ 78
Background ............................................................................................................. 78 Materials and Methods ............................................................................................ 79
Plant Material and Plant Inoculations ............................................................... 79 Bacterial Strains, Plasmids and Media ............................................................. 80 Library Preparation and Isolation of Clone with Avirulence Activity .................. 80 Deletion Mutant Construction ........................................................................... 81 Bacterial Population Dynamics in Infiltrated Leaf Tissue .................................. 81 Determination of Electrolyte Leakage from Infiltrated Leaf Tissue ................... 82 Site Directed Mutagenesis of avrBs7 ............................................................... 82 Sequence Analysis and Protein Homology Modeling ....................................... 83
7
Results .................................................................................................................... 83 Identification of Resistance in Pepper against Bacterial Spot Xanthomonads
and Development of Introgression Lines Carrying the Resistance Gene ...... 83 AvrBs7 from Xv444 Elicits HR in Pepper cv. ECW-70R. .................................. 84 AvrBs1.1 from Xcv str 85-10 Elicits Delayed HR on ECW-70R. ....................... 85 Genetic Analysis of Bs7 Resistance in ECW-70R ............................................ 85 In-Planta Growth Studies and Electrolyte Leakage .......................................... 87 A Catalytic Tyrosine Phosphatase Domain Might be Responsible for
Recognition by the BS7 R Gene Product in ECW-70R. ................................ 88 There is Difference in the Timings of HR Elicitation by AvrBs7 and
AvrBs1.1. ....................................................................................................... 89 Avirulence Proteins AvrBs7 and AvrBs1.1 Display Similar Tertiary Protein
Structure. ....................................................................................................... 90 Host Specificity of Bacterial Spot Strains.......................................................... 90 Avr Genes avrBs7 and avrBs1.1 are Encoded on a Large Transmissible
Plasmid. ........................................................................................................ 91 Concluding Remarks .............................................................................................. 91
4 APPLICATION OF BIOINFORMATICS FOR TYPE III EFFECTOR SIGNAL ANALYSIS AND ITS INTERACTION WITH CHAPERONE .................................. 105
Background ........................................................................................................... 105 Materials and Methods .......................................................................................... 109
Data-Mining Strategy ...................................................................................... 109 Bacterial Strains, Plasmids and Media ........................................................... 109 Plant Material and Plant Inoculations ............................................................. 110 In Planta Reporter Gene Assay ...................................................................... 110 Site-Directed Alanine Mutagenesis ................................................................ 111 Yeast Two-Hybrid Assay ................................................................................ 111 In Vitro Pull Down Assay ................................................................................ 112
Results .................................................................................................................. 114 General Characteristics of Secretion and Translocation Signals in N
Terminal Region of Xanthomonas Type III Effectors ................................... 114 Screening Whole Genomes for Candidate Type III Effectors ......................... 115 First 70 Amino Acids of XopF1 are Sufficient for Translocation into the Plant
Cell. ............................................................................................................. 116 Type III Effector XopF1 is Dependent on Global Chaperone HpaB for its
Translocation. .............................................................................................. 117 First 40 Amino Acids of XopF1 are not enough for Translocation into Plant
Cells. ........................................................................................................... 117 Secondary Structure Analysis of XopF1 Effector. ........................................... 117 Alanine Mutagenesis in Alpha Helix Regions Abolished HR of the Effector-
Reporter Fusion Complex. .......................................................................... 119 Yeast Two-Hybrid Assay ................................................................................ 119 In Vitro Pull Down Assay ................................................................................ 120
Concluding Remarks ............................................................................................ 121
8
5 PATHOGENIC STRATEGIES OF XANTHOMONAS GENUS ON PLANTS: LESSONS LEARNT FROM GENOMICS .............................................................. 133
Background ........................................................................................................... 133 Materials and Methods .......................................................................................... 134
Xanthomonas Genomes and Tools Used for Comparison ............................. 134 Database for Xanthomonas Pathogenicity Factors ........................................ 134 Effectors Database Compilation ..................................................................... 135 Effector Analysis of the Test Case of Citrus Pathogens ................................. 135
Results .................................................................................................................. 135 Type II Secretion Systems .............................................................................. 135 Type III Secretion System .............................................................................. 137 Type III-Secreted Effectors ............................................................................. 137 A CaseStudy – Screening for Candidate Type III Effectors from Draft
Genomes and Possible Host Range Determinants. .................................... 139 The three citrus canker genomes have important differences in regard
to their repertoires of type III secreted effectors .................................... 140 Effectors XopAI and XopE3 may play a role in citrus canker ................... 142 Additional differences in effector repertoires among CC genomes .......... 145
Adhesins ......................................................................................................... 146 Lipopolysaccharides and Xanthan .................................................................. 148 Toxins ............................................................................................................. 148
Concluding Remarks ............................................................................................ 149
6 SUMMARY AND DISCUSSION ............................................................................ 162
LIST OF REFERENCES ............................................................................................. 169
BIOGRAPHICAL SKETCH .......................................................................................... 189
9
LIST OF TABLES
Table page 2-1 General sequencing and combined (454 and solexa) de novo assembly
features of draft genomes of Xv, Xp and Xg. ...................................................... 53
2-2 Whole genome comparisons using MUMmer dnadiff program.. ......................... 53
2-3 Core effectors present in all four tomato and pepper xanthomonads ................. 54
2-4 Type III effectors specific to each species .......................................................... 55
2-5 Effectors specific to particular groups of species ................................................ 57
2-6 Evidence of horizontal gene transfer using Alien Hunter analysis ...................... 58
2-7 Repertoire of cell wall degrading enzymes in xanthomonads. ............................ 59
2-8 Type VI secretion clusters in different xanthomonads. ....................................... 60
2-9 Genes/contigs representing T6SS in draft genomes as compared to Xcv. ......... 61
2-10 A comparison of rpf cluster from rpfB to rpfG found across a range of Xanthomonas genomes. ..................................................................................... 61
2-11 Genes unique to Xp, grouped in clusters. ........................................................... 62
2-12 Genes common to all pepper pathogens but absent from Xp. ............................ 64
2-13 Genes present in all four tomato and pepper pathogens but absent from all other sequenced xanthomonads. ....................................................................... 67
3-1 List of bacterial strains and plasmids used in this study ..................................... 96
4-1 List of bacterial strains and plasmids used in this study ................................... 125
5-1 Xanthomonas species and pathovars within species show host and tissue-specificity. ......................................................................................................... 150
5-2 Xop nomenclature for xanthomonas effectors .................................................. 152
5-3 Core effector genes from xanthomonads and their role in pathogenicity/ induction of resistance ...................................................................................... 155
5-4 Variable effectors which contribute to the pathogenicity ................................... 157
5-5 Putative effectors found in the XAC, XauB, and XauC genome sequences. .... 159
10
LIST OF FIGURES
Figure page 2-1 Maximum likelihood tree based on orthologous genes from xanthomonads
and Stenotrophomonas.. .................................................................................... 68
2-2 Comparison of type III secretion system cluster, its associated type III effector genes and helper genes of three draft genomes with already sequenced xanthomonads.. ............................................................................... 69
2-3 AvrBs2-based HR assay confirms translocation of novel effectors. .................... 70
2-4 Xylanase cluster organization.. ........................................................................... 71
2-5 Schematic representation of type IV secretion system cluster common to Xp, Xv and Xg (Plasmid borne). ................................................................................ 72
2-6 Schematic representation of type IV secretion cluster unique to Xg (plasmid borne). ................................................................................................................ 73
2-7 Schematic representation of chromosomal type IV cluster organization in Xcv, Xv, Xp and Xg. ............................................................................................ 74
2-8 The Structure and phylogeny of the LPS cluster ................................................ 75
2-9 Pepper specificity genes increasing in planta growth of Xp. ............................... 76
2-10 Correlation between phylogenies based on Multi-Locus Sequence Typing (MLST) core genome and pathogenicity clusters. .............................................. 77
3-1 Phenotype observed in leaves of ECW-70R 48 hr after infiltration with bacterial suspesions (adjusted to 108 cfu/ml) ..................................................... 97
3-2 Phenotype on ECW-70R 24 hr and 48 hr post-infiltration by wild type strains, transconjugants and mutants.............................................................................. 98
3-3 Time course of bacterial population growth after infiltration of leaves of pepper genotypes ECW and ECW-70R with suspensions of Xg51 transconjugants and mutant strains. ................................................................... 99
3-4 Electrolyte leakage from pepper genotypes ECW-70R (A and C) and ECW (B and D) after infiltration of leaves with suspensions adjusted to 108 cfu/ml of (Xg51) wild type, transconjugants and mutant strains.. .................................... 100
3-5 Tyrosine phosphatase domain is essential for HR elicitation on ECW-70R.. .... 101
3-6 Alignment of avrBs1.1 and avrBs7 amino acid sequences using clustalw ........ 102
11
3-7 Fusion protein containing N-terminal of avrBs7 and C terminal of avrBs1.1 does not elicit HR on ECW-70R. ...................................................................... 103
3-8 Three dimensional structures of the two avirulence proteins based on homology modeling.. ........................................................................................ 104
4-1 Phenotype on ECW-20R 24 hr post-infiltration by wild type strains and transconjugants. ............................................................................................... 126
4-2 Phenotype on ECW-20R 24 hr post-infiltration by wild type strains, transconjugants, and mutants........................................................................... 127
4-3 Phenotype on ECW-20R 24 hr post-infiltration by wild type strains, transconjugants and alanine mutants. .............................................................. 128
4-4 Secondary structure prediction by PsiPred for first 70 amino acid region of XopF1. Cylinder represents predicted alpha helix. ........................................... 129
4-5 Secondary structure prediction by garnier for first 70 amino acid region of XopF1. H indicates alpha helix. ........................................................................ 130
4-6 Yeast two hybrid interaction between alanine mutants of XopF11-70 and HpaB chaperone. ....................................................................................................... 131
4-7 In vitro pull down assay showing binding of HpaB chaperone to XopF1 variants.. ........................................................................................................... 132
12
Abstract of Dissertation Presented to the Graduate School of the University of Florida in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy
GENOMICS AND EFFECTOROMICS OF XANTHOMONADS
By
Neha Potnis
August 2011
Chair: Jeffrey B. Jones Cochair: David J. Norman Major: Plant Pathology
Bacterial spot disease is a major concern for tomato and pepper growers. There
are four species of xanthomonads associated with this disease classified into four
distinct genotypic groups, Xanthomonas euvesicatoria, Xanthomonas vesicatoria,
Xanthomonas perforans and Xanthomonas gardneri. Various disease control strategies
have been used including application of copper bactericides, antibiotics, biocontrol
methods such as phage therapy, and breeding for disease resistance. We are
approaching the issue from two perspectives. The first approach includes identifying
virulence factors from different species of bacterial spot xanthomonads and studying
their role in the disease development. A strain of Xanthomonas euvesicatoria (Xcv str.
85-10) has already been sequenced. We have sequenced representatives of the other
three species. A comparative genomic analysis has enlightened the commonalities and
differences in virulence factors among the four species and has provided possible clues
to the understanding of host range specificity and aggressiveness of strains. Important
pathogenicity factors of xanthomonads are type III effectors. We have also developed a
program to identify these effectors from the draft genomes using computational
methods. The regulation of type III effectors during pathogenesis is achieved with the
13
help of chaperones. We have focused our studies on effector-chaperone interactions
and the role of these interactions during disease development. The knowledge gained
from comparative analysis is expected to aid in better understanding of host-pathogen
interactions and devising durable control strategies. The second approach consisted of
searching for disease resistance genes. We found a new source of resistance in pepper
to Xanthomonas gardneri and Xanthomonas euvesicatoria. Genetic segregation
analysis indicated the monogenic nature of resistance, confirming a new gene-for-gene
interaction in addition to five already characterized interactions in pepper.
Characterization of avirulence genes avrBs7 and avrBs1.1 from the two xanthomonads
indicated presence of a tyrosine phosphatase domain, which might be important for
eliciting the resistance response in pepper. Further efforts will be directed towards
understanding the mechanism of the resistance and the importance of domains from
avirulence genes in pathogen virulence.
14
CHAPTER 1 XANTHOMONAS-PLANT INTERACTIONS AND GENOMICS
Background
Xanthomonads belong to a genus representing around 27 species infecting more
than 400 plant species including dicots and monocots. Many of them exhibit tissue
specificity, colonizing either xylem vessels or mesophyll apoplasts of the host. A
combination of virulence or pathogenicity factors is used by xanthomonads during
infection of plants. Co-ordinated expression of these virulence factors is governed by a
set of regulatory genes. Xanthomonads persist as epiphytes before the entry into the
plant surfaces via natural openings. Type V-secreted multiple adhesins play an
important role during the adhesion, entry and colonization process. Multiple two-
component signaling cascades are then activated which, in turn, lead to the activation of
different secretion systems and the release of virulence factors (Qian et al. 2008).
Successful infection, establishment and survival of a pathogen depend on different
virulence factors secreted and translocated by different secretion systems, which allow
the pathogen to multiply and avoid host defense responses.
Type III Secreted Effectors and Their Role in Plant-Pathogen Interactions
Among virulence factors, type III secreted effectors are the major contributors to
pathogenicity in most Gram-negative pathogens. Type III secretion systems enable
pathogens to transport their effector proteins inside the host plant cells upon induction
by plant-derived signals (Alfano and Collmer 2004). Type III secreted effector proteins
(T3SEs) are involved in virulence by modulating and suppressing host defense
responses (White et al. 2009). Each strain possesses its repertoire of T3SEs, which
determine the compatibility and subsequent patterns of pathogen growth. The diversity
15
in tissue and host specificities of members of the genus is also reflected in the diversity
of T3SEs between pathovars and species.
Many Xanthomonas T3SEs are known to function to suppress pathogen molecular
associated pattern (PAMP) triggered immune (PTI) responses during the early stages of
infection (Metz et al. 2005; Hotson et al. 2003; Kim et al. 2008; Kim et al. 2009). XopX
from X. euvesicatoria was found to increase the susceptibility of Nicotiana benthamiana
to both Xanthomonas and Pseudomonas species (Metz et al. 2005). The T3SEs XopN
and XopD have also been shown to reduce PTI and to affect host developmental
pathways that may play a role in host defense (Kim et al. 2008; Kim et al. 2009). XopD
possesses cysteine protease activity and mimics endogenous plant SUMO
isopeptidases. It targets SUMO-conjugated proteins by hydrolyzing them and disrupts
the regulation of SUMO mediated pathways (Kim et al. 2008). XopN is another virulence
factor on tomato that suppresses defense-related gene expression and callose
deposition in tomato. XopN interacts with the cytoplasmic domain of TARK1 and 4 along
with tomato 14-3-3 isoforms (Kim et al. 2009). Effector XopJ suppresses defense-
related callose deposition and host protein extracellular secretion (Bartetzko et al.
2009). Another XopJ family member, avrRxv, interacts with host 14-3-3 protein (Whalen
et al. 2008) and is also hypothesized to bind to MAPKs and to interfere with the
signaling cascade.
Some T3SEs are known to be recognized by host defense surveillance systems.
Such effectors elicit a rapid hypersensitive reaction (HR) and effector-triggered
immuninty (ETI). T3SEs are also known to suppress R gene–mediated defense, which
has also been called effector-triggered immunity (ETI) to distinguish ETI from PTI, and
16
some evidence suggests that some T3-effectors of Xanthomonas are involved in ETI
suppression (Rosebrock et al. 2007). AvrBsT, a member of the XopJ/YopJ family,
triggers an HR in a single landrace of Arabidopsis with a recessive mutation in a gene
for carboxylesterase, which was named SUPPRESSOR OF AVRBST-ELICITED
RESISTANCE1 (SOBER1). A model has been proposed that, in the absence of the
esterase activity, AvrBsT can suppress recognition by a host R-gene product (Cunnac
et al. 2007).
Mutations of individual effector genes do not always result in a change in
virulence, which might implicate redundancy of effectors (Castaneda et al. 2005). Some
effectors from xanthomonads have been characterized for their contribution towards
virulence on their respective hosts. AvrBs2, which is a core type III effector in
xanthomonads, has been shown to be a virulence factor only in X. campestris pv.
vesicatoria (Kearney and Staskawicz 1990). TAL (Transcription Activator-Like) effectors
constitute a major family, members of which are known to impart virulence and are
responsible for disease symptoms such as in citrus canker. PthA, of X. citri pv. citri is
required for increase in bacterial populations during canker progression and for
hypertrophy (Swarup et al. 1991). A similar symptom was associated with the AvrBs3
from Xcv in pepper (Marois et al. 2002). In rice, TAL effectors are responsible for
symptoms such as chlorosis and watersoaking (Yang and White 2004). PthA has been
shown to interact with the citrus proteins involved in ubiquitination, DNA repair in
addition to already characterized interaction with α-importin (Domingues et al. 2010).
Another effector belonging to the AvrBs3 family, AvrHah1 from X. gardneri is shown to
contribute to increased watersoaking and necrosis on pepper (Schornack et al. 2008).
17
In addition to the already mentioned XopN and XopD effectors, other effectors known to
contribute to virulence and disease symptoms include XopX (Metz et al. 2005), XopAE
(Kim et al. 2003), and XopAH (AvrXccC, Wang et al. 2007).
Avirulence Genes
Flor’s gene-for gene model (Flor 1971) proposes presence of avirulence (avr)
genes from pathogens interacting with the corresponding plant resistance (R) genes.
However, the nature of the avr gene was not known until the cloning of the first avr gene
avrA from a soybean pathogen Pseudomonas syringae pv. glycinea race 6 (Staskawicz
et al. 1984). This gene, when transferred to other races of P. syringae pv. glycinea,
conferred resistance against soybean cultivars containing the Rpg2 resistance gene.
Another type of avr gene, called “heterologous avr genes” was identified after inter-
species or inter-pathovar transfer. An example of a heterologous avr gene is avrRxv
from X. campestris pv. vesicatoria, which when introduced into pathogenic strains of X.
campestris pv. phaseoli elicited resistance on beans (Whalen et al. 1988). Although
heterologous avr genes contribute to the host range of pathogens, they can not be said
to be host range determinants since the strain of origin of a heterologous avr gene does
not become virulent on the host carrying the corresponding R gene if devoid of the avr
gene. e.g. an avrRxv deletion mutant of Xcv does not become pathogenic on beans
(Whalen et al. 1988).
Later, most avr proteins were shown to be secreted by the type III secretion
systems, hence are type III effector proteins. Plants have evolved R genes in response
to a few effector genes to recognize them and elicit R-gene mediated HR. The race
continues and the pathogen then modifies its effector gene set in order to avoid this
recognition. Evolution of the pathogen acts as strong selection pressure on the host.
18
Since these effector genes come in direct contact with the host environment, they are
under strong selective pressure and hence subjected to rapid evolution in an attempt to
avoid recognition by host defenses (Stavrinides et al. 2006). Avr genes show signs of
horizontal gene transfer. Some avr genes, e.g. avrBs3 family genes, are located on
plasmids. A few avr genes, e.g. avrB from P. syringae, belong to a region of low GC
content (Tamaki et al. 1988). Few of the avr genes, e.g. avrXv3, are flanked by IS
elements (Astua-Monge et al. 2000a). These signs indicate their role in genetic variation
contributing to the evolution of the pathogen.
Few avirulence genes from xanthomonads have been characterized for the
presence of biochemical motifs or functions, which might give clues to their mechanism
of eliciting resistance. According to Swords et al. (1996), AvrBs2 might have enzymatic
function due to its similarity to agrocinopine synthetase from Agrobacterium
tumefaciens. Kearney and Staskawicz (1990) suggested that AvrBs2 had a dual
function eliciting resistance in Bs2 carrying pepper plants and promoting virulence on
pepper lacking Bs2. AvrBs3 possesses a DNA binding domain, nuclear localization
domain and transcriptional activator domain (Van den Ackerveken et al. 1996) and is
shown to act as transcriptional activator by binding to the promoter of upa20
(upregulated by AvrBs3), a cell size regulator in susceptible pepper, and in turn induce
hypertrophy (Kay et al. 2007). Interestingly there is also a upa box in the promoter of
Bs3 resistance gene in resistant peppers (Romer et al. 2007). AvrXv4, AvrRxv, AvrBsT
contain acetyl transferase and C55 cysteine ubiquitin-like protease domain (White et al.
2009). AvrRxv has been shown to interact with a regulatory eukaryotic protein called 14-
3-3 protein and induce cell death response (Whalen et al. 2008). Understanding R-Avr
19
gene interactions and the role of avr genes in virulence and resistance can assist in
screening for broad and durable resistance.
Contributions of Comparative Genomics Era
To date nearly 10 complete genome sequences of xanthomonads are available, 9
draft genome sequences have also been published. The complete genomes were
sequenced using the Sanger sequencing method. These genomes belong to different
species of xanthomonads and provide reference sequences for the new draft genome
sequences. With the advent of next generation sequencing methods such as 454
pyrosequencing, solexa/illumina, and SOLiD sequencing, draft genome sequencing has
become cost effective and time saving. This next generation or second-generation
sequencing has resulted in a quantum leap in the availability of raw genomic data
(Fuller et al. 2009). Yet genomic regions that are exceptionally rich in G+C are still
obstacles for second-generation sequencing and may lead to gaps when the results of
individual sequencing reactions are assembled to reconstruct the complete genomic
sequence. Another hazard complicating the assembly process is repetitive sequences,
such as insertion sequence (IS) elements, which seem to be present in all
xanthomonads, and presence of TAL effectors, which contain repetitive elements, which
are not easy to assemble. As a result, next generation sequencing in xanthomonads
results in draft genomes with the assembled sequence contigs disrupted by gaps. To
complete the draft genomes to finished genomes further requires Sanger sequencing
for gap closure and sequence polishing reactions, such as cloning constructs like BACs
or fosmids or PCR products.
The increasing scale of genomics provides rapid means for identifying
virulence/pathogenicity factors and to generate of new hypotheses to explain the
20
complexities of host-pathogen interactions. Comparative genomics has raised a number
of questions as to how diverse species evolved diverse host range and tissue
specificities, as to the role of type III effectors, regulation of pathogenicity factors, and
molecular and evolutionary mechanisms driving evolution of genomes. Comparative
genomics has now given rise to the “omics” field, focusing on functional aspects of the
genes involved in plant-pathogen interactions.
Project Goal and Objectives
The aim of this project was to study diversity among xanthomonads with respect to
their pathogenicity factors with a special focus on type III effectors using comparative
genomics tools. Comparative genomics has provided different hypotheses regarding the
role of certain pathogenicity factors during infection, in the host specificity. We have
experimentally verified the role of several genes. This study will give insight into the
pathogenicity and virulence strategies used by pathogen during infection, which should
help design new control strategies.
In this study, the four objectives were: I) Comparative genomics of xanthomonads
infecting tomato and pepper; II) Isolation and characterization of an avirulence gene
corresponding to the R gene from a pepper genotype; III) Application of bioinformatics
tools to the identification of type III effectors; and identification and characterization of
chaperone HpaB-binding site in type III effectors of xanthomonads; and IV)
Comparative genomics and study of pathogenicity factors from all xanthomonads.
21
CHAPTER 2 COMPARATIVE GENOMICS REVEALS DIVERSITY AMONG XANTHOMONADS
INFECTING TOMATO AND PEPPER1
Background
Bacterial spot disease of tomato and pepper presents a serious agricultural
problem worldwide, leading to significant crop losses especially in regions with a warm
and humid climate. The disease is characterized by necrotic lesions on leaves, sepals
and fruits, reducing yield and fruit quality (Pohronezny and Volin 1983). The disease is
caused by a relatively diverse set of bacterial strains within the genus Xanthomonas;
strain nomenclature and classification for the strains that infect pepper and tomato have
gone through considerable taxonomic revision in recent years. Currently, the pathogens
are classified into four distinct pathogen groups (A, B, C, and D) within the genus
Xanthomonas. Strains belonging to groups A, B and D infect both tomato and pepper.
Group C strains are pathogenic only on tomato (Jones et al. 1998b; Jones et al. 2000).
These phenotypically and genotypically distinct strains have different geographic
distributions. Strains of group A and B are found worldwide. C strains have been
increasingly found in the U.S., Mexico, Brazil, Korea and regions bordering the Indian
Ocean, and D group strains are found in the former Yugoslavia, Canada, Costa Rica,
U.S., Brazil and regions of the Indian Ocean (Bouzar et al. 1996; Bouzar et al. 1999;
Kim et al. 2010; Hamza et al. 2010; Myung et al. 2009). Three of the four groups except
for D were originally described as a single pathovar within Xanthomonas campestris
and referred to as X. campestris pv. vesicatoria. The D group consisted of a strain
isolated from tomato that had been designated ‘Pseudomonas gardneri’ for many years
1 Reprinted with permission from Potnis et al. 2011.
22
(Sutic 1957) although De Ley provided evidence for placement in the genus
Xanthomonas (De Ley 1978). Subsequently all four groups were classified as separate
species on the basis of physiological and molecular characteristics as follows:
Xanthomonas euvesicatoria (group A), Xanthomonas vesicatoria (group B),
Xanthomonas perforans (group C), and Xanthomonas gardneri (group D) (Jones et al.
2004).
Based on 16S rRNA analysis, X. euvesicatoria str. 85-10 (A group) and X.
perforans (C group) together form a monophyletic group, whereas X. vesicatoria (B
group) and X. gardneri (D group) cluster together with X. campestris pv. campestris
(Xcc) Xcc str. 33913 (Jones et al. 2004). Recently, a phylogenetic tree was constructed
based on MLST (multi-locus sequence typing) data for A, B, C and D group strains and
other xanthomonads (Almeida et al. 2010). The MLST approach revealed that X.
euvesicatoria and X. perforans form a group along with X. citri str. 306. X. gardneri is
most closely related to X. campestris pv. campestris strains while X. vesicatoria forms a
distinct clade (Almeida et al. 2010). This diversity among the four groups makes the
Xanthomonas-tomato/pepper system an excellent example to study pathogen co-
evolution, as distinct species have converged on a common host.
While integrated management approaches for control of bacterial spot disease are
available, the development of host resistance is more economical and environmentally
benign for the control of the disease (Obradovic et al. 2004; Louws et al. 2001). Host
resistance may also be required to replace the loss of some integrated management
tools. Use of copper and streptomycin sprays over the years, for example, has led to the
development of resistant strains (Bouzar et al. 1999). At the same time, genetic
23
resistance has been lost due to race shifts in pathogen populations (Kearney et al.
1990; Gassmann et al. 2000; Stall et al. 2009). Designing new and possibly durable
resistance requires knowledge of pathogenicity factors possessed by the four groups.
Many candidate pathogenicity factors have been identified in strains of
Xanthomonas. A number of virulence factors are employed by xanthomonads to gain
entry into leaf or fruit tissue, and gain access to nutrients, while simultaneously
overcoming or suppressing plant defenses. Different secretion systems and their
effectors have been shown to contribute to the virulence of plant pathogens. The type III
secretion system (T3SS) encoded by the hrp (Hypersensitive Response and
Pathogenicity) gene cluster (Bonas et al. 1991; Kim et al. 2003) and type III secreted
effectors have been widely studied for their role in hypersensitivity and pathogenicity.
Effectors common between strains are believed to be responsible for conserved
virulence function and avoidance of host defense. Differences in effector suites have
evolved in closely related strains of plant pathogens and strain-specific effectors may
help to escape recognition by host-specific defenses (Nimura et al. 2005; Grant et al.
2006; Sarkar et al. 2006; Rohmer et al. 2004; White et al. 2009; Moreira et al. 2010).
Important insights into pathogenicity mechanisms of X. euvesicatoria str. 85-10
(hereafter, Xcv) have been obtained with its genome sequence (Thieme et al. 2005).
Here we report draft genome sequences of type strains of the other three bacterial spot
pathogen species: X. vesicatoria strain 1111 (Xv 1111) (ATCC 35937), X. perforans
strain 91-118 (Xp 91-118), and X. gardneri strain 101 (Xg 101) (ATCC 19865). We have
annotated and analyzed predicted pathogenicity factors in the draft genomes.
24
Additionally, we have investigated differentiation between xanthomonads that might
explain differences in disease phenotypes and in host range.
Materials and Methods
Genome Sequencing
Xv, Xp and Xg were sequenced by 454-pyrosequencing (Margulies et al. 2005) at
core DNA sequencing facility, ICBR, University of Florida. Xanthomonas isolates were
grown overnight in nutrient broth. Genomic DNA was isolated using CTAB-NaCl
extraction method (Ausubel et al. 1994) and resuspended in TE buffer (10 mM Tris pH
8, 1 mM EDTA pH 8). Libraries of fragmented genomics DNA were sequenced on 454-
Genome Sequencer, FLX instrument at Interdisciplinary Center for Biotechnology
Research (ICBR) at UF. De novo assemblies were constructed using 454 Newbler
Assembler (Margulies et al. 2005). The three draft genomes were obtained with around
10X coverage.
For Illumina sequencing, the Xanthomonas strains were purified from single-
colony and grown overnight in liquid cultures. Genomic DNA was isolated by phenol
extraction and precipitated twice with isopropanol, then dissolved in TE buffer. DNA was
then purified by cesium chloride density gradient centrifugation and precipitated with
95% ethanol, then dissolved in TE buffer. Libraries of fragmented genomic DNA with
adapters for paired-end sequencing were prepared according to the protocol provided
by Illumina, Inc. with minor modifications. The libraries were sequenced on the 2G
Genome Analyzer at Center of Genome Research & Biocomputing at Oregon State
University and post-processed using a standard Illumina pipeline (Bentley 2006). We
obtained approximately 8-10 million 60-bp reads for each genome, providing roughly
95X predicted coverage.
25
Assembly and Annotation
De novo assembly was generated on Newbler assembler using 454-sequencing
reads for each genome. CLC workbench (CLC Genomics Workbench 2010) was used
in the next step for combining 454-based contigs with illumina reads, wherein, 454
based contigs were used as long reads to fill in gaps generated during combined de
novo assembly. These combined assemblies of each genome were uploaded on IMG-
JGI (Joint Genome Institute, Walnut Creek, California) server for gene calling. The gene
prediction was carried out using GeneMark. Pfam, InterPro, COGs assignments were
carried out for identified genes. Pathogenicity clusters described in the paper were
manually annotated.
Whole Genome Comparisons
We aligned draft genomes against reference Xanthomonas genomes using
nucmer (Kurtz et al. 2004) of MUMmer program (version 3.20) and dnadiff was used to
calculate percentage of aligned sequences. We have also compared genomes using
the MUM index (Delonger et al. 2009) to measure distances between two genomes.
The maximal unique exact matches index (MUMi) distance calculation was performed
using the Mummer program (version 3.20). Mummer was run on concatenated contigs
or replicons (achieved by inserting a string of 20 symbols ‘N’ between contig or replicon
sequences) of each genome. The distance calculations performed using the MUMi
script are based on the number of maximal unique matches of a given minimal length
shared by two genomes being compared. MUMi values vary from 0 for identical
genomes to 1 for very distant genomes (Delonger et al. 2009).
26
Phylogenetic Analysis
MLST sequences (fusA, gapA, gltA, gyrB, lacF, lepA) for all the genomes were
obtained in concatenated form from PAMDB website (http://pamdb.org). Genes and
their corresponding amino acid sequences spanning gum, hrp cluster were downloaded
from NCBI genbank sequences of sequenced genomes. Amino acid sequences of
proteins of these clusters for Xcv and Xcc were used as query to search for homology
against draft genomes of Xp, Xv and Xg. The amino acid sequences were then
concatenated for each pathogenicity cluster and then aligned using CLUSTALW
ignoring gaps. Neighbor-joining trees were constructed with bootstrap value for 1000
replicates using MEGA4 (Tamura et al. 2007). Codon positions included were
1st+2nd+3rd+Noncoding. All positions containing gaps and missing data were
eliminated from the dataset (Complete deletion option). There were a total of 2723
positions in the final dataset.
Phylogeny Reconstruction
We used a supermatrix approach as in previous work (Moreira et.al. 2010). Protein
sequences of six Xanthomonas genomes (ingroups) and the S. maltophilia R551-3
genome (outgroup) were clustered in 5,096 families using OrthoMCL (Li et al. 2003).
We then selected families with one and only one representative from each of the
ingroup genomes and at most one outgroup protein, resulting in 2,282 families. Their
sequences were aligned using MUSCLE (Edgar 2004) and the resulting alignments
were concatenated. Non-informative columns were removed using Gblocks (Castresana
2000), resulting in 792,079 positions. RAxML (Stamatakis 2006) with the
PROTGAMMAWAGF model was used to build the final tree.
27
Prediction of Effector Repertoires, Cloning of Candidate Effectors and Confirmation Using AvrBs2 Reporter Gene Assay
A database was created collecting all the known plant and animal pathogen
effectors. Using all these known effectors as query, tblastn analysis was performed
against all contigs of the draft genomes of Xv, Xg and Xp with e-value of 0.00001
(Altschul et al. 1997). Pfam domains were searched for possible domains found in
known effectors in predicted set of ORFs of draft genome sequences. Candidate
effectors were classified according to the nomenclature and classification scheme for
effectors in xanthomonads according to currently accepted nomenclature (White et al.
2009). Candidate effectors showing <45% identity at amino acid level to the known
effectors were confirmed for their translocation using avrBs2 reporter gene assay.
N-terminal 100 amino acid region along with upstream 500 bps sequence of
candidate genes were PCR amplified using primers with BglII restriction sites at the 5’
ends. Following digestion with BglII, PCR amplicons were ligated with BglII-digested
pBS(BglII::avrBs262-574::HA) (courtesy of Dr. Mary Beth Mudgett, Stanford university),
and later transformed into E. coli DH5α. In-frame fusions were confirmed by DNA
sequencing using F20 and R24 primers. BamHI-KpnI fragments containing the
candidate gene fused to avrBs2 was then cloned into pUFR034. Resulting plasmids
were then introduced into Xcv pepper race 6 (TED3 containing mutation in avrBs2) by
tri-parental mating. The resulting Xcv strains were inoculated on Bs2 pepper cv. ECW
20R and kept at 28oC in growth room. After 24 hours, strong HR was indicating
successful translocation of candidate effector fusions.
28
Cloning of Pepper Specificity Genes in Xp.
The three genes mentioned above were cloned individually and in combination in
pLAFR3 vector and conjugated in Xp 91-118 ∆avrXv3 mutant PM1. The PM1
transconjugants with the three individual genes and combined ones along with virulent
Xcv pepper race 6 strain were infiltrated at 105 CFU/ml concentration in pepper cv.
ECW and leaves were sampled at every 48 hours after inoculation. The samples were
plated on nutrient agar, incubated at 27oC and CFU/ml counts were enumerated.
Experiment was carried out in triplicate and repeated three times.
Results
Draft Genome Sequences of Xv Strain 1111, Xp Strain 91-118 and Xg Strain 101 were Obtained by Combining Roche-454 (Pyrosequencing) and Illumina GA2 (Solexa) Sequencing Data.
Initially, we sequenced Xv strain 1111 (ATCC 35937) (hereafter Xv), Xp strain 91-
118 (hereafter Xp) and Xg strain 101 (ATCC 19865) (hereafter Xg) by 454
pyrosequencing (Margulies et al. 2005). De novo assembly using Newbler assembler
resulted in 4181, 2360 and 4540 contigs, respectively, for Xv, Xp and Xg, with
approximately 10-fold coverage for each strain. Many pathogenicity genes, including
type III effectors, existed in the form of fragments given the relatively low coverage of
the 454-based assembly. More complete assemblies were obtained using Illumina
sequencing (Bentley 2006). De novo assemblies of around 100-fold coverage were
constructed from the Illumina data alone or combined with pre-assembled 454 long
reads using CLC Genomic Workbench (CLC Genomics Workbench 2010). Combined
454 and Illumina sequencing produced a much better assembly than either technology
alone (Table 2-1). Therefore, combined assemblies were chosen for all subsequent
analyses. The average contig size in the combined 454 and Illumina assemblies was
29
around 18 kb for Xv and Xp, and 10 kb for Xg. The N50 (minimum number of contigs
needed to cover 50% of the assembly) values were 37 and 40 for Xv and Xp,
respectively, and 83 for Xg indicating that final assemblies consist of a few large contigs
allowing reasonably accurate whole genome comparisons.
The three strains were deduced to contain plasmids as evidenced by the presence
of genes that are known to be involved in plasmid maintenance (e.g. parB/F genes). We
have used adjacency to such genes to infer occurrence of certain other genes on
plasmids.
Relationships of the Strains to Other Xanthomonads using Whole Genome Comparisons
16S rRNA analysis and MLST-based phylogenetic analysis showed the diversity
among the four bacterial spot species. We carried out phylogenetic analysis based on
orthologous protein-coding genes from draft genomes and reference xanthomonads
(Figure 2-1). Whole genome comparisons were performed using the MUMi index
(Delonger et al. 2009) to assess pairwise distance between the draft genomes and
available reference Xanthomonas genomes as shown in the phylogenetic tree and the
distance matrix. Another program, dnadiff, based on nucmer (Kurtz et al. 2004) showed
the extent of homologies among the shared regions of the genomes by pairwise
comparisons (Table 2-2). All of the methods yielded consistent results: we were able to
ascertain that among the three newly sequenced strains in relationship to the previously
sequenced strains, Xp and Xcv form the closest pair, which is in turn closest to X. citri
pv. citri (Xac). Next, Xg is closest to Xcc, with Xv forming a clade with Xg and the Xcc
species group (Figure 2-1).
30
Four Xanthomonads Show Variation in the Organization of the Type III Secretion Gene Clusters
Annotation of the respective type III secretion gene clusters, or hrp genes showed
that Xp has an almost identical and syntenic hrp cluster to that of Xcv (Figure 2-2). The
most notable difference is that hpaG and hpaF encode the fusion protein XopAE in Xp,
while they are present as separate genes in Xcv. Adjacent hypothetical protein
XCV0410 (126 amino acid protein) is absent from Xp. Xv and Xg show greater similarity
to the core hrp cluster genes of Xcc than to that of Xcv. Xv and Xg contain hrpW
associated with the hrp cluster as in Xcc. Additionally, xopD in Xv and Xg is not
associated with the hrp cluster as in Xcc (referred to as psv in Xcc). PsvA shows 74%
and 84% sequence identity to the respective homologs from Xv and Xg. XopA (hpa1)
from Xcv seems to be absent from Xv and Xg. Interestingly, we found a novel candidate
effector gene (named xopZ2) upstream of hrpW in Xv and Xg (See below). Finally, the
hrp-associated effector xopF1 is conserved and intact in all four tomato and pepper
pathogens.
A Reporter Gene Assay Confirms Translocation of Novel Type III Effectors
We identified and annotated T3SS effectors from the three newly sequenced
xanthomonads (See Methods). Several candidate effectors, which had not yet been
experimentally confirmed in xanthomonads, and candidate effectors with plausible
translocation motifs were identified. Corroborative evidence for T3SS-mediated
translocation of the candidate effectors was assessed by constructing fusion genes with
the C-terminal end of AvrBs2 coding sequence (avrBs262-574aa) in a race 6 strain of X.
euvesicatoria. Translocation was measured in pepper cv. ECW 20R, containing the
resistance gene Bs2. Genes xopAO, xopG, xopAM, and XGA_0724 (belonging to the
31
avrBs1 class of effectors), of which homologs were previously found in Pseudomonas
species, were demonstrated to direct AvrBs2-specific hypersensitive reactions in ECW
20R (Table 2-4, Table 2-5; Figure 2-3). Another candidate effector gene xopZ2,
associated with the hrp clusters in Xv and Xg (Figure 2-2), was also functional in the
AvrBs2-based assay. Thus, we identified five effectors that have not been previously
recognized in Xanthomonas and showed their functionality.
Core Effectors among Four Xanthomonads Give Insights into Infection Strategies of the Pathogen
Comparing the draft genome sequences of the three xanthomonads with that of
Xcv allowed us to identify the core effectors conserved in all four strains as well as
strain-specific effectors (Tables 2-3, 2-4 and 2-5).
At least 11 effector genes form a core set of common effectors for xanthomonads
infecting tomato and pepper (Table 2-3). Of these 11, eight effector genes (avrBs2,
xopK, xopL, xopN, xopQ, xopR, xopX and xopZ) were found to be conserved in all
sequenced xanthomonads including the three draft genomes presented here with the
exceptions of X. albilineans and X. campestris pv. armoraciae. These genes might be
necessary for maintaining pathogenicity of these xanthomonads in a wide range of host
plants. XopN has been reported to suppress PAMP-triggered immunity by interacting
with tomato TARK1 and TFT1 (Kim et al. 2009). XopF1 is conserved in tomato and
pepper xanthomonads. Although a homolog of xopF1 is found in Xcc, the respective
gene is truncated (Silva et al. 2002). Hence, xopF1 is a potential pathogenicity
determinant in tomato. A xopF1 deletion mutant of Xcv did not show any difference in
virulence when compared to wild type Xcv on the susceptible cultivar of pepper cv.
ECW, suggesting XopF1 is not the lone factor for pathogenicity of Xcv on pepper
32
(Buttner et al. 2007). Another effector gene, xopD, is associated with the hrp gene
cluster in Xcv and Xp. However, xopD appears to have translocated to another location
in the genome in case of Xg, Xv and Xcc strains. XopD is annotated as “Psv virulence
protein” in Xcc genome (Silva et al. 2002) and has been shown to be a chimeric protein
sharing a C terminus with XopD from Xcv (Stavrinides et al. 2006). Although xopD
homologs from Xv and Xg are syntenic with the psv gene in Xcc, Xv and Xg have intact
full-length copies of xopD as in Xcv, indicating that the xopD could be another effector
exclusive to the tomato pathogens and a possible pathogenicity determinant in tomato.
XopD has been shown to enhance pathogen survival in tomato leaves by delaying
symptom development (Kim et al. 2008). Two tandem copies of xopX are found in Xg.
However, one gene in Xg appears to be inactive due to a frameshift mutation. In Xp, the
two copies of xopX are found in different locations in the genome with neighboring
genes, including chaperone gene groEL, which is also duplicated. Orthologs of xopZ are
also found in all four xanthomonads, with 82% identity for Xcv and Xp and 35% identity
for Xg and Xv. Apart from low sequence identity in Xv and Xg, gene-specific
rearrangements appear to have occurred within each ortholog. We propose that the
overall low amino acid relatedness of this effector in Xv and Xg warrants assigning the
proteins to a new family within the xopZ class, named xopZ2, while the orthologs from
Xcv and Xp belong to family of xopZ1 as originally described in Xoo (see above, Figure
2-2, Table 2-5).
Effectors Unique to Xp Might be Responsible for Restricting Growth on Pepper.
Xp is pathogenic only on tomato. The avirulence gene, avrXv3, present in Xp, was
previously shown to elicit an HR in pepper cv. ECW (Astua-Monge et al. 2000a). An
avrXv3 knockout mutant of Xp is not virulent in pepper cv. ECW indicating that other
33
factors are associated with host specificity. Comparing effector repertoires of the pepper
pathogens Xg, Xcv, and Xv with Xp may provide clues to the factors that are
responsible for reduced virulence (Table 2-5). Besides avrXv3, the only effectors
present in Xp and absent or inactive in Xg, Xv and Xcv are xopC2, xopAE and xopJ4
(avrXv4) (Table 2-4). The gene avrXv4 is absent from other sequenced xanthomonads
and shows gene-for-gene interaction with the Xv4 resistance gene from the wild tomato
relative Solanum pennellii but does not contribute to restricted growth of Xp on pepper
(Astua-Monge et al. 2000b). The effector xopC2 is a homolog of the effector rsp1239
from Ralstonia solanacearum GMI1000 and xopAE encodes an LRR protein with
homology to the R. solanacearum effector PopC. Both genes, xopC2 and xopAE, are
truncated in Xcv. Therefore, these two effectors may trigger immunity in pepper.
Interestingly, Xp contains a paralog of xopP. The two copies are found next to each
other in the genome and share 75% identity at the amino acid level. The second copy is
next to the candidate effector xopC2, which is unique to Xp among tomato and pepper
pathogens. Effectors xopC2 and xopP may both act to restrict growth in pepper.
Moreover, there are at least two effectors, xopE2 and xopG, present in the pepper
pathogens Xcv, Xv and Xg but absent from Xp. These effectors may be essential
pathogenicity factors in pepper.
Species-Specific Effectors
Xv possesses two unique effector genes, xopAG (avrGf1) and xopAI (Table 2-4).
A phylogenetic analysis of xopAG showed that xopAG from Xv is closely related to
xopAG from X. citri Aw, which has been shown to be responsible for causing an HR on
grapefruit (Rybak et al. 2009). XopAI is a chimeric protein, which contains a conserved
myristoylation motif at its N terminus, like XopJ1. This effector class also includes the
34
homolog XAC3230 from Xac as well as XAUB_26830 and XAUC_23780 from X.
fuscans subsp. aurantifolii strains B and C, respectively (Moreira et al. 2010). The
presence of transposons and phage elements in close proximity helps to explain the
evolution of this novel effector in Xac by terminal reassortment (Stavrinides et al. 2006).
Xv also contains effector gene avrBsT, which is responsible for the hypersensitive
response on pepper. Loss of the plasmid containing avrBsT in Xcv strain 75-3 allows
the strain to cause disease on pepper (Minsavage et al. 1990).
Xg contains at least two effectors, avrHah1 (an avrBs3-like effector gene) and
xopB as does Xcv, and share sequence identity of 82% and 86% respectively to the
corresponding effectors of Xcv. However, avrHah1 appears to specify a different
phenotype when compared to avrBs3 from Xcv. AvrHah1 was shown to be responsible
for increased watersoaking on pepper cv. ECW-50R and 60R, whereas Xcv strains
carrying avrBs3 show a phenotype that consists of small raised fleck lesions on pepper
(Schornack et al. 2008). Another effector gene, xopB, has a PIP box at the 5’ end in
Xcv, whereas the homolog in Xg does not contain a PIP box. Neighboring genes to
xopB in the respective strains are completely different between genomes, suggesting
lack of synteny between the two species in this region (Table 2-5). XopB from Xg is
92% identical at the amino acid level to the homolog in Xcv. Deletion mutants of xopB
from Xcv did not show any difference in virulence, indicating it does not contribute
significantly to virulence (Noel et al. 2001). However, xopB may contribute to virulence
in Xg. We also identified eight effector genes that are unique to Xcv (Table 2-4). With
the exception of xopAA (early chlorosis factor), all of these genes belong to regions of
low GC content compared to average genome GC content (64.75%): avrBs1 (42%),
35
xopC1 (48%), xopJ1 (xopJ) (57%), xopJ3 (avrRxv) (52%), xopO (52%), xopAJ
(avrRxo1) (51%).
Few Effectors are Shared among Phylogenetically Related Group Strains
Although Xp and Xcv, and Xv and Xg form distinct phylogenetic groups (Figure 2-
1), relatively few effectors are shared between these closely related strains. For Xp and
Xcv, they share at least six effectors – xopE1, xopF2, xopP, xopV, xopAK, xopAP,
which are absent from the other two genomes (Table 2-5). Xv and Xg appear to be most
closely related to strains of X. campestris pv. campestris, and this relationship is
reflected in the suite of effector genes. In fact, Xg and Xv share four effector genes with
Xcc, namely, xopAM, avrXccA1, hrpW and xopZ2, with the caveat that hrpW and
avrXccA1 may not function as intracellular effectors (Table 2-5). Furthermore, the
genomic regions containing these genes are syntenic in Xg, Xv and Xcc.
Xg Shows Evidence of Effector Acquisition by Horizontal Gene Transfer.
Effector homologs of avrA, hopAS1 and avrRpm1 from P. syringae pv. tomato T1
and P. syringae pv. syringae B728a are found in Xg with 79%, 41% and 61% identity at
the amino acid level, respectively (Table 2-4). Other X. gardneri strains also contain
these effectors based on PCR screening (data not shown). These three effectors,
XGA_0724 (belonging to avrBs1 class), XGA_0764/XGA_0765 (xopAS) and XGA_1250
(xopAO), are unique to X. gardneri. The C terminal region of XGA_0724 shows 53%
identity to avrBs1 from Xcv. Hence according to the Xanthomonas effector
nomenclature (White et al. 2009), XGA_0724 from Xg was placed under the class
avrBs1. XGA_0764/XGA_0765 and XGA_1250 have not yet been reported to be found
in xanthomonads and were assigned to new classes xopAS and xopAO. X. gardneri
strains have been found to be associated with tomato and have a lower optimum
36
temperature for disease development similar to that of pathovars of Pseudomonas
syringae (Araujo et.al. 2010). A high score by Alien_hunter analysis (Vernikos and
Parkhill 2006), along with very low GC content (45% for XGA_0724 and 48% for
XGA_01250, 59% for XGA_0764/XGA_0765) and the proximity of mobile genetic
elements provides evidence for horizontal gene transfer (Table 2-6). Effector xopAS
appears to be separated into two ORFs XGA_0764 and XGA_0765 by internal stop
codon. The functionality of effector xopAS needs to be confirmed by in planta reporter
gene assay. AvrA of P. syringae pv. tomato PT23 was shown to contribute to virulence
on tomato plants (Lorang et al. 1994). Acquisition of XGA_0724 by Xg might have
conferred increased virulence on tomato. AvrRpm1 from P. syringae pv. syringae
possesses a myristoylation motif, which is absent from homologs in Xg. This
modification in Xg might have been acquired to escape host recognition. Another
candidate effector gene, xopAQ, in Xg is found 68 bps downstream of a perfect PIP
box. The gene shows 65% identity at the amino acid level to rip6/11, a novel effector
from R. solanacearum RS1000 (Mukaihara et al. 2010).
All Four Xanthomonads Contain Ax21 Coding Gene but Only Xcv Contains a Functional Sulfation Gene.
The ax21 (activator of XA21-mediated immunity) gene is conserved among
Xanthomonas species and is predicted to encode a type I-secreted protein that may
serve as a quorum sensing signaling molecule (Lee et al. 2008). A 17-amino acid
sulfated peptide from the N-terminal region of Xanthomonas oryzae pv. oryzae (Xoo)
Ax21 (axYS22) was shown to bind and activate the XA21 receptor kinase from rice,
demonstrating that Ax21 is a conserved pathogen-associated molecular pattern (PAMP)
that can activate plant immune signaling (Lee et al. 2009). The ax21 gene is present in
37
Xcv (93% identity with Xoo PXO99 protein), Xp (94%), Xv (91%), and Xg (88%). The
axYS22 peptide is 100% conserved in Xcv, Xp and Xv, while in Xg there is a change
from leucine to isoleucine at residue 20; this is unlikely to alter the activity of the
peptide, since changing this residue to alanine had no effect on recognition by XA21
(Lee et al. 2008).
Recognition of axYS22 by the XA21 receptor requires sulfation of tyrosine 22,
which requires the putative sulfotransferase RaxST. In contrast to ax21, the raxST gene
is more variable in these genomes, which is consistent with a report of sequence
differences in this gene among Xoo strains (da Silva et al. 2004). Furthermore, in Xp,
there is a single-nucleotide insertion at position 65, causing a frameshift mutation. The
Xv and Xg genomes do not contain raxST; therefore, the ax21 gene products may be
nonfunctional in these strains. These findings have implications for the further study of
the role of Ax21 in quorum sensing and virulence, as well as for the usefulness of the
XA21 receptor to confer resistance to xanthomonads in crop plants.
Two Type II Secretion Systems are Conserved in All Four Xanthomonas Genomes.
Most cell-wall degrading enzymes, such as cellulases, polygalacturonases,
xylanases, and proteases, are secreted by a type II secretion system (T2SS). The Xps
T2SS, present in all xanthomonads, has been studied for its contribution to virulence in
Xcc and Xoo (Jha et al. 2005; Wang et al. 2008). Another T2SS cluster, known as the
Xcs system, is found only in certain species of Xanthomonas, e.g. Xcc, Xac, and Xcv.
The Xps system secretes xylanases and proteases and is under control of hrpG and
hrpX (Szczesny et al. 2010), indicating differential regulation. Both Xps and Xcs
systems are present in all three draft genomes.
38
Xanthomonads Possess Diverse Repertoires of Cell-Wall Degrading Enzymes, which are Present in Diverse Genomic Arrangement Patterns.
Each species of Xanthomonas has its own collection of genes encoding
endoxylanases, endoglucanases, and pectate lyases, which contribute to cell wall
deconstruction during pathogenesis. We have compared these repertoires from the
three draft genomes and other xanthomonads as detailed in Table 2-7. The genes are
designated for different families of glycosyl hydrolases (GH) and polysaccharide lyases
(PL) that include the enzymes that cleave glycosidic bonds in the structural
polysaccharides of plant cell walls.
Genes encoding secreted endoxylanases regulated by the xps genes have been
described for their contributions to virulence, including XCV0965 (Szczesny et al. 2010)
encoding a GH30 endoxyalanase. The GH30 family catalyses the cleavage of
methylglucuronoxylans in the cell walls of monocots and dicots at a β-1,4-xylosidic bond
penultimate to one linking the xylose residue that is substituted by an α-1,2-linked 4-O-
methylglucuronate residue (Hulbert and Preston 2001; St. John et al. 2006). Such an
enzyme secreted by Erwinia chrysanthemi generates oligosaccharides that are not
assimilated for growth, suggesting a function in which it contributes to cell wall
deconstruction for access to pectates for growth substrate. It is interesting to note the
orthologous genes encoding GH30 enzymes are absent in Xg and Xv, with a truncated
xyn30 gene in Xac. On the basis of sequence homology, xyn30 genes may also
contribute to virulence in Xoo, Xcc and Xp.
The more common GH10 endoxylanases, which occur in several bacterial and
fungal phyla, have been implicated in the virulence of plant pathogenic bacteria and
fungi (Sun et al. 2005; Goesaert et al. 2003). In Xoo, deletion of the gene encoding a
39
GH10 xyn10B resulted in diminished virulence (Rajeshwari et al. 2005). All sequenced
Xanthomonas genomes contain either two or three copies of xyn10 genes, all of which
are within a gene cluster that may comprise a single operon (Figure 2-4). The GH10
endoxylanases are the best studied of all of the xylanases, and structure/function
relationships may be inferred on the basis of gene sequence. The action of these
enzymes on glucuronoxylans generates xylotriose, xylobiose, and small amounts of
xylose that generally serve as substrates for growth. Also generated is
methylglucuronoxylotriose, that is formed to the extent that xylose residues in the β-1,4
xylan backbone are substituted with α-1,2-linked 4-O-methylglucuronate residues (Biely
et al. 1997).
An adjacent gene cluster in an opposite orientation contains an agu67 gene
encoding a GH67 α-glucuronidase that serves to catayze the removal of 4-O-
methylglucuronate from the reducing terminus of methylglucuronoxylotriose. This
activity provides a synergistic function to the overall xylanolytic process to generate
xylotriose, which is converted to xylose by xylanases and xylosidases for complete
metabolism (Preston et al. 2003). The coregulation of operons encoding XynB and
Agu67 enzymes occurs as a logical condition to coordinate expression of genes that
encode these and additional enzymes that collectively process glucuronxylans and
glucuronoarabinoxylans for complete metabolism. The accessory enzymes and
transporters necessary for the function of these enzymes are embedded within these
operons in Gram positive bacteria (Shulami et al. 1999; Shulami et al. 2007; Chow et al.
2007) and share similarities noted here with Xanthomonas spp. These include the
genes encoding two glycohydrolases, a β-xylosidase and an α-L-arabinofuranosidase.
40
Also included in this cluster are genes encoding enzymes for intracellular metabolism
of glucuronate and xylose, including glucuronate isomerase; xylulose isomerase; D-
mannonate dehydratase; and D-mannonate oxidoreductase. Genes encoding mannitol
dehydrogenase and the hexuronate transporter, as well as the TonB-dependent
receptor and LacI transcriptional regulator, flank these two operons.
The arrangement and content of xylanolytic enzymes differentiate Xanthomonas
species into three groups (Figure 2-4). Here, we propose a common nomenclature for
xylanases, the genes for which have been annotated in the sequenced genomes.
Members of the first group are Xac, Xcv and Xp in which all three genes encoding
GH10 endoxylanases (xyn10A, xyn10B and xyn10C) are present, and with additional
genes further downstream in this cluster. Members of the second group are Xcc, Xv and
Xg in which genes encoding two of the three endoxylanases are present (xyn10A and
xyn10C) and where one or more of the the downstream genes are absent. Xoo strains
represent a third group in which a different set of two endoxylanase encoding genes are
present (xyn10A and xyn10B) and where the β-galactosidase and gluconolactonase
genes flanking xyn10C are absent. It is noteworthy that the organization of genes in the
cluster encoding the α-glucuronidase is conserved across Xanthomonas species.
Genes Involved in Several Type IV Secretion Systems are Present in Genomes and Plasmids
Like Xcv, the tomato pathogens, Xg, Xv and Xp, also appear to contain more than
one copy of a type IV secretion system (T4SS) cluster (Figure 2-5, 2-6). Two T4SS
clusters (Vir and Dot/Icm type) are present in Xcv, and genes belonging to both of these
systems are found on plasmids (Thieme et al. 2005). The Dot/Icm type system is absent
from Xv, Xp and Xg.
41
In Xv and Xp, genes for one T4SS are on a plasmid and the second one on the
chromosome while in Xg, two T4SS gene clusters are on a plasmid and one is on the
chromosome. The two T4SS clusters on plasmids of Xg do not show any similarity to
the genes for T4SS in Xac, Xcv, Xcc and Xoo. Of the two T4SS clusters in Xg, one is
also found in Xv and Xp. This cluster appears to be exclusive to these three tomato
pathogens (Figure 2-5). The genes belonging to this cluster show low (30-45%) identity
to the T4SS clusters from Ralstonia, Burkholderia, Bradyrhizobium, and
Stenotrophomonas maltophilia. The other cluster from Xg, which is absent from Xv and
Xp, shows very high identity (98%) and synteny to the T4SS cluster of Burkholderia
multivorans and around 89% identity to a T4SS cluster of Acidovorax avenae subsp.
citrulli (Figure 2-6).
Apart from the plasmid borne T4SS genes, Xcv also contains a portion of a type IV
system cluster on the chromosome and consists of VirB6, VirB8, VirB9, VirD4 genes.
This chromosomal cluster is flanked by a transposon element (IS1477) that might
indicate its horizontal gene transfer. Xp, Xg and Xv genomes contain a complete
chromosomal T4SS cluster showing high identity to the T4SS chromosomal clusters
from Xcc (Figure 2-7).
Type V Secreted Adhesins Function in Synergism During Pathogenesis
Different adhesins have been shown to function at different stages of the infection
process starting with attachment, entry, later survival inside host tissue and colonization
by promoting virulence (El Tahir et al. 2000; Das et al. 2009). FhaB hemagglutinin,
important for leaf attachment, survival inside plant tissue and biofilm formation, is
present in all four tomato pathogens. In Xcv, fhaB is divided into two separate open
reading frames, XCV1860 and XCV1861, with the two-partner secretion domains being
42
present in XCV1860. Sequence alignment indicates that fhaB is possibly inactivated in
Xcv by the internal stop codon that separates XCV1860 from XCV1861. In the case of
Xoo PXO99A, the Xanthomonas adhesin-like proteins XadA and XadB promote
virulence by enhancing colonization of the leaf surface and leaf entry through hydathode
(Das et al. 2009). As in Xcv and Xac, Xp encodes two copies of xadA, while Xv and Xg
possess a single ortholog of xadA as does Xcc. YapH and the type IV pilus protein PilQ
were shown to be involved in virulence in Xoo during later stages of growth and
migration in xylem vessels. In Xcv, Xc, and XooKACC, two copies of yapH are present.
There are two pilQ orthologs in Xcv and only one in other sequenced xanthomonads.
Next to the fhaB and fhaC adhesin genes, hms operon is present in the genomes of
xanthomonads, the homologs of which are pga operon genes in E. coli involved in
biofilm formation (Wang et al. 2004).
Type VI Secretion System is Present in Xcv, Xv and Xp
Type VI secretion system (T6SS) has been shown recently to contribute to host
pathogen interactions during pathogenesis in Vibrio cholerae, Burkholderia
pseudomallei and Pseudomonas aeruginosa. Hcp (Haemolysin-coregulated protein)
and Vgr (valine-glycine repeats) proteins are exported by the T6SS (Boyer et al. 2009).
T6SS clusters can be assigned to three different types in xanthomonads (Table 2-8).
Xcv and Xp possess two types of T6SSs (type 1 and 3); whereas Xv contains only a
single type of T6SS, type 3 (Table 2-9). As in Xcc, there is no T6SS cluster in Xg (Table
2-8).
43
LPS Locus Displays Remarkable Variation In Sequence and Number of Coding Genes and Shows Host Specific Variation
The lipopolysaccharide (LPS) biosynthesis cluster has been studied in detail in
Xcc (Vorholter et al. 2001), which comprises three regions; region 1 from wxcA to wxcE
involved in biosynthesis of water soluble LPS antigen; region 2 (gmd, rmd) coding for
LPS core genes; and region 3 from wxcK to wxcO coding for enzymes for modification
of nucleotide sugars and sugar translocation systems. This LPS biosynthesis locus is
positioned between highly conserved housekeeping genes, namely cystathionine
gamma lyase (metB) and electron transport flavoprotein (etfA), as reported in other
xanthomonads (Patil et al. 2007). Comparison of this cluster from draft genomes to the
already sequenced xanthomonads revealed high variability in the number of genes and
their sequences. Xv and Xg have an identical type of LPS gene cluster of 17.7 kb
encoding 14 open reading frames (Figure 2-8) which is similar in organization and
sequence identity to the LPS locus from Xcc strains. Interestingly, Xg and Xv also
contain two glycosyl transferases involved in synthesis of xylosylated polyrhamnan as
seen in Xcc (Molinaro et al. 2003), in contrast to glycosyl transferases (wbdA1, wbdA2)
involved in synthesis of polymannan in Xcv (Thieme et al. 2005). This suggests that
basic structure of O-antigen in Xg and Xv is similar to Xcc. The three tomato/pepper
pathogens Xcv, Xv and Xg have retained an ancestral type of LPS gene cluster (Figure
2-8). On the other hand, Xp has acquired a novel LPS gene cluster during the course of
evolution and is completely different in sequence and number of genes that are
encoded. In Xp, this LPS locus is 17.3 kb long and encodes 12 ORFs, all of which are
absent in the corresponding genomic region of Xcv, Xv or Xg. Also the first five ORFs
flanking the metB side of the LPS locus in Xp (Figure 2-8, ORFs colored in red) showed
44
very low or no identity to region 1 of the LPS locus in the other xanthomonads.
However, these ORFs still belong to the same Pfam families (Finn et al. 2010) that are
usually present in this region, for example, ABC transporters and glycosyl transferases.
The second half of the LPS cluster flanking etfA side encodes six ORFs, which are
homologs of the LPS cluster genes from Xac, Xcm and Xoo. Phylogenetic insight based
on conserved metB and etfA genes that flank the LPS locus suggest that the ancestor
of all the Xanthomonas pathogens of pepper and tomato studied in this paper had the
same LPS gene cluster, however putative horizontal gene transfer events at this locus
have led to the acquisition of a novel LPS gene cluster in Xp. Alien_hunter analysis also
supports this acquisition with a high score showing this region to belong to an
anomalous region (Table 2-6). This event might have played a major role in changing
the specificity of Xp towards tomato and its dominance over its relative(s) as reported
previously (Jones et al. 1998a), similar to variant epidemic strain of Vibrio cholerae,
reported to be a major reason for its emergence and cholera outbreak during the 1990’s
in the Indian subcontinent (Mooi and Bik 1997). Identity in terms of sequences and gene
organization among pepper pathogens and absence of those genes from X. perforans
and a novel LPS cluster in the tomato pathogen X. perforans suggest a role of this
cluster in host specific variation.
Analysis of DSF Cell-Cell Signaling System
RpfC/RpfG are two-component signaling factors and are involved in DSF
(diffusible signal factor) cell-cell signaling (Slater et al. 2000; He and Zhang 2008; Dow
2008, Ryan et al. 2010), known to co-ordinate virulence and biofilm gene expression.
The genomes of Xv, Xp, and Xg carry an rpf (regulation of pathogenicity factors) gene
cluster (Table 2-10) that is found in all xanthomonads and which encodes components
45
governing the synthesis and perception of the signal molecule DSF (He and Zhang
2008; Dow 2008). The Rpf of the DSF system regulates the synthesis of virulence
factors and biofilm formation and is required for the full virulence of Xcc, Xac, Xoc, and
Xoo (Barber et al. 1997; Dow et al. 2003; Chatterjee and Sonti 2002; Siciliano et al.
2006; Wang et al. 2007a). RpfF is responsible for the synthesis of DSF, whereas, RpfC
and RpfG are implicated in DSF perception and signal transduction (Slater et al. 2000;
He and Zhang 2008; Dow 2008; Ryan et al. 2010). RpfC is a complex sensor kinase,
whereas RpfG is a response regulator with a CheY-like receiver domain that is attached
to an HD-GYP domain. HD-GYP domains act in degradation of the second messenger
cyclic di-GMP (Ryan et al. 2006). In addition to genes encoding these products, Xg and
Xp have rpfH, which encodes a membrane protein related to the sensory input domain
RpfC but whose function is unknown. Xv contains rpfH but with an internal stop codon.
rpfH is present in Xcv and Xcc, and absent in Xac and Xoo.
Cyclic Di-GMP Signaling
Cyclic di-GMP is a second messenger known to regulate a range of functions in
diverse bacteria, including the virulence of animal and plant pathogens (Romling et al.
2005; Jenal and Malone 2006; Hengge 2009). The cellular level of cyclic di-GMP is
controlled by a balance between synthesis by GGDEF domain diguanylate cyclases and
degradation by HD-GYP or EAL domain phosphodiesterases. GGDEF, EAL and HD-
GYP domains are largely found in combination with other signaling domains, suggesting
that their activities in cyclic di-GMP turnover can be modulated by environmental cues.
A number of proteins involved in cyclic di-GMP signaling have been implicated in
virulence of Xcc (Ryan et al. 2007; He et al. 2009). The genome of Xcv encodes 3
proteins with an HD-GYP domain and 33 proteins with GGDEF and /or EAL domains.
46
As in other Xanthomonas spp, the HD-GYP domain proteins are completely conserved
in Xcv, Xv, Xg and Xp. There is also almost complete conservation of GGDEF/EAL
domain proteins between Xcv and three draft genomes, although Xv has no ortholog of
XCV1982. In addition, the EAL domain protein (XCVd0150) encoded on a plasmid in
Xcv is absent in the other strains.
Copper Resistance (cop) Genes are Present in Xv and Copper Homeostasis (coh) Genes are Present in All Strains
Among the Xcv, Xv, Xp and Xg strains sequenced, Xv is the only one resistant to
copper and the only strain harboring a set of plasmid borne genes, namely copL, copA,
copB, copM, copG, copC, copD, and copF that are also present in copper resistant
strains of Xac (unpublished data/ Behlau, F. personal communication) and S.
maltophilia (Crossmann et al. 2008). Genes copA and copB have been previously
annotated as copper resistance related genes for many different xanthomonad
genomes including Xoo, Xoc, Xcv, Xac and Xcc. Homologs of these genes are also
present in Xv, Xg and Xp and are located on the chromosome. Additionally, upstream of
copA on the chromosome of all strains, there is an ORF that shares homology with
plasmid copL. In contrast to what has been published, chromosomal copA and copB are
not responsible for copper resistance but likely for copper homeostasis and/or
tolerance. While strains harboring the plasmid-borne cop genes, like in Xv, are resistant
to copper and can grow on MGY agar (manitol-glutamate yeast agar) amended with up
to 400 mg L-1 of copper sulfate pentahydrate, strains that have only the chromosomal
cop genes as for Xcv, Xp and Xg, are sensitive to copper and can only grow on media
amended up to 75 mg L-1 of copper. Nucleotide sequence of plasmid cop genes in Xv
are 98% similar to the ones found in Xac and Stenotrophomonas, whereas
47
chromosomal copLAB from Xv is 83% identical to homolog ORFs in Xcv, Xg and Xp.
When copL, copA and copB genes from Xv located on the plasmid are compared to the
homologs on the chromosome of the same strain, the identity of nucleotide sequences
is 27, 73, and 65%, respectively. To avoid further confusion or misinterpretation, we
suggest that the nomenclature of the chromosomal copL, copA and copB genes in
xanthomonads should be changed to cohL, cohA and cohB, respectively, referring to
copper homeostasis genes. New nomenclature has been adopted in the annotation of
the draft genomes.
Genes Unique to Xp as Compared to Pepper Pathogens Give Clues to its Predominance over Xcv in the Field and Host Specificity
Thirteen gene clusters were found to be specific to the tomato pathogen Xp when
compared to the other three strains (Table 2-11). A part of the clusters are syntenic to
the genomic regions specific to the three pepper pathogens, suggesting the
replacement of these genomic regions from pepper pathogens in correspond to these
region in Xp. These replaced regions in Xp might provide potential candidates for host
range determinants. Most notable among these regions was the LPS cluster genes
(See above). Other such regions include the avirulence genes avrXv3 and avrXv4, a
TIR-like domain containing protein, oxidoreductases, and bacteriocin-like proteins that
were not found in any other sequenced xanthomonads. Importance of bacteriocin-like
genes in Xp has already been studied for its predominance in the field over T1 strains
(Hert et al. 2005; Tudor-Nelson 2003). Alien_hunter analysis showed that the
bacteriocin BCN-A region belongs to an anomalous region indicating possible horizontal
gene transfer of this region (Table 2-6).
48
Pepper Pathogenicity/Aggressiveness Factors Increased In Planta Growth of Xp
Comparison of proteomes of Xv, Xg, Xcv against Xp showed 68 genes exclusive
to pepper pathogens which might be candidate virulence factors on pepper (Table 2-
12). These include 16 genes with known function, 35 coding for mobile genetic
elements, and 17 genes with unknown function/hypothetical proteins. Out of the 16
genes with known function, xopG was confirmed to be a type III effector using the
avrBs2 reporter gene assay and 6 genes belong to the LPS biosynthesis gene cluster.
These 16 genes were searched against already sequenced genomes of Xac, Xcc and
Xoo. The wxcO gene, which codes for O-antigen, has been identified to be a virulence
factor in the X. fuscans – bean pathosystem by subtractive hybridization (Alavi et al.
2008). Three genes, XCV1298, XCV1839 and wxcO, were initially selected for the
verification of their contribution to virulence in pepper. Individual genes along with their
promoter regions were cloned into pLAFR3 and conjugated individually and in
combination into X. perforans ME24 (91-118∆avrXv3), which no longer elicits an HR in
pepper. However, in planta growth of ME24 is more similar to that of an avirulent strain
than the virulent pepper strain TED3 race 6. ME24 transconjugants carrying wxcO and
XCV1839 in combination showed increased in planta growth and also comparatively
increased number of lesions on pepper cv. ECW when compared to ME24 revealing
that these two genes play in fact a role in pepper pathogenicity (Figure 2-9).
Genes Specific to Xg as Compared to Other Tomato/Pepper Pathogens may Explain its Aggressive Nature on Tomato and Pepper
Comparison of genes from Xg against Xcv, Xp and Xv genes showed the
presence of 625 genes specific to Xg. These include four type III effectors (avrBs1
member, xopAO, avrHah1, xopAQ), twenty-one genes belonging to the unique type IV
49
secretion system cluster and associated genes. These genes can be speculated to
contribute to the aggressive nature of Xg strains on tomato and pepper. Xg also
contains a unique beta xylosidase not present in any other xanthomonads. Moreover,
Xg contains XGA_3730 coding for a hemolysin-type calcium-binding repeat containing
protein, a homolog of which is found in Xylella strains with 55% sequence identity. In
Xylella, this gene is annotated as a member of a family of pore forming toxins/RTX
toxins. Its homolog is also found in other plant pathogens (i.e. P. syringae pv. syringae
B728a and R. solanacearum GMI1000). This protein has been described as a type I
effector in X. fastidiosa str. temecula (PD1506) (Reddy et al. 2007). RTX toxin family
members, especially of the hemolysin type, have been shown to be virulence factors in
a variety of cell types in eukaryotes (Lally et al. 1999; Linhartova et al. 2010). Finally, a
gene XGA_0603 coding for lanthionine synthetase (lantibiotic biosynthesis) is found
among these Xg specific genes, a homolog of which is found in Xvm NCPPB702. LanL
enzymes in pathogenic bacteria contribute to virulence by modifying the host signaling
pathways, in most cases by inactivating MAPKs (Goto et al. 2010).
Genes Common to All Tomato Pathogens but Absent from Other Sequenced Xanthomonads
In order to see what defines the tomato pathogens, we compared the four
sequenced genomes (Xv, Xp, Xg and Xcv) to other sequenced xanthomonads. We
found seven genes that were conserved in all four tomato pathogens and absent from
most of other sequenced xanthomonads with the exception of Xcm, Xvm, Xau, which
possess homologs for six out of these seven genes (Table 2-13). Only the hypothetical
protein XCV2641 seems to be specific to the four tomato pathogens. This gene shows
only 35% sequence identity to a gene from Xvm and Xcm. A homolog of the
50
hypothetical protein, XCV4416 was found in Xau, but is absent from all other sequenced
xanthomonads. Genes homologous in Xcm and Xvm include two transposase genes
both belonging to the transposase 17 superfamily (XCV0615, XCV0623), XCV0041
(putative penicillin amidase fragment), XCV0111 (lignostilbene-alpha, beta
dioxygenase), XCV0112 (uncharacterized protein conserved in bacteria) (Table 2-13).
Interestingly, XCV0111 encodes a protein known to be involved in phenylpropanoid
degradation. Phenylpropanoids are well known plant secondary metabolites induced
during defense response upon pathogen attack (Dixon et al. 2002). It appears that the
four tomato pathogens along with Xvm and Xcm have acquired this function to disarm
the basal plant defense.
The Evolution of Pathogenicity Clusters Corresponds to the MLST-Based Phylogeny
The correlation between tree topology using MLST and phylogeny based on the
sequences of pathogenicity clusters and the avrBs2 effector gene, which is found in all
xanthomonads, was tested. Based on MLST, Xp and Xcv group together along with Xac
while Xg is more closely related to Xcc. Xv forms a different clade and is more closely
related to the Xcc group. As can be seen in Figure 2-10, phylogeny based on MLST is
congruent with phylogeny based on the pathogenicity clusters (gum, hrp cluster) and
based on the avrBs2 effector, suggesting that overall these clusters were vertically
inherited from the most recent common ancestor of these strains.
Concluding Remarks
The interaction of Xanthomonas strains with tomato and pepper represents a
model system for studying plant-pathogen co-evolution because of the diversity present
among the strains causing bacterial spot. Although the four Xanthomonas species infect
51
the same host, tomato, and cause very similar disease, they are genetically diverse
pathogens. The comparative genomic analysis has provided insights into the evolution
of these strains. Whole genome comparisons revealed that Xg and Xv are more closely
related to Xcc than Xcv and Xp. A few pathogenicity clusters, such as hrp, xcs and xps
of Xg and Xv, were similar in terms of genetic organization and sequence identity to
Xcc. However, a few pathogenicity clusters of the four strains belonging to four
phylogenetic groups showed different evolutionary origins. While the pepper pathogens
Xcv, Xv and Xg possess similar LPS biosynthesis cluster, part of the LPS cluster from
Xp is similar to the one from Xac. Xv contains few effectors, including xopAG (avrGf1)
and xopAI the latter of which was previously found to be unique to citrus pathogens
Xac, Xaub and Xauc (Moreira et al. 2010). Xg has a number of effectors homologous to
P. syringae type III effectors suggesting probable horizontal transfer of these effectors.
Xg contains a unique T4SS along with the one that is exclusive to Xp, Xv and Xg. Xp
has two T6SSs, as found in Xcv. Xv has only one T6SS, which is similar to that of Xac.
Xg has no T6SS as seen for Xcc. While Xg and Xv show close relationship to Xcc
based on whole genome comparisons, few pathogenicity clusters mentioned above
seem to be conserved among tomato/pepper Xanthomonads.
Type III effectors have been investigated for their contribution to pathogenicity and
host-range specificity. In addition to homologs of the known effectors, we identified
novel effectors in the draft genomes. By comparing effector repertoires of tomato
pathogens, two possible candidate pathogenicity determinants, xopF1 and xopD, were
identified, of which xopD is responsible for delaying symptom development, and in turn,
is important for pathogen survival. Unique genes present in Xg include the novel
52
effectors xopAO, xopAQ, xopAS and an avrBs1 member as well as a few other
virulence factors, which have been characterized in other plant pathogens and which
could explain the aggressive nature of Xg on pepper. Each species contains at least
three unique type III effectors, which could explain host preferences among the strains
and their aggressiveness on tomato/pepper. Comparison of the LPS clusters between
the four species revealed significant variation. Xp has acquired a novel LPS cluster
during evolution, which might be responsible for its predominance and its limited host
range. As seen from the in planta growth assay of Xp ∆avrXv3 mutant carrying the LPS
O-antigen from Xcv, the LPS cluster from pepper pathogens can be a contributor to the
increased in planta growth of Xp ∆avrXv3 mutant on pepper, but is not the absolute
virulence determinant. Use of the XA21 receptor similar to the Xoo-rice system in Xcv –
tomato/pepper could be one of the ways to confer resistance to xanthomonads due to
presence of a similar AX21 peptide and a functional rax system in Xcv. Common and
unique genes encoding enzymes involved in cell wall deconstruction are candidates for
further study to define host preference and virulence.
In conclusion, comparison of draft genomes obtained by next generation
sequencing has allowed an in-depth study of diverse groups of bacterial spot pathogens
at the genomic level. This analysis will serve as a basis to infer evolution of new virulent
strains and overcoming existing host resistance. The knowledge of potential virulence or
pathogenicity factors is expected to aid in devising effective control strategies and
breeding for durable resistance in tomato and pepper cultivars.
53
Table 2-1. General sequencing and combined (454 and solexa) de novo assembly features of draft genomes of Xv, Xp and Xg.
Xv Xp Xg Number of contigs 296 291 552
N50* 37 40 83
Mean contig length 18,686 18,082
10,014
Longest contig 153,834 133,836
88,536
Total length of contigs
5,531,090
5,262,127
5,528,125
Table 2-2. Whole genome comparisons using MUMmer dnadiff program. % coverage of the aligned contigs and % identities of the respective contigs against reference genomes has been shown for each draft genome. Genome comparison % of contigs of draft
genome aligned % of average identity for the
aligned sequences
Xp Xcv 85.57 98.1
Xac 85.91 93.8
Xcc 74.23 87.36
Xoo MAFF 77.32 90.5
Xg Xcv 78.44 88.57
Xac 79.71 88.05
Xcc 83.33 88.83
Xoo MAFF 72.83 87.9
Xv Xcv 83.11 87.86
Xcc 76.35 87.37
Xac 80.07 87.90
Xoo MAFF 69.26 87.68
54
Table 2-3. Core effectors present in all four tomato and pepper xanthomonads Effector
class Xcv Xv Xp Xg Pfam domains Ref
AvrBs2 XCV0052 XVE_4395 XPE_2126 XGA_3805 Glycerophosphoryl diester
phosphodiesterase
Kearney and Staskawicz,
1990.
XopD XCV0437 XVE_2372 XPE_2945 XGA_3151 C48-family SUMO cysteine protease
(Ulp1 protease family); EAR motif
Roden et al., 2004
XopF1 XCV0414 XVE_3220 XPE_2922 XGA_2763 - Roden et al., 2004
XopK XCV3215 XVE_0354 XPE_1077 XGA_3563 - Furutani et al., 2009
XopL XCV3220 XVE_0359 XPE_1073 XGA_0320 LRR protein Jiang et al., 2009
XopN XCV2944 XVE_0564 XPE_1640 XGA_0350 ARM/HEAT repeat Kim et al., 2009
XopQ XCV4438 - XPE_0810 XGA_0949 Inosine uridine nucleoside N-ribohydrolase
Roden et al.,2004
XopR XCV0285 XVE_0593 XPE_1215, XPE_3295
XGA_1761 - Furutani et al., 2009
XopX XCV0572 XVE_ 3610 XVE_3609
(partial)
XPE_1488 XPE_1553
XGA_3272 (second
copy with frameshift)
- Metz et al., 2005
XopZ1 XCV2059 + (*) XPE_2869 +(*) - Furutani et al., 2009
XopAD XCV4315/4314/431
3
XVE_4177 XPE_4269 XGA_0755 SKWP repeat protein
Guidot et al., 2007
*Xv and Xg contain effector xopZ2 belonging to the same family xopZ.
55
Table 2-4. Type III effectors specific to each species Effector Locus tags Effector
homolog Pfam domains/
biochemical motifs Comments/Reference
Effectors specific to Xv XopJ2 XVE_4840
(partial); XVE_3769
(partial)
AvrBsT
C55-family cysteine protease
or Ser/Thr acetyltransferase
Minsavage et al., 1990
XopAG XVE_2415 AvrGf1 - Rybak et al., 2009
XopAI XVE_4756 XAC3230 - Moreira et al., 2010
Effectors specific to Xg class avrBs1 XGA_0724 AvrA
(84% identity)
- This study
AvrHah1 (Fragmented in assembly)
XGA_4845/ XGA_3187
AvrBs3 Transcriptional activator, nuclear
localization
AvrBs3 present in few euvesicatoria strains. Schornack et al., 2008
XopAO XGA_1250 AvrRpm1 (61%
identity)
- This study
XopAQ XGA_2091 Rip6/rip11 No known domains Mukaihara et al., 2010
XopAS XGA_0764/0765 HopAS1 No known domains This study
Effectors specific to Xp XopC2 XPE_3585 Rsp1239 Haloacid
dehalogenase-like hydrolase
White et al., 2009
XopJ4 XPE_1427 AvrXv4 SUMO protease (experimental); YopJ-like serine threonine acetyl
transferase domain (predicted)
Astua-Monge et al., 2000b; Roden et al.,
2004.
XopAF XPE_4185 AvrXv3 Transcriptional activator domain
Astua-Monge et al., 2000a
XopAE XPE_2919 HpaF/G LRR protein White et al., 2009
Effectors specific to Xcv AvrBs1 XCVd0104 AvrBs1 - Thieme et al., 2005
XopC1 XCV2435 XopC Phosphoribosyl transferase domain and
haloacid dehalogenase-like
hydrolase
Roden et al., 2004
56
Table 2-4. continued Effector Locus tags Effector
homolog Pfam domains/
biochemical motifs Comments/Reference
XopJ1 XCV2156 XopJ C55-family cysteine protease or Ser/Thr acetyltransferase
Roden et al., 2004
XopJ3 XCV0471 AvrRxv C55-family cysteine protease or Ser/Thr acetyltransferase
Thieme et al., 2005
XopO XCV1055 Unknown Thieme et al., 2005
XopAA XCV3785 ECF Early chlorosis factor, proteasome/cyclosome
repeat
Thieme et al., 2005
XopAI XCV4428 AvrRxo1 - Thieme et al., 2005
57
Table 2-5. Effectors specific to particular groups of species Effector class Locus tags Pfam domains Comments/ References
Effectors common to all pepper pathogens Xv, Xcv and Xg XopE2 XCV2280, XVE_1190,
XGA_2887 Putative
transglutaminase Thieme et al., 2007
XopG XCV1298, XVE_4501, XGA_4777
M27 family peptidase clostridium toxin
This study
Effectors common to Xv, Xg but absent from Xp and Xcv XopAM XVE_4676, XGA_3942 - This study
HrpW XVE_3222, XGA_2761 Pectate lyase HrpW associated with hrp cluster, May not be T3SE; Park et al., 2006
AvrXccA1 XVE_5046, XGA_0679 LbH domain containing hexapeptide repeats (X-[STAV]-X-[LIV]-
[GAED]-X)- acyltransferase enzyme
activity
May not be T3SE; Xu et al., 2006
XopZ2 XGA_2762, XVE_3221 Not known This study; Associated with hrp cluster.
Effectors common to Xg and Xcv but absent from Xp and Xv XopB XGA_4392, XCV0581 - Noel et al., 2001
Effectors common to Xp and Xcv but absent from Xg and Xv XopE1 XPE_1224, XCV0294 Putative
transglutaminase Thieme et al., 2007
XopF2 XPE_1639, XCV2942 - Roden et al., 2004 XopI XPE_3711, XCV0806 F-box domain Thieme, 2008 XopP XPE_3586,
XPE_4695(Partial), XCV1236
Roden et al., 2004
XopV XPE_4158, XCV0657 - Furutani et al., 2009 XopAK XPE_4569, XCV3786 - Not confirmed to be
effector in Xanthomonas; Homolog of effector in Pseudomonas.
XopAP XPE_1567, XCV3138 Lipase class III 45% identity to homolog in Xp;
Homolog of rip38 from R. solanacearum
RS1000; Mukaihara et al., 2010
Effectors present in Xv and Xp but absent from Xg and Xcv XopAR XVE_3216, XPE_2975 - Mukaihara et al., 2010
58
Table 2-6. Evidence of horizontal gene transfer using Alien Hunter analysis Gene/ Gene cluster
Locus tag Score for Alien
Hunter (Threshold = 12.496)
% GC
tRNA/transposase/mobile genetic elements
in the vicinity
Evidence of HGT
avrBs1 XGA_0724 32.031 45 Transposase Good
xopAO XGA_1250 13.735 48 Predicted to be located on plasmid
Good
xopAS XGA_0764/XGA_0765
19.844 59 Transposase Good
xopG XGA_4501 XVE_4777 XCV1298
21.272 50 ISxac2 transposase in Xcv
Good
xopAQ
XGA_2091
Does not belong to
anomalous region
51
Could not be
predicted
Weak
xopZ2 XGA_2762 XVE_3221
Does not belong to
anomalous region
69 IS30 transposase 3000 bps apart
Weak
LPS
cluster
XPE_3787 to
XPE_3795
Belongs to anomalous
region
50
No
Good
Bacteriocin cluster
XPE_0786 to
XPE_0790
Belongs to anomalous
region
50
tranposase
Good
59
Table 2-7. Repertoire of cell wall degrading enzymes in xanthomonads. Gene name
Family Enzymatic function
Xp Xac Xcv Xv Xg Xcc str. 33913
Xoo str.
KACC
Xylanases xyn10A GH10 Endo-β-1,4-
xylanase
EC:3.2.1.8
2014 4254 4360 2337 1172 4118 4429
xyn10B 2016 4252 4358 - - - 4428
xyn10C 2020 4249 4355 2333 0341 4115 -
aguA GH67 α-glucuronidase
EC:3.2.1.139
4318 4227 4333 4712 2473 4102 4419
xyn51A GH51 β-D-Arabino-furanosidase
EC:3.2.1.55
0180 1286 1335 1029/1030 2303 1191 1317
xyn5A GH5 Endo-β-1,4-xylanase
EC:3.2.1.8
4682 0933/34 partial
0965 - - 0857 3618
Glucanases cel8A GH8
Endo-1,4-β-D glucanase
1965 3516 3641 0432 - - -
cel9A GH9 2345 2522 2704 1327 0588 2387 -
Pectate lyases pel1A PL1 Pectate lyase
EC:4.2.2.2
3841 3562 3687 1933 4024 0645 0821
pel1B 1563 2986 3132 3512 0893 2815 -
pel1C - 2373 2569 - - - -
pel3A
PL3 Pectate lyase
EC:4.2.2.2
- 2922 - 3222 2761 1219 -
pel4A PL4 Rhamno-galacturonan
lyase
EC:4.2.2.-
1975 3505 3632 2592 4531 3377/78/79 1078
pel9A
PL9 Pectate lyase
EC:4.2.2.2
- - 2278 1927 1853 - 2265
60
Table 2-7. continued Gene name
Family Enzymatic function
Xp Xac Xcv Xv Xg Xcc str. 33913
Xoo str.
KACC
pel10A PL10 Pectate lyase
EC:4.2.2.2
- - - 4069 5124 0122 -
Table 2-8. Type VI secretion clusters in different xanthomonads. Strain T6SS #1 T6SS #2 T6SS #3
Phosphorylation-type regulators:
Kinase / Phosphatase / Forkhead
- Kinase / Phosphatase / Forkhead
AraC-type regulators:
- - AraC
Xvm NCPPB702 YES / /
Xvm NCPPB4381 YES / /
Xaub / / YES
Xauc / / YES
Xac / / XAC4116 - XAC4148
Xv / / YES
Xp YES / YES
Xcv XCV2120 - XCV2143 / XCV4206 - XCV4244
Xoo KACC10331 XOO3034 - XOO3052 XOO3466 - XOO3517
/
Xoo MAFF 311018 XOO2886 - XOO2906 XOO3286 - XOO3319
/
Xoo PXO99A XOO0245 - XOO0270 XOO2029 - XOO2060
/
Xoc BLS256 XOC2523 - XOC2545 XOC1309 - XOC1370
/
Xg / / /
Xcc ATCC33913 / / /
Xcc 8004 / / /
Xca 756C / / /
Xalb / / /
61
Table 2-9. Genes/contigs representing T6SS in draft genomes as compared to Xcv. T6SS subtype #1 T6SS subtype #3
Xp XCV homologs Xp XCV homologs Xv XCV homologs Contig 33 XCV2120-
XCV2127(N) Contig 120
XCV4244-XCV4236(N)
Contig 233
XCV4244-XCV4216
Contig 287
XCV2127(i) Contig 287
XCV4236(i)
Contig 288
XCV2127(i) Contig 288
XCV4236(i)
Contig 291
XCV2127(i) Contig 291
XCV4236(i)
Contig 238
XCV2127(i) Contig 238
XCV4236(i)
Contig 254
XCV2127(i) Contig 254
XCV4236(i)
Contig 90 XCV2127(C)-XCV2137(N)
Contig 44 XCV4236(C)-XCV4216
Contig 240
XCV2137(C)-XCV2144
no homolog
XCV4215 no homolog
XCV4215
Contig 116
XCV4214-XCV4209(N)
Contig 183
XCV4214-XCV4212(N)
Contig 133
XCV4209(C)-XCV4206(N)
Contig 148
XCV4213(N)-XCV4206(N)
Contig 233
XCV4206(i)
Contig 195
XCV4206(C) Contig 175
XCV4206(C)
Table 2-10. A comparison of rpf cluster from rpfB to rpfG found across a range of Xanthomonas genomes.
Gene Name
Xcc8004 Xoo Xcv Xv Xp Xg
rpfB XC_2331 XOO2868 XCV1921 2934 0530 2948 rpfF XC_2332 XOO2869 XCV1920 2932 0528 2950 rpfC XC_2333 XOO2870 XCV1919 2930 0526 2952 rpfH XC_2334 Absent XCV1918 2928/2926* 0524 2954 rpfG XC_2335 XOO2871 XCV1917 2924 0522 2956
62
Table 2-11. Genes unique to Xp, grouped in clusters.
Locus tag in Xp/ Gene OID Distribution of flanking genes Function
Cluster 1- LPS cluster genes XPE_3787 to XPE_3795 Present in Xcv Lipopolysaccharide biosynthesis
cluster Cluster 2- Chemotaxis protein histidine kinase inactivated by transposase carrying 3 genes (in yellow) along with it in Xp. XPE_4460 In all 4 chemotaxis protein histidine kinase XPE_4461 In all 4 transposase XPE_4462 Fe-S oxidoreductase XPE_4463 XPE_4464 XPE_4465 In all 4 chemotaxis protein histidine kinase Cluster 3- Carrying unique genes in Xp not present in any plant pathogens XPE_1809 Transposase
XPE_1810 TIR-like domain, cyclic nucleic acid
binding domain XPE_1811 Hypothetical protein XPE_1812 Hypothetical protein XPE_1813 Hypothetical protein Cluster 4- avrXv4 and phage genes in the neighborhood Cluster 5- XopC from Xcv is replaced by other unique genes in Xp XPE_3067 present in 306 hypothetical protein XPE_3068 present in 306 hypothetical protein XPE_3069 XAC2120 XPE_3070 mdmC from Xac306 Predicted O-methyltransferase XPE_3071 not called in gene calling
in 306 Hypothetical protein
Cluster 6- Carrying bacteriocin genes XPE_0786 to XPE_0790 Cluster 7- flanked by phage integrase
XPE_2401 Predicted transcription regulator containing HTH domain
XPE_2402 Uncharacterized protein conserved in bacteria
XPE_2403 present in Xv XPE_2404
XPE_3894 plasmid mobilization system relaxase
XPE_3895 XCV1122
XPE_3896
52% hypothetical protein [Legionella pneumophila str. Corby] predicted ATPase
XPE_3897 hypo protein from Legionella XPE_3898 present in Xv, Xg XPE_3899 in Xv, XCV1116 XPE_3900 XccB100_3109 exonuclease VII
63
Table 2-11. continued
Locus tag in Xp/Gene OID Distribution of flanking genes Function Cluster 8- Upstream flanking genes are conserved in order in all xanthomonads; while downstream are transposase genes in Xcv.
XPE_3601 present in all xanthomonads
XPE_3602 XPE_3603 XPE_3604 XPE_3605 XPE_3606 XPE_3607 XPE_3608 XPE_3609 cluster 9- Flanking genes conserved in Xcv XPE_3366 XAUB_37550 95% hypothetical protein XPE_3367 XCV0352 XPE_3368 XCV0353
XPE_3369 no hit to any plant pathogen hypothetical protein
XPE_3370 no hit to any plant pathogen hypothetical protein
XPE_3371 no hit to any plant pathogen hypothetical protein
XPE_3372 no hit to any plant pathogen hypothetical protein
XPE_3373 no hit to any plant pathogen
Activator of Hsp90 ATPase homolog 1-like protein.
XPE_3374 no hit to any other plant pathogen hypothetical protein
Cluster 10- Upstream and downstream flanking genes present in Xcv
XPE_1376 no hit to any other plant pathogen
XPE_1377 No hit to any other plant pathogen
XPE_1378 no hit to any other plant pathogen
XPE_1379 no hit to any other plant pathogen
XPE_1380 EF-hand calcium binding protein Cluster 11- Upstream, downstream flanking genes also present in Xcv XPE_0135 XAC3183 Hypothetical protein XPE_0136 XAC3182 Hypothetical protein Cluster 12
XPE_0734 signal peptide, transmemb helices
XPE_0735 hypothetical protein
XPE_0736
Xccb100_0356, vasculorum and musacearum hypothetical protein
64
Table 2-11. continued
Locus tag in Xp/Gene OID Distribution of flanking genes Function
Cluster 13
XPE_2183 In Xoo
Type I site-specific restriction-modification system, R (restriction) subunit and related helicases
XPE_2187 Xoo Uncharacterized conserved protein
XPE_2190 Xoo Uncharacterized conserved protein
XPE_2192 Xoo
Type I restriction-modification system methyltransferase subunit
XPE_2194 Xoo
Type I site-specific restriction-modification system, R (restriction) subunit and related helicases
XPE_2195 Xoo, Xoc hypothetical protein
Table 2-12. Genes common to all pepper pathogens but absent from Xp.
Locus tag in Xcv85-10
Gene symbol Product name Evidence to be involved in pathogenicity/ virulence
Genes with the known functions XCV2278 Pectate lyase precursor XCV3713 wxcL Glycosyltransferase XCV3715 wxcN Putative membrane
protein involved in synthesis of cell surface polysaccharide
XCV3716 wxcO Putative carbohydrate translocase
Alavi, SM et. al., 2008 in X. fuscans – bean pathosystem and this study.
XCV3718 gmd GDP-mannose 4,6-dehydratase (EC: 4.2.1.47)
XCV3720 wxcB Putative protein kinase XCV3722 wzm O-antigen ABC
transporter permease
XCV4257 rpmB LSU ribosomal protein L28P
65
Table 2-12. continued
Locus tag in Xcv85-10
Gene symbol Product name Evidence to be involved in pathogenicity/ virulence
XCV1298 Type III effector (homolog of hopH1 from Pseudomonas syringae)
XCV1839 Hypothetical protein This study XCVc0007 kfrA KfrA protein XCV0510 hsdS1 Type I site-specific
deoxyribonuclease (specificity subunit)
XCV0513 hsdM1 Type I site-specific deoxyribonuclease (modification subunit)
XCV2820 Putative type IV pilus assembly protein PilV
XCV3312 Transcriptional regulator, AraC family
XCV2191 Putative DoxD-like family membrane protein
Genes coding for mobile genetic elements XCVb0012 Putative ISxac3
transposase (fragment)
XCVb0018 tnpR Tn5045 resolvase XCVc0040 Site-specific
recombinase/resolvase family protein
XCVd0025 ISxac3 transposase (fragment)
XCVd0071 Phage integrase family protein
XCVd0097 tnpA Tn5044 transposase XCVd0109 tnpR Tn5045 resolvase XCVd0115 Tn5044 traposase XCV0355 ISxac3 transposase XCV0619 Transposase XCV0706 ISxac3 transposase XCV1118 ISxac3 transposase XCV1553 Phage-related integrase XCV1698 ISxac3 transposase XCV1843 ISxac3 transposase XCV1848 Putative
integrase/recombinase
XCV2158 ISxac3 transposase XCV2217 Phage-related integrase
66
Table 2-12. continued Locus tag in Xcv85-10
Gene symbol Product name Evidence to be involved in pathogenicity/ virulence
XCV2261 Phage-related integrase XCV2263 ISxac3 transposase
(fragment)
XCV2273 Tn5044 transposase XCV2295 Putative ISxac3
transposase (fragment)
XCV2439 Tn5044 trasposase XCV2453 Filamentous phage Cf1c
protein
XCV2461 Filamentous phage phiLf related protein
XCV2474 Filamentous phage Cf1c protein
XCV2477 ISXac3 transposase XCV2484 Phage-related integrase XCV2615 Integrase XCV2690 ISxac3 transposase XCV2712 Putative transposase
(fragment)
XCV2867 ISxac3 trasposase XCV3384 ISxac3 trasposase XCV3397 ISxac3 trasposase XCV3410 ISxac3 trasposase Genes with function unknown XCVd0055 XCV0648 XCV1188 XCV1189 XCV1187 XCV1303 XCV1596 XCV1937 XCV2455 XCV2857 XCV2958 XCV3162 XCV3326 XCV3986 XCV4135 XCV4262 XCV4421
67
Table 2-13. Genes present in all four tomato and pepper pathogens but absent from all other sequenced xanthomonads.
Locus tag for Xcv85-10
Possible function Homolog present in any other genera GC content
XCV0623 Transposase 17 superfamily Hypo protein –COG belonging to transposase, inactive derivatives
In Stenotrophomonas, Acidovorax Xanthomonas campestris pv. musacearum NCPPB4381
0.59
XCV2641 Hypothetical protein X. c. musacearum and X. c. vasculorum (identity 37, 31% respectively)
0.65
XCV4416 Hypothetical protein Pectobacterium carotovorum X. fuscans pv. aurantifolii
0.57
XCV0615 Transposase 17 superfamily Hypothetical protein COG1943 (transposase, inactivated derivates)
Acidovorax, X. c. musacearum and X. c. vasculorum
0.62
XCV0112 COG4704 uncharacterized protein conserved in bacteria
Stenotrophomonas, X. c. musacearum and X. c. vasculorum
0.65
XCV0111 putative lignostilbene-alpha,beta-dioxygenase- phenylpropanoid compound degradation
Stenotrophomonas, Ralstonia, X. c. musacearum and X. c. vasculorum
0.66
XCV0041 putative penicillin amidase (fragment)
Ralstonia, X. c. musacearum and X. c. vasculorum
0.64
68
Figure 2-1. Maximum likelihood tree based on orthologous genes from xanthomonads
and Stenotrophomonas. Concatenated amino acid sequences of the orthologous genes from four bacterial spot pathogen strains along with other sequenced xanthomonads were considered in the analysis. Stenotrophomonas maltophilia was used as an outgroup. The evolutionary history was inferred using the Maximum likelihood method. The tree is drawn to scale, with branch lengths corresponding to the evolutionary distances. The evolutionary distances were computed using the Maximum Composite Likelihood method and are in the units of the number of base substitutions per site.
69
Figure 2-2. Comparison of type III secretion system cluster, its associated type III
effector genes and helper genes of three draft genomes with already sequenced xanthomonads. Type III secretion gene clusters in five strains are shown. Boxes of the same color indicate orthologous genes. Genes of special interest discussed in the paper are labeled. Xp has near identical hrp cluster as Xcv; Xv and Xg contain mosaic hrp cluster with organization and gene content similar to Xcc, but associated effectors are similar to Xcv along with novel effector gene associated with the cluster.
70
Figure 2-3. AvrBs2-based HR assay confirms translocation of novel effectors.
Hypersensitive response reaction indicating presence of translocation signal was recorded 24 hr after inoculation on pepper cv. ECW20R with candidate effectors xopZ2 (a), avrBs1 (b), xopG (d), xopAM (e), xopAO (f) conjugated in race 6 strain along with control race 6 strain (c). All the strains showed water-soaking on pepper cv. ECW after 48 hr after inoculation
71
Figure 2-4. Xylanase cluster organization. Three types of cluster organizations can be
found within xanthomonads. A) Found in Xac, Xcv and Xp containing three endoxylanase genes xyn10A, xyn10B and xyn10C; B) Found in Xcc, Xv and Xg containing two endoxylanases xyn10A and xyn10C; and C) Found in Xoo containing xyn10A and xyn10B within endoxylanase operon.
72
Figure 2-5. Schematic representation of type IV secretion system cluster common to Xp, Xv and Xg (Plasmid borne).
73
Figure 2-6. Schematic representation of type IV secretion cluster unique to Xg (plasmid borne).
74
Figure 2-7. Schematic representation of chromosomal type IV cluster organization in
Xcv, Xv, Xp and Xg.
75
Figure 2-8. The Structure and phylogeny of the LPS cluster. Schematic comparison of
LPS gene clusters described in the present study. Genes conserved in different strains are given identical color. Genes specific to individual strains are given unique color. “Hpo pro” indicates an ORF encoding for a hypothetical protein. The red color-coded genes in Xp genes are absent in any of the sequenced xanthomonads.
76
Figure 2-9. Pepper specificity genes increasing in planta growth of Xp. In planta growth
of PM1 transconjugants (combined 2 [XCV1839+wxcO]; combined 3 [XCV1839+wxcO+xopG]); PM1 and pepper virulent strain pepper race 6 represented in log (CFU/cm2 of leaf tissue) at 0, 2, 4, and 6 days post inoculation.
77
Figure 2-10. Correlation between phylogenies based on Multi-Locus Sequence Typing (MLST) core genome and pathogenicity clusters: Concatenated amino acid sequences of the six genes fusA, gapA, gltA, gyrB, lacF, lepA from four bacterial spot pathogen strains along with other sequenced xanthomonads are considered in the analysis. The evolutionary history was inferred using the Neighbor-Joining method. The percentage of replicate trees in which the associated taxa clustered together in the bootstrap test (1000 replicates) is shown next to the branches. The tree is drawn to scale, with branch lengths in the same units as those of the evolutionary distances used to infer the phylogenetic tree. The evolutionary distances were computed using the Maximum Composite Likelihood method and are in the units of the number of base substitutions per site. Phylogenetic analyses were conducted in MEGA4.
78
CHAPTER 3 AVIRULENCE PROTEINS AVRBS7 FROM XANTHOMONAS GARDNERI AND
AVRBS1.1 FROM XANTHOMONAS EUVESICATORIA ELICIT HYPERSENSITIVE RESISTANCE RESPONSE IN PEPPER
Background
Bacterial spot of tomato and pepper is a disease leading to significant yield loss
(Pohronezny and Volin 1983). Based on the current classification, there are four
genetically distinct groups of xanthomonads infecting tomato and pepper. These have
been named as Xanthomonas euvesicatoria, X. vesicatoria, X. perforans and X.
gardneri (Jones et al. 2000, 2004). These groups are sufficiently different to be
assigned to different species (Jones et al. 1998, Bouzar et al. 1999).
Chemical control strategies such as sprays of copper/ streptomycin have not
significantly helped control of the disease (Bouzar et al. 1999). Efforts have been
focused on breeding for resistance in tomato and pepper cultivars. Five resistance
genes namely, Bs1, Bs2, Bs3, Bs4 and BsT have been identified so far in pepper giving
a hypersensitive type of resistance with the corresponding avr genes from the pathogen
being characterized (Stall et al. 2009). Two recessive resistance genes, bs5 and bs6,
leading to non-hypersensitive type of resistance confer quantitative, or multigenic
resistance that has been shown to be more durable (Stall et al. 2009). Screening for
novel resistance genes continues to be important since the pathogen evolves to
selective pressure.
Plant pathogenic xanthomonads possess a type III secretion system (T3SS),
encoded by a hypersensitive response and pathogenicity (hrp) cluster (Bonas et
al.1991). Effector proteins are secreted through the T3SS. They interfere with host
immunity and manipulate host cellular processes (Buttner and He 2009, Grant et al.
79
2006). Avirulence proteins are type III effectors that are recognized in particular host
genotypes by plant R gene products. Many avirulence proteins have been characterized
and in some cases, the mechanism of R-gene interaction has been studied. In the
absence of the corresponding R gene, avr proteins/ effectors act as virulence factors
contributing to susceptibility (Kjemtrup et al. 2000). Avirulence genes have also been
studied for their contribution to pathogen evolution. A classic example is AvrBs2 eliciting
resistance in pepper containing Bs2. AvrBs2 is known to have an enzymatic function,
required for virulence activity. Pathogens have evolved in such a way that mutations in
avrBs2 retain enzyme activity but lose recognition by Bs2. In particular, mutants with
single base changes at nucleotide site 1386 resulted in loss of recognition by Bs2
without a loss in aggressiveness (Gassmann et al. 2000).
Materials and Methods
Plant Material and Plant Inoculations
Several Capsicum genotypes were collected by Rosana Rodrigues in Brazil and
screened for resistance against races of the bacterial spot xanthomonads.
Pepper (Capsicum annuum L.) cv. Early Calwonder (ECW), its near-isogenic line
ECW-70R, F1 cross (ECW-70R × ECW), two hundred and twenty-five F2 plants, and
backcrosses [(ECW-70R × ECW) × ECW-70R; (ECW-70R × ECW) × ECW] were grown
in the greenhouse. Inoculated plants were kept in a greenhouse under a 26oC during 12
hr light and 15oC, 12 hr dark cycle. Plants were observed for 48 hr following inoculations
for development of HR/ watersoaking symptoms.
A four to five cm2 area of fully expanded leaves was infiltrated using a hypodermic
needle and syringe with bacterial suspension adjusted to 108 CFU/ml (Hibberd et al.
1987). All experiments were carried out in three replicates.
80
Bacterial Strains, Plasmids and Media
Bacterial strains and plasmids used and developed in this study are listed in Table
3-1. All Xanthomonas strains were grown at 28oC on nutrient agar (NA) plates. The
cultures were suspended in sterile tapwater and the optical density (O.D.) at 600 nm
was adjusted to 0.3 with a spectrophotometer (Spectronic 20, Spectronic UNICAM,
U.S.) for plant inoculations. E. coli strains or transformants were grown at 37oC on
Luria-Bertani agar/broth (Maniatis et al. 1982) amended with appropriate antibiotics.
Protocols for ligation of plasmids and transformation into E. coli DH5α were according to
Maniatis et al. (1982). These plasmids were mobilized from E. coli into Xanthomonas
recipient strains by triparental mating with the aid of pRK2073 helper plasmid (Ditta et
al. 1980; Figurski and Helinski 1979). After incubating the matings on NYG agar at 28oC
overnight (Daniels et al. 1984), the growth was suspended in 2 ml sterile tapwater and
plated on NA plates containing appropriate antibiotics. The resulting transconjugants
were then grown to obtain pure cultures. Antibiotics used in following final
concentrations: ampicillin 125 μg/ml; kanamycin 50 μg/ml; rifamycin 100 μg/ml;
spectinomycin 50 μg/ml; and tetracycline 12.5 μg/ml. All strains and constructs were
stored in 20% glycerol stocks at -80oC.
Library Preparation and Isolation of Clone with Avirulence Activity
A genomic library of X. gardneri Xv444 was constructed in E. coli using the cosmid
vector pLAFR3 following the protocol as described earlier (Staskawicz et al. 1987;
Minsavage et al. 1990). Individual clones were mobilized by triparental mating into
recipient X. gardneri Xg51, a strain virulent on pepper cv. ECW-70R. Transconjugants
were inoculated into the leaves of pepper cv. ECW-70R to screen for the clone eliciting
a hypersensitive response (HR). A cosmid clone, pXv444-352, containing a 20 kb insert
81
gave an HR on ECW-70R. This clone was selected for further subcloning. A 5kb
BamHI- BamHI DNA fragment subclone from the pXv444-352 clone was transferred into
pBlueScript (Stratagene, CA). This 5 kb subclone pXv444-352Bam8 was sequenced at
the ICBR (Interdisciplinary Center for Biotechnology Research) sequencing facility
(University of Florida, Gainesville, FL) with the Applied Biosystems (Foster city, CA)
model 373 system. Further subcloning of the pXv444-352Bam8 clone was achieved
using restriction enzymes BamHI, EcoRI and PstI. The digestion products were tested
for HR in leaves of pepper cv. ECW-70R by cloning them into pLAFR3 and by
mobilization into recipient strain Xg51.
Deletion Mutant Construction
An in-frame deletion of the coding region of avrBs7 in the vector pGEMT-easy was
carried out. PCR primers were designed in the outward directions to create the deletion
and to add BamHI restriction enzyme sites. The PCR product was purified and digested
with BamHI. After re-ligation and transformation into E.coli DH5α, a clone lacking the
complete ORF of avrBs7 and containing only flanking regions of avrBs7 was chosen.
The deletion was confirmed by sequencing the insert in pGEMT-easy vector. The ORF-
deleted fragment of the gene with flanking regions was excised from pGEMT-easy and
cloned into the suicide vector pOK1. This deletion mutant gene was conjugated into
XV444 using homologous recombination as previously described and mutants were
identified by PCR (Huguet et al. 1998).
Bacterial Population Dynamics in Infiltrated Leaf Tissue
Internal bacterial populations were determined at selected time intervals after
inoculation. Xanthomonas culture suspensions (wild type, mutant, recipient carrying avr
clones) were diluted to a concentration of 105 CFU/ml using sterile tapwater and then
82
infiltrated into the leaves of the parental lines of pepper cvs. ECW-70R and ECW. The
inoculated plants were incubated in the growth room maintained at 15oC-26oC (12 hr
dark/light period) for 8 days. Leaves were sampled every 48 hr. An area of 1cm2 of leaf
tissue was cut from the infiltrated area using a sterile cork-borer. Using sterile forceps
the leaf disk was then placed into a sterile tube containing 1ml sterile tapwater and
triturated. Standard 10-fold dilution plating onto NA plates was carried out and plates
were incubated at 28oC for three days. Colonies were then counted and the bacterial
populations were calculated as cfu/cm2 of leaf area.
Determination of Electrolyte Leakage from Infiltrated Leaf Tissue
The amount of tissue damage after inoculation of leaves with the different
Xanthomonas strains listed above was estimated to assess necrosis by quantifying
electrolyte leakage as described previously (Cook and Stall 1968). Leaves were
infiltrated with bacterial suspensions adjusted to 108 CFU/ml (O.D at 600nm = 0.3).
Inoculated plants were kept in the growth room at 26oC during 12 hr light period and
15oC during 12 hr dark period. Electrolyte leakage was expressed as the increase in
conductivity [calculated by difference in the two readings (measured in μmhos)] per hour
at 28oC.
Site Directed Mutagenesis of avrBs7
Catalytic site residues of avrBs7 were mutated to alanine by a PCR-mutagenesis
approach using primers designed as follows: Avr1.1AlaF 5’
GCGCTAGCGGCCGCCGCAGCCACATGCAGCCT 3’ and Avr1.1AlaR 5’
GCGCTAGCGCAGCTGCAGCCATCTTCATTGCT 3’. Both primers had NheI overhangs
at the 5’end. pGEMT-easy:avrBs7 was used as template for mutagenesis PCR. The
amplified PCR product was purified using the Qiagen spin kit and subsequently
83
digested with NheI enzyme. The digested product was re-ligated and transformed into
E. coli DH5α. The mutated gene construct was then moved to the Xanthomonas
compatible plasmid pLAFR3. The pLAFR3 clone was then mobilized into two recipients,
Xg51 and X. euvesicatoria TED3 by tri-parental mating. A similar protocol was followed
for the single amino acid mutation (Cys to Ser) within the catalytic site of avrBs7, with
the following primer set. CysmutF1 5’ GCGGTGCACTCAGGGGTCGGCCA 3’ and
CysmutR1 5’ GCGGTGCACATGCAGCCTCTCAT 3’.
Sequence Analysis and Protein Homology Modeling
Sequence analysis was carried out using several programs including blast
(Altschul et al. 1997) and pfam (Finn et al. 2010).
Results
Identification of Resistance in Pepper against Bacterial Spot Xanthomonads and Development of Introgression Lines Carrying the Resistance Gene
Several Capsicum genotypes were collected in Brazil and were tested for HR
against races of Xanthomonas euvesicatoria. One genotype gave an HR when
inoculated with races 1, 2, 3 and 6. This line had been designated as 1556 and was a
member of Capsicum chinense. The fruit of this line was of the elongated chili type and
pungent. Since this line appeared to have broad resistance to different races of the
bacterial spot xanthomonads, crosses were made with Capsicum annuum cultivar Early
Calwonder (ECW) for the purpose of transferring the resistance to a plant with bell-
shaped, nonpungent fruit.
Since the first cross was interspecific, only a few seeds were obtained. Some of
the seeds germinated and a few plants of a F2 population were obtained after self-
pollinating a F1 plant. Segregation of resistance in the F2 population seemed to occur,
84
but the inheritance of the resistance could not be obtained because of the low number
of plants. It was then decided to transfer the resistance via a backcross program to a
recurrent susceptible parent (ECW). Plants in each bcF1 generation were screened for
resistance to Xv444, which provided a strong HR in resistant plants. In a third
backcross, F1 plants were male sterile, but female fertile. Instead of pollination of
susceptible parent plants, as was done previously in the backcross procedure,
pollination of resistant plants with pollen from a susceptible plant was necessary. In the
next generation, a plant that was resistant to Xv444 and male fertile was identified. All
future backcrosses were based on this plant and were always male fertile. Eventually a
population of plants in the 7th backcross was obtained that did not appear to have the
fertility problems present in the early population of the interspecific cross and was
uniform in resistance. A population in the 7th bcF4 was used to determine the inheritance
of the resistance gene, designated as Bs7, the cultigens referred to here as pepper cv.
ECW-70R.
AvrBs7 from Xv444 Elicits HR in Pepper cv. ECW-70R.
Among the different strains of the bacterial spot pathogens tested on pepper cv.
ECW-70R, Xv444 was found to elicit a strong HR. An avirulence gene corresponding to
the R gene i. e. Bs7 was isolated by mobilizing clones in pLAFR3 from a genomic DNA
library of Xv444 into Xg51, a strain virulent on ECW-70R, by conjugation. A
transconjugant carrying subclone pXg-352Bam8 elicited HR in ECW-70R. Further
subcloning of this 5 kb insert into pLAFR3 using BamHI, PstI and EcoRI restriction
enzymes resulted into three subclones of 1kb, 1.8kb and 2 kb. None of the subclones
elicited an HR on pepper cv. ECW-70R. Sequence analysis of the clone showed that
there was one ORF spanning the region cut by the restriction enzymes used to
85
generate two subclones. This ORF with 500 bps of upstream sequence was cloned by
PCR (Primers: avrBs1.1F : 5’ CAAGGTGGTGATGGACATGG 3’and avrBs1.1R: 5’
GTTGTCACCGCCGACAAGTT 3’) individually in the pGEMT-easy vector and the insert
was confirmed by sequencing. The insert was then transferred to pLAFR3 and
conjugated into Xg51. Transconjugants carrying this insert exhibited a strong HR similar
to the wild type Xv444 strain by 24 hr after infiltration (Figure 3-1). This ORF was named
avrBs7. It consists of 1071 bps encoding a 356 amino acid protein of 39.734 kDa. It
shows 67% sequence identity at the amino acid level to avrBs1.1 (XCVd0105) from Xcv
str. 85-10, whose genome was sequenced previously. The possibility that avrBs1.1 from
Xcv str.85-10 was responsible for HR when infiltrated into leaves of ECW-70R was
pursued experimentally.
AvrBs1.1 from Xcv str 85-10 Elicits Delayed HR on ECW-70R.
The avrBs1.1 gene with 500 bps of upstream sequence was cloned by PCR
(8510-Bs1.1F: 5’ CGTTTCTACGACAGCACCAA 3’; 8510-Bs1.1R: 5’
CCTCTTGGGGGTTTGAAAAT 3’) into pLAFR3 and conjugated in Xg51.
Transconjugants carrying avrBs1.1 produced a weak HR by 32 hr post inoculation and,
a strong HR was observed by 48 hr (Figure 3-2). The susceptible reaction due to Xg51
was first observed at 72 hr.
Genetic Analysis of Bs7 Resistance in ECW-70R
Genetic segregation of resistance was analyzed by inoculating an F2 population
with Xg51 transconjugants carrying the avrBs7 clone and Xg51 transconjugants
carrying the avrBs1.1 clone. The two clones were also introduced into the Xcv TED3
race 6 background and tested for their phenotype on the F2 population.
86
A total of 166 F2 plants were infiltrated with Xg51 transconjugants carrying the
avrBs7 clone. They were scored for HR or susceptibility at 48 hr post inoculation. One
hundred and seventeen plants (70.5%) developed an HR and 49 (29.5%) exhibited a
water-soaking phenotype. Analysis of segregation ratio showed a fit to 3:1 ratio (χ2 =
1.80; P value between 0.2 and 0.1; p value greater than 0.05), confirming that the
resistance trait was inherited as a single dominant resistance gene. However, when the
avrBs7 clone was introduced into Xcv TED3, there were more susceptible plants than
expected in another F2 population. Out of a total 59 F2 plants tested, 24 plants (40%)
were susceptible, showing χ2 = 7.93 and a p value between 0.01 and 0.001, showing
the close fit to the only Mendelian segregation ratio of 3:1out of all other segregation
ratios.
In the case of Xg51 transconjugants carrying the avrBs1.1 clone when infiltrated
into ECW-70R, the F2 population exhibited 71 resistant (66%) plants and 36 (34%)
susceptible plants, giving an χ2 value of 4.264 with the p value slightly lower than 0.05.
The same avr gene when introduced into Xcv TED3 race 6 and inoculated in the leaves
of 59 F2 plants yielded 40 resistant (68%) plants and 19 susceptible (32%) plants, with
the χ2 value of 1.63 and p value between 0.3 and 0.2. This indicated a good fit to a 3:1
Mendelian segregation ratio.
In a backcross of an F1 plant with ECW-70R, both avrBs7 and avrBs1.1 clones
inTED3 caused an HR. Hence we can speculate that AvrBs1.1 might react with the BS7
R gene itself or possibly with another resistance gene closely linked to Bs7.
87
In-Planta Growth Studies and Electrolyte Leakage
Growth of wild type and individual avr clone transconjugants along with deletion
mutants was examined by measuring CFU/cm2 of inoculated leaf tissue. By 6 days
inoculation, Xg51 carrying the avrBs7 clone increased in population size by
approximately 3 log, while Xg51 carrying the avrBs1.1 clone showed 0.5 log more
growth than the avrBs7 clone and then growth ceased to increase. The wild type
virulent strain Xg51 increased up to 4 log by 8 days post inoculation (Figure 3-3A). Wild
type Xv444 showed approximately 2.5 log increase in growth by 6 days post inoculation
and stayed at the same level afterwards, whereas, deletion mutant Xv444 ∆avrBs7 grew
2 log more compared to wild type Xv444 by day 6 post-inoculation (Figure 3-3C). In
summary, strains carrying avr genes grew significantly less compared to strains lacking
the avr genes and Xg51 transconjugants carrying avrBs1.1 exhibited more in planta
growth compared to Xg51 transconjugants carrying avrBs7 (Figure 3-3A).
The rapidity of tissue damage in the inoculated leaf tissue was measured by
electrolyte leakage. There was no significant difference between Xg51 carrying avrBs7
or carrying avrBs1.1 compared to Xg51 wild type at 12 hr after inoculation (Figure 3-
4A). Similarly, no difference was observed between Xv444 and Xv444 ∆avrBs7 at 12 hr
post-inoculation (Figure 3-4B). However, electrolyte leakage in tissue inoculated with
Xg51 carrying avrBs7 increased significantly in the following 36 hr, showing peak at 48
hr and then began decreasing. For Xg51 carrying avrBs1.1, electrolyte leakage started
increasing slowly after 12 hr with a peak at 60 hr after inoculation. There was a
difference in the extent and speed of tissue damage between avrBs7 and avrBs1.1
clones. Significant differences in tissue damage between the Xg51 virulent strain
lacking avr genes and those carrying avr genes were observed (Figure 3-4A).
88
Electrolyte leakage of Xv444 and Xv444 ∆avrBs7 did not show difference after the first
12 hr but leakage showed a sudden increase for Xv444 in the next 24 hr, showing a
peak at 36 hr after inoculation, while that caused by Xv444 ∆avrBs7 remained almost
unchanged at 36 hr post-inoculation. In the last 12 hr, tissue damage caused by Xv444
∆avrBs7 started to increase and that by Xv444 remained constant or started to drop
(Figure 3-4C).
A Catalytic Tyrosine Phosphatase Domain Might be Responsible for Recognition by the BS7 R Gene Product in ECW-70R.
Sequence analysis of both avr genes showed the presence of a tyrosine
phosphatase domain in the C-terminal region. AvrBs7 belongs to classical pTyr-specific
protein tyrosine phosphatases (PTPs) (pfam family Y_phosphatase PF00102).
AvrBs1.1contains a dual specificity phosphatase domain (pfam family DSPc PF00782),
indicating its ability to dephosphorylate Ser/Thr phosphate containing proteins in
addition to Tyr phosphate containing proteins.
Mutation of the catalytic domain (HCGVGQGRTG) in avrBs7 to Alanine residues
abolished HR activity of Xg51 carrying the avrBs7 clone (Figure. 3-5) Mutation of Cys
residue to Ser residue in catalytic domain of tyrosine phosphatase is known to abolish
the enzyme activity (Espinosa et al. 2003). Xg51 transconjugant carrying avrBs7 (Cys265
→Ser) clone failed to exhibit HR on ECW-70R. This implies that tyrosine phosphatase
activity of the AvrBs7 avirulence protein might be contributing towards recognition by
Bs7 gene transcripts inside the plant cell.
Blastp search using avrBs7 and avrBs1.1 as query showed hits with effectors from
other plant pathogens. Some effectors from other xanthomonads and from other genera
of plant pathogens also possess tyrosine phosphatase activity, specifically dual-
89
specificity phosphatase activity. Xanthomonas campestris pv. campestris str. 33913
along with Xcc str. 8004 and Xcc str. B100 encode avrBs1.1 effector. Effector avrBs1.1
has been classified as xopH according to the recent classification of xop effectors
(White et al. 2009). Pseudomonas syringae pv. tomato str. DC3000 encodes the
HopAO1 effector (HopPtoD2) which has been shown to suppress programmed cell
death in Nicotiana bentamiana, suggesting its role as virulence factor interfering with
MAPK pathway and downstream defense pathway (Espinosa et al. 2003). Similar to
AvrBs7, also effector HopAO1 belongs to Y-phosphatase pfam family. Acidovorax citrulli
AAC00-1 contains another homolog, Aave_3502 with a dual-specificity phosphatase
domain.
There is Difference in the Timings of HR Elicitation by AvrBs7 and AvrBs1.1.
Xg51 transconjugants carrying avrBs1.1 show a delayed HR compared to Xg51
transconjugants carrying the avrBs7 clone. This phenotype was also confirmed by
higher population growth by day 6 and slower tissue damage in case of Xg51 carrying
avrBs1.1 compared to avrBs7. We were interested why avrBs1.1 causes a delayed HR.
As mentioned above, avrBs7 encodes a conserved catalytic domain for tyrosine
phosphatase (HCGVGQGRTG), whereas, avrBs1.1 is predicted to encode a dual
specificity phosphatase (HCGMGLGRTT) based on pfam domains. Our hypothesis was
that the difference in the timings of tissue damage and HR is due to differences in the
amino acid residues at the catalytic domain. We aligned AvrBs7 and AvrBs1.1 using
clustalw (Figure 3-6). We fused the N terminal 262 amino acids of AvrBs7 (just
upstream of catalytic domain) to the C terminal of AvrBs1.1 containing catalytic domain
of AvrBs1.1, in turn replacing catalytic domain of AvrBs7 with that of AvrBs1.1.
Exchanging the catalytic domain of AvrBs7 with the catalytic domain of AvrBs1.1
90
abolishes the hypersensitive response of AvrBs7 on ECW-70R (Figure 3-7). According
to our hypothesis, if the difference between AvrBs7 and AvrBs1.1 was only at the
catalytic domains, replacement of AvrBs7 catalytic domain by that of AvrBs1.1 would
have altered hypersensitive response of AvrBs7 by delaying it similar to AvrBs1.1,
instead of complete loss of HR. However, several explanations can be given for this
result. Either this fusion protein might have become inactive due to modification in
tertiary structure or replacement of catalytic residues in AvrBs7 makes it no longer
capable of recognizing the R gene.
Avirulence Proteins AvrBs7 and AvrBs1.1 Display Similar Tertiary Protein Structure.
Although AvrBs7 shows only 67% identity to AvrBs1.1 at the amino acid level, the
tertiary structure of the respective Avr proteins were similar to each other when
predicted by homology modeling (Figure 3-8). Except for the first 50 amino acids (blue
helix fragment), within which a motif for 14-3-3 ligands is found, appears to be different
between AvrBs7 and AvrBs1.1. That motif along with an APCC-D box motif, are the only
differences between the two avr proteins when the motifs are compared. The catalytic
domain is highlighted in the 3-D structures by pink dots (Figure 3-8).
Host Specificity of Bacterial Spot Strains
Different strains belonging to the groups A, B and D of bacterial spot
xanthomonads were tested for their phenotype on ECW-70R (Table 3-1). The C group
(X. perforans) is not pathogenic on pepper (Astua-Monge et al. 2000a). HR was
classified into types- strong HR after 24 hr (as seen for avrBs7) and delayed HR after
48 hr (as seen for avrBs1.1).
91
We also developed avrBs7 specific primers and avrBs1.1 specific primers to
identify the type of avr gene in the strains. PCR amplification results correlated well with
the phenotype observed after infiltration, thus classifying strains into those carrying
avrBs7 and those carrying avrBs1.1.The avirulence gene avrBs7 was exclusively limited
to X. gardneri strains (D group). Gene avrBs1.1 was found in X. euvesicatoria (A group)
and X. vesicatoria (B group) strains. X. vesicatoria strain Xv1111, for which the draft
genome has been already sequenced (Potnis et al. 2011), also has avrBs1.1 but with
an internal stop codon. Thus, the avr gene in this strain is inactive and the strain
escapes detection by R gene in ECW-70R. There were strains in each group that did
not contain the avr gene.
Avr Genes avrBs7 and avrBs1.1 are Encoded on a Large Transmissible Plasmid.
The cosmid clone p352-Bam8, from which avrBs7 was isolated, contained
marginal regions showing identity to avirulence gene avrHah1 (Schornack et al. 2008).
The J1 mutant of Xv444, a strain cured of the plasmid encoding AvrHah1, showed a
watersoaking phenotype by 3 days after infiltration of ECW-70R (Figure 3-2). This
indicates that the two avirulence genes avrBs7 and avrHah1 are encoded on the same
plasmid in Xv444.
The gene avrBs1.1 from Xcv85-10 is encoded on plasmid pXCV183, upstream of
avirulence gene avrBs1 (Thieme et al. 2005). Some of the X. euvesicatoria strains,
tested for phenotype on ECW-70R, are also known to carry copper resistance plasmid.
Correlation was found in copper resistance and avrBs1.1 phenotype.
Concluding Remarks
A broad resistance was initially found in pepper Capsicum chinense against
several strains of bacterial spot xanthomonads. Since fruits were elongated and
92
pungent, the resistance was transferred to another species Capsicum annuum cv. Early
Calwonder (ECW). Such interspecific crosses have been carried out in the past for
resistance gene transfer (Cook and Guevara 1984; Astua-Monge et al. 2000a). The
resistance gene segregated in several backcrosses and a population in the 7th
backcross was referred to as ECW-70R, which was used to determine genetic
inheritance of resistance. Segregation analysis of the F2 population identified a gene-
for-gene interaction for avrBs7 avirulence gene from Xv444 and corresponding R gene
Bs7 from pepper cv. ECW-70R, similar to gene-for gene model explained by Flor
(1971). Xcv str. 85-10 elicits delayed HR on ECW-70R. The segregation of resistance
genes in an F2 population was identical after inoculation with Xv444 and Xcv85-10. The
corresponding avr genes in Xv444 and Xcv str. 85-10 have been isolated and
characterized. The avr gene from Xv444 has been referred to as avrBs7, while Xcv str.
85-10 gene was referred to as avrBs1.1 as previously named. Further experiments such
as bacterial population dynamics and electrolyte leakage (Cook and Stall 1968) were
carried out to confirm that these avirulence genes elicit HR in ECW-70R.
Avirulence genes with enzyme activity have been characterized in xanthomonads
(Kearney and Staskawicz 1990, Mudgett et al. 2000). Here we present evidence of
another avirulence gene possessing enzyme activity, which is required for elicitation of
HR. Although avrBs7 and avrBs1.1 share only 67% identity at amino acid level, they
have a common characteristic, both belong to the tyrosine phosphatase superfamily.
The carboxy-terminal of both avirulence genes contains a consensus PTP active site
domain (HCGVGQGRTG for avrBs7 and HCGMGLGRTT for avrBs1.1) along with
possible general acid motif (TVTDH) 24 amino acids upstream. Alanine mutagenesis
93
around catalytic residues in avrBs7 as well as Cys265 →Ser mutant within catalytic
residues in avrBs7 failed to elicit an HR on ECW-70R, so the catalytic domain appears
to be important in recognition of the avr protein by R gene transcripts. Characteristic
phosphotyrosine recognition region and the immediately following arginine and aspartic
acid residues which make H bonds to an acidic side chain and main chain (Fauman and
Saper 1996) were located in the two avr protein sequences. Sequence YDR at position
81, 82 and 83 of AvrBs7 represents a possible recognition loop of PTPs.
Tyrosine phosphatases have been found as type III effectors in animal as well as
plant pathogens. They have been shown to interfere with the host signal transduction
pathways, thus functioning as virulence factors. Yersinia pseudotuberculosis secretes
type III effector YopH, classic PTPase family protein. YopH, in activated form,
dephosphorylates p130Cas and FAK substrates and thus resists its upstake by the host
mammalian cells (Persson et al. 1997). Similarly, Salmonella type III effector SptP
possesses tyrosine phosphatase activity which increases pathogen replication by
dephosphorylating host AAA+ ATPase VCPs (Humphreys et al. 2009).
Pseudomonas syringae pv. tomato DC3000 contains HopPtoD2 i.e. HopAO1 type
III effectors, which is a chimeric protein with N terminal region similar to avrPphD
hooked onto tyrosine phosphatase containing C terminal region. AvrPphD from
Pseudomonas syringae pv. phaseolicola elicits non-host HR on pea (Arnold et al. 2001).
Various hopPtoD alleles have been found in pseudomonads. In contrast to AvrPphD,
HopPtoD2 acts as a virulence factor targeting step downstream or independent of
MAPK, suppressing plant innate immunity (Bretz et al. 2003; Underwood et al. 2007).
94
The difference in the timing of HR elicitation was observed between the
transconjugants carrying the avrBs7 clone and those carrying avrBs1.1 clone. The
avrBs1.1 clone, along with wild type Xcv str. 85-10 elicited HR 48 hr after infiltration. To
explain this difference between the two clones, we compared amino acid sequences of
the two clones. Avirulence gene AvrBs7 shares 67% identity with AvrBs1.1 at amino
acid level. There are few amino acid differences within and around the catalytic site.
Hence, we hypothesized that these amino acid differences within and around the
catalytic site could be the reason for the differences in HR timing due to differential
activation of R gene. We constructed a fusion protein containing 262 N terminal amino
acids of AvrBs7 fused to 90 C-terminal amino acids of AvrBs1.1, thereby exchanging
AvrBs7 catalytic site with AvrBs1.1 catalytic site. Exchanging catalytic domains did not
change the timing of HR elicitation. HR activity was completely lost when the fusion
construct was infiltrated into ECW-70R leaves. There are two possibilities. Either fusion
protein was modified in its three dimensional structure and became inactive, or
AvrBs1.1 has different substrate specificity than AvrBs7. If the latter is true, AvrBs1.1
might be interacting with the different proteins within plant cell and might be activating
the resistance gene transcripts by a different pathway or might be activating another
linked resistance gene transcripts. Comparison of three-dimensional structures of
AvrBs7 and AvrBs1.1 did not show significant differences in the two structures.
In summary, we have identified a gene-for-gene interaction in the Xanthomonas -
pepper system in addition to five already identified gene-for-gene interactions (Stall et
al. 2009). Avirulence gene avrBs7 has been found to be restricted to D group X.
gardneri strains, while its ortholog avrBs1.1 is distributed among A and B group strains.
95
Both avr genes are plasmid-borne. Future research on differences in the activation of
resistance by AvrBs1.1 and AvrBs7 will contribute to our understanding of the
mechanism of activation of this broad resistance. Studying the possible motifs in
avirulence proteins will shed light into their possible role in pathogen virulence.
96
Table 3-1. List of bacterial strains and plasmids used in this study Strain designation Relevant characteristics Source or reference
Xanthomonas euvesicatoria 85-10 Pepper race 2, tomato race 1, Rifr Minsavage et.al. 1990 TED3 Pepper race 6
E3 CuR, HR(+) ECW 70R, avrBs1.1(+) R. E. Stall (Florida, 1960) Xv718 CuR, HR(+) ECW 70R, avrBs1.1(+) .Jones (Puerto Rico 1991) Xv881 CuS, HR(-) ECW 70R, avrBs1.1(-) Jones (Mexico, 1992) Xv669 CuS, HR(-) ECW 70R, avrBs1.1(-) Jones
Xv1025 CuR, HR(-) ECW 70R, avrBs1.1(-) Jones (Mexico, 1992) Xv818 CuS, HR(-) ECW 70R, avrBs1.1(-) Jones
Xanthomonas gardneri
Xg51 HR(-) ECW 70R, avrBs7(-) Minsavage, unpublished Xv444 HR(+) ECW 70R, avrBs7(+) Jones et.al., 2004
Xv444 ∆avrBs7 Xv444, avrBs7 deletion mutant This study J1 Mutant strain of Xv444 cured of the
plasmid carrying avrHah1 Schornack, et.al., 2008
XV1927 (BSX104A) HR(+) ECW 70R, avrBs7(+) D. Cuppels, AAFC London; ON, Canada
ENA4035 HR(-) ECW 70R, avrBs7(-) Rosana Rodrigues 01T46A HR(+) ECW 70R, avrBs7(+) Jones 02T1A HR(+) ECW 70R, avrBs7(+) Jones 04T5 HR(+) ECW 70R, avrBs7(+) Jones
98T3A HR(-) ECW 70R, avrBs7(-) Jones 00T12B HR(-) ECW 70R, avrBs7(-) Jones 99T4A HR(-) ECW 70R, avrBs7(-) Jones 1782 HR(+) ECW 70R, avrBs7(+) Brazil 1783 HR(+) ECW 70R, avrBs7(+) Brazil
Furman 3 HR(+) ECW 70R, avrBs7(+) Minsavage XV451 HR(+) ECW 70R, avrBs7(+) Jones
XV1194 HR(-) ECW 70R, avrBs7(-) Jones
Escherichia coli DH5α F-recAΦ80dlacZ∆M15 Bethesda Research
Laboratories, Gaithersburg,MD
λPIR Host for pOK Huguet et.al., 1998
Plasmids pLAFR3 Tcrrlx+RK2 replicon, Tcr Staskawicz et.al., 1987
pBlueScript II KS +/- Phagemid sequencing vector, Apr Stratagene, La Jolla, CA pRK2073 Spr Tra+, helper plasmid Figurski and Helinski 1979
97
A B
Figure 3-1. Phenotype observed in leaves of ECW-70R 48 hr after infiltration with
bacterial suspesions (adjusted to 108 cfu/ml) A) Xv444, and B)Xg51
98
Figure 3-2. Phenotype on ECW-70R 24 hr and 48 hr post-infiltration by wild type strains, transconjugants and mutants infiltrated with suspension adjusted to 108 cfu/ml. Order of inoculation as follows (counterclockwise from top left): 1. Xg51 (pLAFR3: avrBs7); 2 Xg51 (pLAFR3: avrBs1.1); 3 Xv444 ∆avrBs7 mutant; 4.Xg51.
99
A B
C D
Figure 3-3. Time course of bacterial population growth after infiltration of leaves of
pepper genotypes ECW and ECW-70R with suspensions (adjusted to 105 cfu/ml) of Xg51 transconjugants and mutant strains. A) and C) In planta growth in ECW-70R and B) and D) In planta growth on ECW; Transconjugants used in A) and B) are – diamond shape-Xg51 transconjugants carrying pLAFR3 clone; square shaped- Xg51 carrying avrBs7 clone; triangle – Xg51 carrying avrBs1.1 clone. Wild type and mutants used in C) and D) are- square shaped: Xv444 wild type; cross : Xv444 ∆avrBs7 mutant.
3
4
5
6
7
8
9
0 2 4 6 8
Log 1
0(C
FU/c
m2 )
Days after infiltration
ECW-70R
3
4
5
6
7
8
9
0 2 4 6 8
Log 1
0(CF
U/c
m2 )
Days after infiltration
ECW
3
4
5
6
7
8
9
10
0 2 4 6 8
Log 1
0(C
FU/c
m2 )
Days after infiltration
ECW-70R
3
4
5
6
7
8
9
10
0 2 4 6 8
Log 1
0(C
FU/c
m2 )
Days after infiltration
ECW
100
A B
C D
Figure 3-4. Electrolyte leakage from pepper genotypes ECW-70R (A and C) and ECW
(B and D) after infiltration of leaves with suspensions adjusted to 108 cfu/ml of (Xg51) wild type, transconjugants and mutant strains. Transconjugants used in A) and B) are – diamond shape-Xg51 transconjugants carrying pLAFR3 clone; square shaped- Xg51 carrying avrBs7 clone; triangle – Xg51 carrying avrBs1.1 clone. Wild type and mutants used in C) and D) are- diamond shaped: Xv444 wild type; square : Xv444 ∆avrBs7 mutant.
0
50
100
150
200
250
300
0 12 24 36 48 60
μMho
s
Hours after infiltration
ECW-70R
0
50
100
150
200
250
300
0 12 24 36 48 60
μMho
s
Hours after infiltration
ECW
0
50
100
150
200
250
300
0 12 24 36 48 60
μMho
s
Hours after infiltration
ECW-70R
0
50
100
150
200
250
0 12 24 36 48 60
μMho
s
Hours after infiltration
ECW
101
Figure 3-5. Tyrosine phosphatase domain is essential for HR elicitation on ECW-70R.
Phenotype on ECW-70R 48 hr post-infiltration by wild type strains, transconjugants and site-directed mutants infiltrated with suspension adjusted to 108 cfu/ml.
102
avrBs1.1 MPNKISGSIAPSASSDAMKSADCAENIKEEVVSKHVHQAVPAELADLPSRQPPRSKTA-L avrBs7 MPNPVSRSSTSSVSGKGSDDADVVADIKQEAVVEPGNQSTPHGLEGLA----PRSKTARD *** :* * :.*.*... ..** . :**:*.* : :*:.* * .*. ****** avrBs1.1 YQVIQKFRDPLPLPPPPTSHPVLAYDRDLGSS-DNFRSSDEFDLPESLNPTGWKNLHVSG avrBs7 LSLIKKFSNPLPLPQRPTEIPVLQYDRSPRSSSDNFRSSDDFDLPESCNPTGWKDLHVSG .:*:** :***** **. *** ***. ** *******:****** ******:***** avrBs1.1 SGSIASIGQITRLRPSKERPVVVLDAREESHAIVGGYPGTWRTPNNWGNAGKSRDEALAD avrBs7 SGSIASISQITRLNPSRDRPVIVLDVREESHAIVGGYPATWRAPNNWANVGKSREEVLAD *******.*****.**::***:***.************.***:****.*.****:*.*** avrBs1.1 EQQRIQALKSQETVHIFHRKDVKSEARNPRGATLSKPLIFSEEELVRAAGAKYVRLTVTD avrBs7 EHEKIRAIKSQETVQILHRKDVKNGFPNPRSVKLSNPSIFSEEELVRNAGAEYLRLTVTD *:::*:*:******:*:******. ***...**:* ********* ***:*:****** avrBs1.1 HLSPRADDIDAFIAMEREMAHDERLHVHCGMGLGRTTIFIVMHDILRNAAMLSFDDIIER avrBs7 HLGPRADDIDAFVRMERNMAPHERLHVHCGVGQGRTGIFIAMHDILRNAHIISFEDIIKR **.*********: ***:** .********:* *** ***.******** ::**:***:* avrBs1.1 QRKFNPGRSLDNNKDVSDKGRSEFRNERSEFLPLFYEYAKQNPKGQPLLWSEWLDHNA-- avrBs7 QLAFNPGRALDFNKDVSHEGRSDFRNDRLELISLFYEYAKSNPNGQPSLWSEWLRAANKT * *****:** *****.:***:***:* *::.*******.**:*** ******
Figure 3-6. Alignment of avrBs1.1 and avrBs7 amino acid sequences using clustalw
103
Figure 3-7. Fusion protein containing N-terminal of avrBs7 and C terminal of avrBs1.1
does not elicit HR on ECW-70R. Picture was taken 48 hrs after infiltration with suspensions adjusted to 108 cfu/ml. Order of inoculation anticlockwise from top left: Xg51, Xg51 transconjugant carrying fusion clone, Xv444 wild type, Xg51 transconjugant carrying avrBs7 clone, Xg51 transconjugant carrying fusion clone, Xg51 transconjugant carrying fusion clone, Xg51 transconjugant carrying avrBs1.1 clone, Xcv 85-10
104
A B
Figure 3-8. Three dimensional structures of the two avirulence proteins based on
homology modeling. A) Avirulence protein AvrBs7; B) Avirulence protein AvrBs1.1. Catalytic site is present in the groove in both structures. Amino acid residues for catalytic domain tyrosine phosphatase are highlighted as pink dots in both the structures.
105
CHAPTER 4 APPLICATION OF BIOINFORMATICS FOR TYPE III EFFECTOR SIGNAL ANALYSIS
AND ITS INTERACTION WITH CHAPERONE
Background
Most Gram-negative plant and animal pathogens possess a highly specialized
type III secretion system (T3SS) that injects effector proteins inside host cells, interferes
with the host cellular machinery and paralyzes host defense responses (Buttner and He
2009; White et al. 2009). Type III effector proteins contain secretion and translocation
signals that recruit the effectors to the T3SS (Schesser et al. 1996; Mudgett et al. 2000;
Sory et al. 1995). The mechanism for recruitment and regulation of secretion of the type
III effectors is not yet clear.
Several models have been proposed to explain nature and location of the
secretion signals in type III effectors (Buttner and Bonas 2006). The first 15 amino acid
residues contain a signal for secretion through the T3SS and the signal is not conserved
at the amino acid level (Boyd et al. 2000; Lloyd et al. 2001; Schechter et al. 2004,
Buttner et al. 2006; Triplett et al. 2009). In a few cases, the 5’ end of the mRNA is said
to contain a secretion signal, suggesting co-translational secretion of effectors
(Anderson et al. 1999). The first 28 amino acids of AvrBs2 from Xcv is reported to
contain a functional secretion signal (Mudgett et al. 2000). Plant and animal pathogen
effectors do not share any sequence similarities or conservation in the N terminal
region. In pseudomonads, the secretion signal features have been described based on
amino acid composition of the N-terminus (Petnicki-Ocwieja et al. 2002). Apart from the
secretion signal, effectors also contain an N-terminal translocation signal, which is
required to target the protein across the plant plasma membrane. This translocation
signal was determined to lie within the 50-100 most N-terminal amino acids of some
106
effectors (Buttner and Bonas 2006; Mudgett et al. 2000, Schechter et al. 2004;
Schesser et al. 1996). Although the location of secretion and translocation signals have
been predicted, the exact sequence and nature of signals have not yet been completely
understood. Different computational programs have been recently developed to explain
nature of secretion and translocation signals and to identify the draft genome
sequences for putative type III effectors based on characteristic amino acid residues.
The SVM-based Identification and Evaluation of Virulence Effectors (SIEVE) algorithm
program, by Samudrala et al. (2009), combines different DNA sequence features such
as G+C content, with amino acid composition of the 30 most N terminal residues of the
protein sequence. The training set used for machine learning support vector algorithm
(SVM) consisted of known effectors from Pseudomonas syringae and Salmonella
enterica serovar Typhimurium. This program can identify secreted effectors from
evolutionarily distant bacteria. Since the training set included the first 30 amino acids of
effectors, the putative effectors found with this program can include secreted proteins,
which might not necessarily be translocated but just secreted. As with the other
methods, false positives such as tra conjugal transfer proteins, LPS antigen proteins,
and type IV secreted proteins are obtained. This method also identifies some sequence
biases found in the N terminal region of type III secreted effectors, which can’t be
identified using BLAST. An effectiveT3 program proposed by Arnold et al. (2009) is
based on N-terminal sequence features such as frequencies of amino acids, residues
with particular physico-chemical properties, and considers the first 25 amino-acid
residues. The database for machine learning input included known effectors from family
Chlamydiae as well as the genera Escherichia, Yersinia and Pseudomonas. Again, this
107
method can identify potential secreted proteins, but whether they are translocated into
the host cell or not is not known. Modlab by Lower and Schneider (2009), based on
neural networks, included all known effectors from genomes of gram- negative bacteria.
All of these methods were generalized for identification of type III effectors using models
developed on effectors from different genera, indicating that the type III signal is
universally conserved. Another machine learning program developed by Yang et al.
(2010) used features such as amino acid composition, hydrophobicity, and secondary
structure properties of the N terminal residues of known P. syringae effectors and
applied the model to predict effectors in rhizobia.
Apart from secretion and translocation signals, some of the effectors are also
known to contain a chaperone-binding site in the N terminal region. Chaperones are
believed to keep the type III effectors in the cytoplasm in a secretion competent state,
stabilized and separated from other interaction partners before they are secreted by the
T3SS. Chaperones have also been shown to maintain hierarchy of the secreted
substrates in case of animal pathogen effectors (Parsot et al. 2003). T3SS chaperones
don’t share any sequence similarities, but have common characteristic features such as
small size, acidic pI, and amphiphilic α-helix in C terminal regions (Feldman and
Cornelis 2003). T3SS chaperones have been classified as class I, II and III. Class I
chaperones contain approximately 130 amino acids. They are divided into two groups:
class IA associate with only one particular effector; while class IB associate with several
effectors, exhibiting broad range specificity. Class II chaperones contain 160 amino
acids and associate with two translocators. Class IA and II chaperones are located in
the neighborhood of their substrates within the genome, while class IB chaperones are
108
encoded within type III secretion system components operon. Class III chaperones
contain chaperones of the flagellar export system (Parsot et al. 2003; Feldman and
Cornelis 2003). HpaB is the only known type III effector chaperone from X. campestris
pv. vesicatoria. HpaB can be classified as a class IB chaperone, since it controls the
secretion of effectors that do not exhibit any sequence similarities among each other
and it is encoded within the hrp operon. HpaB is a major pathogenicity factor essential
for translocation of some of the effectors (Buttner et al. 2004). Effectors, which are not
translocated in the absence of HpaB, are classified as class A effectors and include
XopJ and XopF1 from Xcv. Class B effectors do not require HpaB for translocation; they
are translocated in the absence of HpaB but in reduced amounts (Buttner et al. 2006).
Examples of class B effectors are xopC and avrBs3 (Buttner et al. 2004; Buttner and
Bonas 2006). Chaperone-dependent effectors get privilege in translocation and are
translocated early during the infection process (Feldman and Cornelis 2003).
Co-crystallization studies have been carried out for some of the effector-
chaperone complexes. A crystal structure model for the SipA-InvB complex from
Salmonella shows the interaction in which the chaperone-binding domain of the effector
wraps around the chaperone dimer and interacts with a helix-binding groove and
hydrophobic regions of the chaperone (Stebbins and Galan 2001; Lilic et al. 2006).
Recognition of the effector-chaperone complex by the T3SS apparatus is proposed to
impose priority for effectors associated with chaperones in getting through the T3SS
(Feldman and Cornelis 2003). Various models have been developed in animal pathogen
effectors to describe the interaction of a chaperone with an effector, its role in controlling
109
hierarchy of the effector translocation, and switch in substrate specificity (Stebbins and
Galan 2001; Parsot et al. 2003; Lilic et al. 2006).
In this chapter, we have developed another type III effector identification program
based on a machine learning algorithm using known type III effectors from
xanthomonads. However, unlike other methods of effector identification, we have
considered the first 100 amino acid residues of the known effectors with the intention of
targeting both secretion as well as translocation signal patterns for effector
identification. Along with the knowledge on secretion and translocation signal patterns,
we are also interested in studying the role of type III effector chaperones in the
regulation of effector translocation. We have selected the known chaperone-dependent
effector, XopF1, as a model to describe the nature of its secretion and translocation
signal and its HpaB chaperone-binding site.
Materials and Methods
Data-Mining Strategy
Models and scoring matrices for the type III effector motifs were built using the
MEME program (Bailey and Elkan 1994) considering the first 100 amino acids of the
known type III effectors of Xanthomonas. A motif search program developed in C was
implemented to search against the ORFs from the whole genome.
Bacterial Strains, Plasmids and Media
Bacterial strains and plasmid constructs used and developed in this study are
listed in Table 4-1. X. euvesicatoria TED3 race 6 strain was grown at 28oC on nutrient
agar (NA) plates. For plant inoculations, the cultures were suspended in sterile tap
water and adjusted to A600= 0.3 with a spectrophotometer (Spectronic 20, Spectronic
UNICAM, U.S.). E. coli strains or transformants were grown at 37oC on Luria-Bertani
110
agar/broth (Maniatis et al. 1982) amended with appropriate antibiotics. Protocols for
ligation of plasmids and transformation into E.coli DH5α strain were according to
Maniatis et al. (1982). These plasmids were then mobilized into Xanthomonas recipient
strains by conjugation with pRK2073 helper plasmid using the triparental mating
procedure (Ditta et al. 1980; Figurski and Helinski 1979). After incubating the matings
on NYG agar at 28oC overnight (Daniels et al. 1984), the growth was suspended in 2ml
sterile tap water and plated on NA plates with Rifamycin and other appropriate
antibiotics. The transconjugants obtained were then grown for pure culture. Antibiotics
were used in following final concentrations: Ampicillin 125 μg/ml; kanamycin 50 μg/ml;
rifamycin 100 μg/ml; tetracycline 12.5 μg/ml. All strains and constructs were stored in
20% glycerol stocks at -80oC. Yeast strain CG1945 was grown on YPD agar (Peptone
2%, Yeast 1%, glucose 2%, pH 5.8) or YPD broth at 30oC overnight. For prepration of
yeast competent cells, the culture was grown in YPD broth until mid-log phase
(OD600=0.8-1.0).
Plant Material and Plant Inoculations
Pepper (Capsicum annuum L.) cv. Early Calwonder (ECW) and its near-isogenic
line, ECW-20R, were grown in the greenhouse set at temperature range of 25oC to
35oC (day/night). Plant leaves were infiltrated with 108 CFU/ml bacterial suspension
using a syringe and hypodermic needle (Hibberd et al. 1987). All experiments were
carried out in three replicates. Plants were observed for the next 48 hr for development
of HR or watersoaking symptoms.
In Planta Reporter Gene Assay
The N-terminal region including 500 bps upstream of the genes were PCR
amplified using primers with BglII restriction sites at the 5’ ends. Following digestion with
111
BglII, PCR amplicons were ligated with BglII-digested pBS(BglII::avrBs262-574::HA)
(courtesy of Dr. Mary Beth Mudgett, Stanford university), and later transformed into E.
coli DH5α. In-frame fusions were confirmed by DNA sequencing using F20 and R24
primers. BamHI-KpnI fragments containing the candidate gene fused to avrBs2 was
then cloned into pUFR034/ pLAFR3. Resulting plasmids were then introduced into Xcv
pepper race 6 (TED3 containing mutation in avrBs2) by tri-parental mating. The
resulting Xcv strains were inoculated into pepper cv. ECW 20R containing Bs2 and kept
at 28oC in a growth room. After 24 hours, a strong HR indicated successful translocation
of candidate effector fusions.
Site-Directed Alanine Mutagenesis
Amino residues of xopF1 were mutated to alanine by a PCR-mutagenesis
approach using primers designed as follows F1-50A - R1: 5’ GC GCT AGC GGC CGC
CGC AGC CGC TGC GGC CAGGCCCGCAAGCG 3’; F1-50A – F1: 5’ GC GCT AGC
GCT GCG GCA GCT GCA GCC GGTCGCGCCAGTCCT; F1-30A – R1: GC GCT AGC
GGC GCA GGC CTGCGTTGG; F1-30A – F1: GC GCT AGC GCT GCC GCA GAA
CGCGCACCC. All primers had NheI overhangs at 5’end. pBS(XopF11-70::avrBs262-
574::HA) was used as template for the above mutagenesis PCR to avoid contamination
by wild-type plasmid. The amplified PCR product was cleaned and digested with NheI
enzyme. The digested product was re-ligated and transformed into E.coli DH5α.
Consequently the mutated gene construct was moved to pLAFR3. It was then mobilized
by triparental mating into Xcv TED3 race 6 strain.
Yeast Two-Hybrid Assay
XopF1, XopF11-70, XopF1(1-70; 27-33= 4A, 1C, 1S, 1 deletion); XopF1(1-70; 47-59= 9A, 1S)
fragments were cloned in fusion with the LexA DNA-binding domain in the SalI and SpeI
112
sites of the bait vector pDBLeu. HpaB was cloned into the SalI and NotI sites of the prey
vector pPC86. Bait and prey constructs were cotransformed into the Saccharomyces
cerevisiae CG1945 (pLacZ/HIS3) using Frozen-EZ Yeast Transformation kit (Promega,
U.S.). Transformation mixture was spread on minimal Synthetic dropout (SD) agar
amended with –Trp-Leu supplement (BD cat no. 630417). Transformants grown on this
medium were transferred to minimal SD agar amended with –Trp-Leu-His supplement
(Clonetech cat. No. 630419) and checked for presence of growth after 72 hr of
incubation at 30oC (Nodzon and Song 2004).
In Vitro Pull Down Assay
XopF1, XopF11-70, XopF1(1-70; 27-33= 4A, 1C, 1S, 1 deletion); XopF1(1-70; 47-59= 9A, 1S)
fragments were cloned in fusion with maltose-binding domain in SalI and NotI sites of
vector pMAL86. HpaB was cloned into the NotI and SalI sites with fusion to FLAG-C
terminal in pFLAG-CTC vector. These vectors were then transformed into E.coli DH5α.
The transformants carrying inserts were sequenced to confirm in-frame fusion. These
vectors were then transferred to expression E.coli strain BL21 (DE3). The cytoplasmic
expression of the HpaB-carboxy-terminal FLAG fusion protein and XopF1 variants fused
to MBP was carried out by following protocol. Single colony cultures of the above
expression E.coli carrying different fusion vectors were grown overnight at 37oC. A 500
μl aliquot of the overnight cultures was transferred into LB broth containing 50 μl Amp,
200μl 50% glucose and continued growth at 37oC until OD600=0.6. Protein expression
was induced by adding 25 μl of 1M IPTG and growth was continued for 3 more hr at
37oC. The cells were pelleted by centrifuging at 6000 rpm for 10min at 4oC. Supernatant
was discarded and cell pellets were weighed and stored at -20oC until further
purification steps. The above cell pellet was thawed and resuspended in 5 ml of 1X
113
MBP buffer (20mM Tris-HCl pH 7.4, 200mM NaCl, 1mM EDTA, 1mM dithiothreitol) per
50 ml culture. The resuspended cells were aliquoted into 1.5 ml eppendorf tubes and
sonicated (30s × 4 times) (Sonicator setting 9.5, reading =12-15). Fifteen microliters of
this sonicated mixture was placed in a separate tube as total protein and stored. For
HpaB-FLAG tagged protein and FLAG-CTC protein, samples were stored at this point
without further purification. XopF1 variant fusion protein samples were further purified
using resin columns. Resin was equilibriated by washing 50 μl of slurry with 500 μl 1X
MBP buffer four times at 1000 rpm for 1 min. Sonicated cell suspension was centrifuged
at 6500 rpm for 15 min at 4oC. Fifteen microliters of the supernatant was placed in a
separate tube and stored. The remaining supernatant was loaded onto pre-equilibriated
resin and shaken gently on a rotary shaker at 4oC for 1 hr. The resin was then washed
five times with 800 μl of 1X MBP buffer. Resin-bound fusion protein samples were
stored at -20oC for later use. Protein concentration in the purified protein samples was
checked by running SDS-PAGE gel.
Each MBP-tagged XopF1 variant fusion protein sample bound to resin was mixed
with FLAG-tagged total protein. The tubes with the combination of mixtures of FLAG-
tagged protein and MBP-tagged protein were rocked at 4oC overnight. Resin-bound
protein samples were washed with 1X MBP buffer five times by centrifuging at 1000 rpm
for 1min at 4oC. Fifteen microliters of resin-bound protein samples were loaded on 15%
SDS-PAGE and were run at 120 V. The proteins separated by SDS-PAGE were
transferred to the nitrocellulose membrane by semi-dry blotting for 30 min. The
membrane was then incubated in 20 ml TTBS [1ml of tween-20 to 1 L of TBS (10mM
Tris 3.12 g; 150 mM NaCl 17.53 g, pH 7.5, bring volume to 2 L)] for 10 min at room
114
temperature with shaking on rotator mixer. The membrane was then incubated for 1 hr
at room temperature in 15ml blocking solution (5 g dry milk to 100ml TTBS) to reduce
non-specific binding. Blocking solution was decanted. Fifteen milliliters of primary
antibody (anti-FLAG rabbit antibody) diluted 10000-fold dilution in blocking solution was
added and then the suspension and membrane were incubted on a rotary shaker for 1
hr. After incubation, the membrane was washed with 15 ml of TTBS, 2 times for a total
of 30 min. A 15 ml aliquot of secondary antibody (Anti-rabbit goat IgG antibody
conjugated to Alkaline phosphatase) diluted 2500 fold was applied for 1 hr of gentle
shaking at room temperature. Secondary antibody was then washed and the membrane
was washed with 15 ml TTBS twice, for a total of 30 min. After washing, membrane was
transferred to a plastic petri dish. Color development mixture was prepared by
dissolving a pill made of alkaline phosphatase buffer (AP), BCIP, NBT in 10 ml of
ddH2O. The color development mixture was added to a dish containing the membrane
and gently shaken until bands became visible. Development was stopped by discarding
the mixture and rinsing with water. Membrane was then allowed to air dry.
Results
General Characteristics of Secretion and Translocation Signals in N Terminal Region of Xanthomonas Type III Effectors
Frequency of each amino acid within the first 50 amino acid region of a set of
known secreted and translocated Xanthomonas effectors was determined. Six
predictive rules have been developed in case of Pseudomonas effectors (Petnicki-
Ocwieja et al. 2002). Pattern and amino acid bias varies to a greater extent in
Xanthomonas effectors compared to Pseudomonas effectors. A) First 50 residues are
rich in Pro/ Ser/ Ala. In Xcv, Ser content within the first 25 amino acids of known TTS
115
substrates varies 8% (HrpB2) and 32% (HrpF). This is higher than Ser content in N
termini of non-secreted components of TTSS (between 0% in HrcN and 12% as in
HrcT). B) For few effectors like AvrBs1, AvrRxv, AvrBsT, AvrXv3, AvrXv4, XopB,
XopF1, XopP, XopN, richness in Ser was observed as was true for Pseudomonas
effectors. For effectors belonging to avrBs3 family, the first 50 residues are rich in Pro
along with Ala and Arg. C) Similar to Pseudomonas effectors, Ile, Leu, Val can be found
in positions 3, 4, 5, not both and preceded by polar amino acids. D) Asp and Glu can
occur within first 12 positions, in contrast to Pseudomonas effectors. E) The group of
effectors which was mentioned above showing richness in Ser i.e. AvrRxv, AvrXv4,
AvrXv3, AvrBsT, XopA, position 5 was found to be occupied by, either, Ile, Leu, Phe,
Tyr, or Trp, which are rarely found at position 5 in Pseudomonas effectors.
Clearly, due to several differences between the effectors from different species,
there is need to develop a separate prosite pattern for xanthomonads for this amino
acid bias which can then be employed to screen the draft genomes for candidate
effectors.
Screening Whole Genomes for Candidate Type III Effectors
The first 100 amino acids of known effectors from xanthomonads were used as
training set. The MEME program identified a number of motifs, which were assigned
based on amino acid frequencies among a group of effectors. Position specific scoring
matrices (PSSM) corresponding to each motif were used to create input for the
screening program. Model parameters were adjusted by validation against known
Xanthomonas effector set and the well characterized Xanthomonas euvesicatoria Xcv
85-10 genome. The program gave hits for all the known characterized effectors with
high scores. However, the major drawback was that it also identified type II and type IV
116
substrates; therefore the search strategy is not foolproof. We also searched draft
genomes of xanthomonads using the above models. We tested several candidates
using the avrBs2 reporter gene assay (Refer Chapter 2) and identified novel effectors
from Xv and Xg.
First 70 Amino Acids of XopF1 are Sufficient for Translocation into the Plant Cell.
The translocation signal of type III effectors in xanthomonads was shown to be
located within the 50-100 most N-terminal amino acid residues (Buttner and Bonas
2006; Mudgett et al. 2000, Schechter et al. 2004; Schesser et al. 1996). Based on the
models developed above, candidate translocation signal sites were predicted. The
coding sequence corresponding to the first 70 amino acids of XopF1, an effector from
Xcv 85-10, along with a 500 bps long upstream region containing the endogenous
promoter were fused to avrBs262-574 in pBlueScript using a BglII restriction enzyme site.
The portion of avrBs2 effector, avrBs262-574, lacks its own secretion and translocation
signal. Therefore, avrBs262-574 cloned alone in pLAFR3 and conjugated in TED3 race 6
is not translocated into plant cells of pepper cv. ECW-20R. TED3 race 6 was chosen as
a recipient since it contains an inactivated version of avrBs2. The xopF11-70:avrBs2
fragment from pBluescript clone was moved to pLAFR3 resulting in a clone designated
as pLAFR:xopF1-70 and conjugated into Xcv TED3 race 6 by triparental mating.
Transconjugants when infiltrated into the leaves of pepper cv. ECW-20R, showed a
strong HR by 24 hr post inoculation (Figure 4-1). This shows that the first 70 amino
acids contain a translocation signal necessary for delivery of the protein into plant cells.
117
Type III Effector XopF1 is Dependent on Global Chaperone HpaB for its Translocation.
XopF1 has been shown earlier to be translocated only in the presence of the
chaperone, HpaB (Buttner et al. 2006). We were interested in identifying the chaperone
binding site(s). pLAFR:xopF1-70 was conjugated into a TED3 race 6 ∆hpaB mutant and
infiltrated into leaves of pepper cv. ECW-20R. This fusion construct did not elicit an HR
48 hr after inoculation (Figure 4-2). This indicates that the first 70 amino acids might
contain a possible HpaB binding site.
First 40 Amino Acids of XopF1 are not enough for Translocation into Plant Cells.
Next we decided to narrow down the location of the translocation signal and HpaB
binding site within the first 70 amino acids of XopF1. The first 40 amino acids were
fused to the reporter gene and transferred to pLAFR3 resulting in pLAFR3 (xopF11-
40:avrBs2) clone, referred to as pLAFR3:XopF1-40, which was conjugated into TED3
race6. The transconjugant failed to induce an HR on 20R by 48 hr after inoculation
(Figure 4-1). One explanation for the absence of HR for above transconjugants is that
the translocation signal is missing in the first 40 amino acids. A second possiblity is that
the HpaB binding site is missing in the first 40 amino acids and although a translocation
signal is present in the first 40 amino acids, the effector will not bind to HpaB and
therefore translocation will not occur. A third possibility could be that both translocation
signal and HpaB binding site could be overlapping and are missing in first 40 amino
acids.
Secondary Structure Analysis of XopF1 Effector.
Although there is little or no sequence identity among type III effector chaperones,
they have similarities in their structures in that they contain acidic dimers with three
118
alpha helices and five beta sheets. Specific secondary structures and specific residues
are known to be involved in the effector-chaperone binding. These secondary structures
include alpha helices and a single three-residue motif, the β-motif. Class I chaperones
interact with one or more alpha helices on the effector protein (Lilic et al. 2006). In the
case of Erwinia effector DspE and chaperone DspF interaction, DspF was shown to
bind in the region rich in alpha helices and the β-motif. Alanine stretch mutagenesis of
this region reduced binding of the corresponding chaperone (Triplett et al. 2009). We
predicted the secondary structure of the XopF1 effector using secondary structure
prediction programs Psipred (Jones 1999) and Garnier (Garnier et al. 1996). Psipred
predicted alpha helix rich region from aa 49 through 56 (Figure 4-4), whereas, Garnier
predicted alpha helices in two regions, one from 48 through 53 and another from 26
through 35 (Figure 4-5). Mutations or deletions in the β-motif have been shown to lead
to loss of effector-chaperone binding (Lilic et al. 2006). Alignment of different type III
effector substrates from plant and animal pathogens showed conserved β-motif
residues, the first two of which are always hydrophobic and the third one which is mostly
hydrophobic (Lilic et al. 2006). We searched for the probable conserved β-motif
residues in XopF1 amino acid sequence by alignment. We found β-motifs within α-helix
regions (47 through 59) as LRGRRASL (three β-motif residues underlined in the
sequence; 52nd, 57th and 59th residues) and another one as QAEDVAA (three β-motif
residues underlined in the sequence; 25th, 29th and 31st residues) within the 25 through
33 helix region.
119
Alanine Mutagenesis in Alpha Helix Regions Abolished HR of the Effector-Reporter Fusion Complex.
We generated alanine mutants of XopF1 mutating amino acid residues 27 through
33 and 47 through 59 to alanine using 103 diluted pBS(xopF11-70 : avrBs2) as template.
The generated PCR product was digested with the enzyme NheI, religated and
transformed. The constructs were sequenced to confirm the mutated sequence. Since
PCR also introduced random mutations in the avrBs2 gene, we digested the product
using the BglII enzyme and separated the mutated xopF11-70 fragment from the avrBs2
fragment. The mutated xopF11-70 fragment was then again fused in frame to pBS
(avrBs262-574) and transferred to pLAFR3 to get pLAFR3 [xopF1(1-70; 27-33= 4A, 1C, 1S, 1
deletion): avrBs262-574] and pLAFR3 [xopF1(1-70; 47-59= 9A, 1S): avrBs262-574] clone.
Transconjugants carrying mutations at 27 through 33 and 47 through 59 were
inoculated into the leaves of pepper cv. ECW-20R. Neither mutant elicited HR on 20R
(Figure 4-3) indicating that either they had lost the HpaB-binding site or they carried a
mutation in the translocation signal.
Yeast Two-Hybrid Assay
XopF1 full-length gene, XopF11-70, and both alanine mutants 27 through 33 and 47
through 59 were cloned in frame with the LexA-DNA binding domain in the bait vector
pDBLeu and HpaB was cloned in the prey vector pPC86. Yeast transformants carrying
both these vectors were selected on SD-Leu-Trp-His medium. Y2H assay showed weak
interaction of XopF1 full length with HpaB and very weak interaction for XopF1-70, both
alanine mutants, and HpaB (Figure 4-6).
120
In Vitro Pull Down Assay
To confirm results obtained in Y2H assay, we cloned the above constructs from
pDB-Leu vector to pMal86 vector using SalI/NotI enzymes. HpaB was cloned into
pFLAG-CTC with in-frame fusion. Fusion proteins containing XopF11-70 and the two
alanine mutants 27 through 33 and 47 through 59, each fused in-frame with Maltose
binding domain were expressed in E.coli BL21 (DE3) and purified using resin. Fusion
protein HpaB-FLAG-CTC was expressed and total protein from the cell extracts was
stored. This HpaB-FLAG-CTC total protein extract was allowed to bind to resin-bound
xopF1 variants individually overnight and then co-immunoprecipitated using anti-FLAG
antibodies. Pull down assay showed that HpaB-FLAG-CTC pulled down all XopF1
variants including two alanine mutants (Figure 4-7). The band observed for the two
alanine mutants indicates that HpaB could bind to both alanine mutants. Binding to the
two alpha helices might be essential for formation of HpaB-XopF1 complex and hence
mutating individual alpha helix still allowed binding of HpaB to the other intact alpha
helix of XopF1. This binding might occur to the alanine mutants in vitro but may not be
translocated by type III secretion system in planta and hence cannot elicit HR when
fused to reporter. In fact, in both alanine mutants, we mutated three β-motif residues as
well to alanine, which are part of alpha helix. Mutating β-motif residues to alanine did
not change the hydrophobic properties of the residues at that position and could still
possibly form the β-motif structure. However, the other interacting regions of alpha helix
of XopF1 were mutated in the two mutants. These might not be able to interact with
corresponding residues in HpaB and may not form a stable HpaB-XopF1 complex.
121
Concluding Remarks
Plant and animal pathogens deliver type III effectors into the host cell. Two
functional signals are believed to be present in effectors, which direct their journey
through the bacterial cytoplasm to the host cell. Usually these signals are present in the
N terminal region, with a short N terminal fragment sufficient for secretion into the
culture medium and longer one sufficient for translocation in vivo (Mudgett et al. 2000;
Sory et al. 1995). Different type III prediction programs have been developed based on
the amino acid bias in the N terminal region. But there is no amino acid sequence
similarity found in the plant/animal pathogen effectors. In pseudomonads, six predictive
rules have been suggested to search for the type III effectors in the draft genome. We
compared those six rules to the known Xanthomonas effectors. Richness in Ser content
in first 50 amino acids is found in few Xanthomonas effectors, however exception to this
would be avrBs3 family effectors. Similar to Pseudomonas effectors, Ile, Leu, Val can
be found in positions 3, 4, 5, not both and preceded by polar amino acids. Asp, Glu can
occur within first 12 positions, in contrast to pseudomonas effectors. Due to these
differences, pattern developed for Pseudomonas effectors cannot be used for searching
for the novel effectors in the draft genomes of Xanthomonads. We developed different
matrices describing the amino acid biases in the N terminal 100 amino acid residues of
known xanthomonas effectors. We used MEME program to develop the matrices and
then used C-based program to screen the genomes of xanthomonads for the type III
effectors. This program can identity all the known effectors. Apart from these known
effectors, it identified other putative candidates. When we used the program to screen
our three draft genomes, candidate effectors were assayed using avrBs2 reporter gene
assay. We identified 2 novel effectors in the search as mentioned in Chapter 2. The
122
drawback of this program is that it also gave type II and type IV secreted proteins as hits
suggesting false positive and negatives could not be avoided with this program as well.
Here we have reported analysis of N terminal region of type III effector XopF1. We
have selected XopF1 as model for the analysis since it is shown to be dependent on
HpaB chaperone for its translocation (Buttner et al. 2006). We have demonstrated here
that first 70 amino acids of XopF1 effector contain the translocation signal and are
sufficient for delivering the fused reporter into the plant cell. Previous work on AvrBs2
has identified the translocation signal present between 50-100 amino acids (Mudgett et
al. 2000).
To narrow down the location of translocation signal in XopF1, we cloned coding
sequence of first 40 amino acids of XopF1 in frame with reporter gene avrBs262-574 and
assayed by inoculating the leaves of pepper cv. ECW-20R. The first 40 amino acids
failed to deliver the reporter into the plant cell and induce a BS2-based HR. The inability
of first 40 amino acids to induce HR could be imparted to absence of translocation
signal within first 40 amino acids or absence of chaperone HpaB-binding site within first
40 amino acids. In animal pathogenic type III effectors dependent on chaperone,
chaperone-binding site and translocation signal have been shown to be overlapping.
This explanation could also be true for XopF1, since XopF1 is not translocated in
absence of HpaB. It could be that since a translocation signal is masked by the HpaB
binding site and hence only when HpaB binds to it, it is directed for delivery by HpaB to
the secretion apparatus. This also could be the distinction between the chaperone
dependent and chaperone independent effectors, a separate translocation signal and a
separate chaperone-binding site in chaperone independent effectors.
123
In Yersinia effector YopE, there is no separate translocation signal, first 2-15
residues are sufficient for delivery into eukaryotic cells along with chaperone SycE
binding domain in the region of 50-77 residues. It was shown that residues 50-77 are
inhibitory to the effector release, however chaperone binding masks that inhibitory effect
and allows its translocation (Boyd et al. 2000).
Co-crystallization studies have determined effector- chaperone interaction and the
residues of effector interacting with the chaperone. According to the model proposed by
Lilic et al. (2006), β motif residues are hydrophobic which interact with chaperone
hydrophobic residues. Mutation of these single three-residues to glycine resulted in
instability of the effector-chaperone complex. We determined secondary structure of
XopF1 and found two alpha helices, one around 30th amino acid and one around 50th
residue. We also found β motif residues in the second helix region. We constructed
alanine mutants in the two alpha helices regions. Transconjugants carrying mutations at
both sites, 27 through 33 and 47 through 59 were inoculated into the leaves of pepper
cv. ECW-20R. Both mutants did not elicit HR on 20R indicating that either they had lost
HpaB-binding site or they carried mutation in translocation signal. According to the
model proposed based on crystal structures of different effector-chaperone complexes,
mutation in β motif residues region makes the complex unstable. Since we mutated β
motif residues as well as alpha helices, HpaB could not bind and hence effector XopF1
was not directed towards secretion apparatus by HpaB chaperone. However in vitro
experiments such as yeast two hybrid assay and pull-down assay showed that HpaB
could bind to both alanine mutants 27 through 33 and 47 through 59, showing possibility
that HpaB could have bound to the effector, but the complex might not be active to be
124
translocated. HpaB might require both the alpha helices for formation of stable complex.
However when one alpha helix was mutated, it might have partially bound to the other
alpha helix as seen in the in-vitro experiments. Another possibility is that since we
generated alanine mutants, β motif which mainly constitutes hydrophobic residues could
have been still active, however the alpha helices were disrupted, chaperone could not
have formed stable complex of effector and chaperone and hence not translocated in in-
planta experiments.
The current analysis of chaperone dependent type III effector of Xanthomonas has
opened new areas of study such as regulation of type III effectors by chaperone, role of
chaperone dependent effectors. Since HpaB is shown to be essential for pathogenicity,
HpaB-dependent effectors might be playing important roles in the establishment of
infection (Buttner and Bonas 2006). In animal pathogen effectors, the chaperone is
known to be responsible for hierarchy of effectors during translocation (Boyd et al.
2000). Chaperone dependent effectors get privilege in secretion and translocation. If
this is true for xanthomonas pathosystem, the chaperone dependent effectors would be
important pathogenicity factors in early stages of infection.
125
Table 4-1. List of bacterial strains and plasmids used in this study Strain designation Relevant characteristics Source or reference
Xanthomonas euvesicatoria TED3 Pepper race 6 Minsavage, Univ of Florida
TED3∆hpaB Race 6 HpaB deletion mutant This study
Escherichia coli DH5α F-recAΦ80dlacZ∆M15 Bethesda Research
Laboratories, Gaithersburg,MD
BL21 (DE3) Host for Expression vector Song, University of Florida
Plasmids pLAFR3 Tcrrlx+RK2 replicon, Tcr Staskawicz et al. 1987
pBlueScript II KS +/- Phagemid sequencing vector, Apr
Stratagene, La Jolla, CA
pRK2073 Spr Tra+, helper plasmid Figurski and Helinski 1979 pBS(BglII::avrBs262-574::HA) Phagemid sequencing vector,
Apr Mary Beth Mudgett, Stanford university
pDBLeu Kmr Song, University of Florida pPC86 Apr Song, University of Florida
pMAL86 MBP binding domain, Apr Song, University of Florida pFLAG-CTC Apr,contains FLAG tag on C
terminus Jerry Minsavage
pLAFR3[xopF1(1-70; 27-33= 4A, 1C,
1S, 1 deletion): avrBs262-574] Tcrrlx+RK2 replicon, Tcr
containing XopF1 alanine mutant
This study
pLAFR3[xopF1(1-70; 47-59= 9A, 1S): avrBs262-574]
Tcrrlx+RK2 replicon, Tcr containing XopF1 alanine
mutant
This study
pDBLeu(xopF1(1-70; 27-33= 4A, 1C,
1S, 1 deletion)) Kmr, XopF1 variant fused in
frame with LexA binding domain
This study
pDBLeu[xopF1(1-70; 47-59= 9A, 1S)] Kmr, XopF1 variant fused in frame with LexA binding
domain
This study
pPC86 (hpaB) Apr This study pMAL86(xopF1(1-70; 27-33= 4A, 1C,
1S, 1 deletion)) Apr, XopF1 variant fused in
frame with MBP binding domain
This study
pMAL86[xopF1(1-70; 47-59= 9A, 1S)] Apr, XopF1 variant fused in frame with MBP binding
domain
This study
pFLAG-CTC (hpaB) HpaB fused In frame with C terminal FLAG tag
This study
126
Figure 4-1. Phenotype on ECW-20R 24 hr post-infiltration by wild type strains and
transconjugants. First 70 amino acids of xopF1 are sufficient for translocation of the effector into the plant cell, whereas first 40 amino acids are not sufficient for the translocation. The order of inoculation is as follows (anticlockwise, starting with top left): TED3 race 6 transconjugants carrying known Xanthomonas type III effector fused to avrBs2 reporter gene; TED3 race 6 transconjugants carrying pLAFR3(xopF11-70:avrBs2) clone; TED3 race 6 transconjugants carrying pLAFR3(xopF11-40:avrBs2) clone ; TED3 race 6.
127
Figure 4-2. Phenotype on ECW-20R 24 hr post-infiltration by wild type strains,
transconjugants, and mutants. First 70 amino acids of XopF1 are sufficient for translocation of the effector into the plant cell. However fusion of first 70 amino acids of XopF1 hooked to avrBs2 reporter gene is not translocated in absence of hpaB chaperone. Order of inoculation as follows (anticlockwise, starting top left): TED3 race 6; TED3 race 6 transconjugants carrying pLAFR3(xopF11-70:avrBs2) clone; TED3 race 6 ∆hpaB mutant transconjugants carrying pLAFR3(xopF11-70:avrBs2) clone.
128
Figure 4-3. Phenotype on ECW-20R 24 hr post-infiltration by wild type strains,
transconjugants and mutants. First 70 amino acids of XopF1 are sufficient for translocation of the effector into the plant cell. Alanine mutants XopF1(1-70; 27-
33= 4A, 1C, 1S, 1 deletion); XopF1(1-70; 47-59= 9A, 1S) do not show translocation of fusion reporter protein. The order of inoculation is as follows (counterclockwise from top left): TED3 race 6 transconjugants carrying pLAFR3 (xopF11-70:avrBs2) clone; TED3 race 6; TED3 race 6 transconjugants carrying pLAFR3 (xopF1(1-
70; 27-33= 4A, 1C, 1S, 1 deletion) : avrBs2) clone.; TED3 race 6 transconjugants carrying pLAFR3(xopF1(1-70; 47-59= 9A, 1S): avrBs2) clone
.
129
Figure 4-4. Secondary structure prediction by PsiPred for first 70 amino acid region of
XopF1. Cylinder represents predicted alpha helix.
130
. 10 . 20 . 30 . 40 . 50 MKLSSDIGTAASRGAASHPPVQPTQAEDVAAPREERAPTGPLAGLASSSA helix HH HHHHHHHHHH H HHH sheet E E EE E EEEE turns T TTT T T T coil CC C CC CCCC CCCC C CCC C . 60 . 70 . 80 . 90 . 100 ALRGRRASLAGRASPHADEEGAMLGGSHRSDSSQSSQASDATFYTAQVVS helix HHH HHHHHHHHH sheet EEE EEEEEEE turns TT TT TT T coil CC CCCC CCCCC CCCCCCC C CC
Figure 4-5. Secondary structure prediction by garnier for first 70 amino acid region of XopF1. H indicates alpha helix.
131
Figure 4-6. Yeast two hybrid interaction between alanine mutants of XopF11-70 and
HpaB chaperone. Empty vector control contains pDBLeu and pPC86 empty vectors.
132
Figure 4-7. In vitro pull down assay showing binding of HpaB chaperone to XopF1
variants. Lane 1: Kaleidoscope prestained standard, 2: XopF11-70 27 through 33 alanine mutant fused to MBP tag; 3: XopF11-70 47 through 59 alanine mutant fused to MBP tag; 4. XopF11-70 fused to MBP tag; 5. Empty; 6: total protein containing FLAG protein; 7: MBP protein; all pulled down using HpaB-FLAG-CTC tag.
133
CHAPTER 5 PATHOGENIC STRATEGIES OF XANTHOMONAS GENUS ON PLANTS: LESSONS
LEARNT FROM GENOMICS1
Background
Xanthomonas, the genus belonging to the gamma subdivision of the
proteobacteria, comprises of 27 species. These diverse species are known to cause
diseases on nearly 400 plant hosts, including both eudicots and monocots (Buttner and
Bonas 2010). Xanthomonas species cause serious diseases of a wide variety of
economically important crops including rice, citrus, banana, cabbage, tomato, pepper
and bean (Chan and Goodwin 1999). Pathogenic species and pathovars within species
show a high degree of host plant specificity and many exhibit tissue-specificity, invading
either the xylem elements of the vascular system or the intercellular spaces of the
mesophyll tissue of the host. For instance, Xanthomonas campestris includes pathovars
that (collectively) infect different brassicaceous, and other plant species, and
Xanthomonas oryzae, a species specific to rice and some wild relatives, comprises
pathovars that either invade through the vascular system (X. oryzae pv. oryzae) or
colonize the intercellular spaces of the parenchyma tissue (X. oryzae pv. oryzicola). As
with X. oryzae, the X. campestris group also includes vascular and non-vascular
colonizers, exemplified by X. campestris pv. campestris and X. campestris pv.
armoraciae respectively. Bacteria enter the host either through stomates to colonize the
mesophyll parenchyma, or through hydathodes or wounds to spread systemically
through the vascular system.
1 Reprinted with permission from White et al. 2009; Moreira et al. 2010; and Ryan et al. 2011.
134
In order to study plant-pathogen interactions at the molecular level, Xanthomonas-
plant system can be used as a model due to diversity among xanthomonads with
respect to hosts and tissue types. At the time of writing, the complete genome
sequences of 10 Xanthomonas species have been determined and draft genomes of a
further 9 species are available, in total comprising seven species and eight pathovars
(Table 5-1). Sequencing projects currently in train will provide data on further species
and pathovars (Ryan et al. 2009). In addition, complete and draft genome sequences
are available for the related bacteria, Xylella fastidiosa and Stenotrophomonas species
including S. maltophilia (Ryan et al. 2009). In order to get insights into the diversity of
xanthomonads, their pathogenic adaptation colonizing wide variety of plants, and
evolutionary mechanisms, we compared pathogenicity clusters, and individual
pathogenicity/ virulence factors, especially type III effectors from all sequenced
xanthomonads. The results mentioned in this Chapter have been published in three
research articles – White et al. 2009, Moreira et al. 2010, and Ryan et al.2011.
Materials and Methods
Xanthomonas Genomes and Tools Used for Comparison
As listed in table 5-1, available Xanthomonas genome sequences were
downloaded from NCBI Genbank. IMG-JGI website (http://img.jgi.doe.gov/er/) was used
as interface for comparative genomics. Few recently published Xanthomonas genomes
are not yet available on this website, in such a case, comparisons are made manually
using blast (Altschul et al. 1997).
Database for Xanthomonas Pathogenicity Factors
Protein sequences of pathogenicity factors including all type secretion systems,
other virulence factors such as LPS, EPS of known plant pathogens, especially
135
characterized in terms of function in xanthomonads were downloaded from NCBI. The
known pathogenicity factors were searched in IMG interface and searched for homologs
within all xanthomonads.
Effectors Database Compilation
New xop nomenclature was introduced for type III effectors of xanthomonads. All
known plant and animal pathogen effectors including known xanthomonas effectors
were collected as a database and were used as query with an e-value threshold ≤ 10-5
for tblastn analysis. Pfam domains were searched for possible domains in the identified
set. Nomenclature and classification scheme is available on www.xanthomonas.org
Effector Analysis of the Test Case of Citrus Pathogens
The candidate T3SS effectors in the XauB and XauC genomes were identified
using tBLASTn (Altschul et al. 1997) analysis and Pfam domain (Finn et al. 2010)
searches. For tBLASTn analysis, all known plant and animal pathogen effectors were
used as query with an e-value threshold ≤ 10-5. Pfam domains were searched for
possible domains found in known effectors in the predicted set of ORFs of draft genome
sequences. Candidate effectors were classified according to the nomenclature and
classification scheme for effectors in xanthomonads recently described by White et al.
(2009).
Results
Type II Secretion Systems
Plant cell wall-degrading enzymes such as cellulase, polygalacturonase, xylanase,
and protease are secreted by type II secretion systems (T2SS). All Xanthomonas spp.
and the phylogenetically related Xylella fastidiosa and Stenotrophomonas spp. possess
a T2SS system called Xps. A second T2SS system known as the Xcs system is found
136
in certain species that include X. campestris pv. campestris, X. armoraciae pv. citri and
X. campestris pv. vesicatoria. The Xps T2SS has been shown to contribute to virulence
in X. campestris pv. campestris and Xanthomonas oryzae pv. oryzae, Xanthomonas
oryzae pv. oryzicola and X. campestris pv. vesicatoria (Dow et al. 1987; Jha et al. 2007;
Wang et al. 2008; Szczesny et al. 2010). In contrast the Xcs T2SS does not appear to
have a function in virulence (Szczesny et al. 2010).
Interestingly, homologs of T2SS substrates from other Xanthomonas species are
not secreted by the T2SS of X. campestris pv. vesicatoria. This finding indicates that the
substrate specificity of T2SS secretion systems differs significantly among
Xanthomonas spp. (Szczesny et al. 2010). Comparative analysis of the XpsD protein,
which forms the secretion channel in the Xps system, reveals amino acid differences at
three positions (residues 494, 696, 698) that correlated with vascular or mesophyll
tissue specificity among the strains analysed (Lu et al. 2008). However, subsequent
analysis of the mesophyllic (bacterial spot) pathogens X. gardneri and X. vesicatoria
indicated that this correlation no longer held for position 494 (unpublished data). It is not
known whether these differences in XpsD relate to the substrate specificity of the
various Xps T2SS. All Xanthomonas genomes have an extensive number of genes for
cell wall degrading enzymes. Whereas some genes such as cbhA encoding a
cellobiosidase are found only in the xylem-invading Xanthomonas spp. and in Xylella
fastidiosa, others are conserved in all species. Differences in the complement of genes
for cell wall degrading enzymes between species may reflect the differences in
symptoms produced, rather than host or tissue preference (Table 2-7).
137
Type III Secretion System
The type III secretion system (T3SS) is encoded by the hrp gene cluster (for
hypersensitive response and pathogenicity). This system “injects” effector proteins into
the cytoplasm of the host cell that interfere in diverse host processes in order to
promote disease (Nimura et al. 2005; Grant et al. 2006; Sarkar et al. 2006; Rohmer et
al. 2004; White et al. 2009). X. albilineans does not possess the typical hrp gene cluster
found in all other Xanthomonas species, but encodes a unique T3SS similar to the SPI-
1 (Salmonella Pathogenicity Island-1) found in Erwinia spp. (Pieretti et al. 2009). The
function of this SPI-1 T3SS is unknown, although its occurrence in insect bacterial
pathogens and symbionts has led to the suggestion that X. albilineans, which is not
known to be insect-transmitted, may have an insect-associated lifestyle. However
Xylella fastidiosa, which is insect vectored, possesses neither an Hrp-like nor a SPI-1-
like T3SS.
Type III-Secreted Effectors
Genome-enabled bioinformatic analyses have provided insights into the diverse
repertoires of type III-secreted effectors possessed by Xanthomonas with clues to their
possible contribution towards host specificity (White et al. 2009). So far, a total of 52
effector families have been identified along with three harpin proteins; helper or
accessory proteins that assist in the translocation of the effectors (Table 5-2). The
majority of sequenced Xanthomonas genomes contain a core set of nine effector genes
(xopR, avrBs2, xopK, xopL, xopN, xopP, xopQ, xopX, xopZ). The exceptions are X.
campestris pv. armoraciae, which only has six known effectors, and X. albilineans,
which has none. A study of 132 strains comprising eighteen pathovars of X. axonopodis
identified additional core effector genes (pthA, xopF1, xopE2 and avrXacE3) for this
138
species (Hajri et al. 2009). Mutation of genes encoding some core effectors leads to
reduced virulence and fitness of the pathogen (Table 5-3) (Kim et al. 2009; Kearney and
Staskawicz 1990; Metz et al. 2005; Duan et al. 1999; Al-saadi et al. 2007; Song and
Yang 2010; Gassmann et al. 2000), although this is not always the case (Roden et al.
2004a). Similarly, mutation of genes encoding some variable effectors influences
virulence and disease symptomology (Table 5-4) (Kim et al. 2003; Wang et al. 2007b)
whereas mutation of others has no apparent effect (Roden et al. 2004b). Mutation in
individual genes may not result in change in virulence phenotype because of
redundancy of function between effectors that may or may not share sequence
similarity.
A few effector genes have been found to be associated only with certain species
or with different species that attack common hosts. For instance xopAL1, xopAC,
xopAD, xopAH, and xopAL2 are unique to X. campestris strains pathogenic on
cruciferous plants, with the exception of X. campestris pv. armoraciae, which only has
xopAL1 and xopAC . The xopE3 and xopAI genes are specific to the citrus pathogens
X. axonopodis pv. citri strain 306, X. fuscans pv. aurantifolii B and X. fuscans pv.
aurantifolii C and are localized in a region identified as genomic island (Moreira et al.
2010). XopE4, a member of the XopE family, is an effector found uniquely in X. fuscans
subsp. aurantifolii strains B and C but not in any other Xanthomonas spp. (Moreira et al.
2010). The contribution of these genes to the ability to cause disease in specific hosts
remains to be tested. Multiple copies of some effectors may also be responsible for host
range, an example being the AvrBs3/PthA family of TAL-like effectors of X. oryzae. pv.
oryzae, X. oryzae. pv. oryzicola, and X. campestris pv. vesicatoria.
139
The role of effectors in restriction of host range through an action as avirulence
determinants has also been described. One example is the avrGf1 gene responsible for
exclusion of grapefruit from the host range of X. axonopodis pv. citri Aw strain (Rybak et
al. 2009). Interestingly, the effector gene xopAG which belongs to the same family as
avrGf1 has also been found to limit the host range of X. fuscans pv. aurantifolii strain C
to exclude grapefruit. The X. fuscans pv. aurantifolii B strain, which causes disease in
grapefruit, has an almost identical xopAG gene that is inactivated by transposon
insertion (Moreira et al. 2010). An avirulence gene, avrXv3, restricts the host range of X.
perforans to tomato, giving HR on pepper (Astua-Monge et al. 2000a). A microarray
based on the complete genome sequence of X. campestris pv. campestris strain 8004
was used investigated the genetic diversity and host specificity of this pathovar by
array-based comparative genome hybridization analyses of 18 virulent strains. This
analysis led to the identification of avrXccC and avrXccE1 as determinants of host
specificity of X. campestris pv. campestris strain 8004 on mustard and Chinese
cabbage respectively and avrBs1 as determinant of non-host resistance on pepper
ECW10R (He et al. 2007).
A CaseStudy – Screening for Candidate Type III Effectors from Draft Genomes and Possible Host Range Determinants.
Citrus canker is a disease that has severe economic impact on the citrus industry
worldwide. There are three types of canker, called A, B, and C. The three types have
different phenotypes and affect different citrus species. The causative agent for type A
is Xanthomonas citri subsp. citri, whose genome sequence was made available in 2002.
Xanthomonas fuscans subsp. aurantifolii strain B causes canker B and Xanthomonas
fuscans subsp. aurantifolii strain C causes canker C. We have sequenced the genomes
140
of strains B and C to draft status. We have compared their genomic content to X. citri
subsp. citri and to other Xanthomonas genomes, with special emphasis on type III
secreted effector repertoires.
The three citrus canker genomes have important differences in regard to their repertoires of type III secreted effectors
The hrp/hrc genes encoding the T3SS are basically the same and found in the
same order in all three Citrus Canker (CC) genomes. However, there are notable
differences in the three putative T3SS-secreted effector repertoires.
A list of twenty-seven T3SS effector genes predicted in the genomes of the CC
strains is shown in Table 5-5. Effectors are important determinants of virulence and host
range in many plant pathogenic bacteria, in particular in Xanthomonas sp. and
Pseudomonas syringae (Alfano and Collmer 2004). Comparison of effector repertoires
between the three CC genomes and all other Xanthomonas genomes can thus give us
important clues. The effector genes avrBs2, xopL, xopQ, and xopX are present in all
three CC genomes, in all sequenced genomes of other Xanthomonas species, and in all
X. citri and most Xanthomonas strains that were surveyed by PCR and hybridization for
these genes by Hajri et al. (2009). These effectors thus belong to the Xanthomonas
core set of effectors possibly important for pathogenicity on all plants. The putative
effector genes xopK, xopR, and xopZ also belong to this group since they can be found
in all sequenced Xanthomonas genomes. However, no data exist for these effectors in
regard to other Xanthomonas strains (Hajri et al. 2009). The effector genes xopI, xopV,
xopAD, and xopAK are present in all three CC genomes and in several, but not all,
sequenced Xanthomonas genomes. These effectors, therefore, might contribute to
disease in some plant species while they might trigger immunity in others.
141
As already mentioned, PthA is well known to be an important X. citri effector that
plays an essential role in citrus canker, while limiting the host range of CC strains to
citrus because it triggers immunity in all other tested plant species (see references
above). The pthA gene is a member of the avrBS3 family of effector genes, members of
which are present in most Xanthomonas genomes and in some R. solanacearum
genomes (Heuer et al. 2007). However, only PthA is known to induce citrus canker.
Besides pthA (XACb0065), three paralogs of pthA are also present in the Xac genome
(XACa0022, XACa0039, and XACb0015). All four copies are found on plasmids. The
three paralogs do not seem to play an important role in citrus canker (Swarup et al.
1991). We found two pthA homologs in the XauB genome (XAUB_40130 and
XAUB_28490) and two in the XauC genome (XAUC_22430 and
XAUC_24060/XAUC_09900 [the latter is a single gene with halves in different contigs]).
Not all of these genes have been completely assembled due to the repetitive regions
found in avrBS3 family members. However, El Yacoubi et al. (2007) previously
assembled a pthA homolog (pthB [GenBank: 2657482]) from the pXcB plasmid
[GenBank: NC_005240] of a XauB strain with the same repeat copy number (i.e. 17.5)
as pthA, and Al-Saadi et al. (2007) sequenced and assembled another homolog (pthC
[GenBank: EF473088]) from a XauC strain. These genes functionally complemented a
pthA deletion in Xac without affecting host range (Al-Saadi et al. 2007). The
XAUC_22430 gene has 99% nucleotide identity to pthC and thus probably corresponds
to pthC and would be the functional pthA homolog of XauC. We do not have enough
data to confidently report on the repeat copy number of the other three Xau pth
142
homologs, but a phylogenetic analysis (see below) suggests that XAUB_28490 is the
functional pthA homolog of XauB.
Effectors XopAI and XopE3 may play a role in citrus canker
A comparison of effectors present in all three CC strains with those present in fully
sequenced Xanthomonas species, and data from the study by Hajri et al. (2009),
suggest that two additional putative effectors may play a special role in citrus canker.
These are XopAI and XopE3. Both are present in all three CC genomes.
The putative effector xopAI is not found in any other sequenced Xanthomonas
species and it was not included in the Hajri et al. (2009) analysis. We do have evidence
that it is present in Xanthomonas vesicatoria str. 1111 (Potnis et al. 2011). Interestingly,
the C-terminal region of XopAI has similarity to predicted ADP-ribosyl transferase
domains of the effector HopO1-1 of Pseudomonas syringae and of hypothetical proteins
in Acidovorax citrulli, Ralstonia solanacearum, and other bacteria. The N-terminus has
high similarity to the N-terminus of the effector XopE2 of X. campestris pv. vesicatoria
85-10 as well the N-termini of a number of other Xanthomonas and Pseudomonas
syringae effectors (more on the N-terminal region of xopAI below).
XopE3 belongs to the HopX/AvrPphE family of effectors. Effectors belonging to
this family have been found in diverse phytopathogenic bacteria including Ralstonia,
Pseudomonas, Acidovorax, and Xanthomonas, suggesting their conserved role in
virulence on a wide range of hosts. Sequences from this family have similarity to the
transglutaminase superfamily of enzymes, which are responsible for modification of host
proteins (Nimchuk et al. 2007). The HopX/AvrPphE effector from Pseudomonas
syringae has been shown to be involved in host protein proteolysis, thereby suppressing
host defenses (Nimchuk et al. 2007; Schechter et al. 2004). In xanthomonads, multiple
143
effectors belonging to this group have been found, such as xopE1, xopE2, xopE3,
xopE4. XopE1 and xopE2 have been found in most of the xanthomonads. XopE3
effector gene homologs have been found by PCR and dot-blot hybridization methods in
some Xanthomonas axonopodis strains belonging to the alfalfae, anacardii, glycines,
phaseoli, malvacearum, fuscans, mangiferae, indicae, and citrumelo pathovars (Hajri et
al. 2009). However, sequences of xopE3 from these strains could not be compared
against homologs from CC strains since sequence data from the X. axonopodis strains
mentioned are not currently available. Phylogenetic analysis of hopX orthologs shows
that the xopE3 effector genes found in the CC strains group together with hopX1
effector genes from pseudomonads (data not shown).
Although all hopX orthologs show conservation of the catalytic triad (Cys, His, Asp
residues) as well as the conserved domain “GRGN” N-terminal to the triad, the region
C-terminal to the triad shows high degree of variability. This variable region has been
hypothesized to be responsible for targeting different host proteins (Nimchuk et al.
2007). In fact, while some AvrPphE (hopX) alleles from P. syringae pv. phaseolicola
strains trigger gene for gene disease resistance in some bean cultivars, other alleles
were shown to be virulent on these same cultivars. Amino acid differences in the C-
terminal region of AvrPphE were identified between alleles (Stevens et al. 1998).
Similarly, comparing XopE3 homologs from different strains at the amino acid level and
their corresponding reactions on different hosts might give clues regarding the variable
C-terminal domains of XopE3 family members and might determine whether this
variability is responsible for targeting different proteins in different host species.
144
Both xopE3 and xopAI belong to an interesting Xac chromosomal region of
approximately 15 kbp in size that has been hypothesized to be a genomic island
(Moreira et al. 2005). An alignment of the Xac chromosome sequence with the
chromosome sequences of X. campestris pv. campestris str. ATCC33913 and X. oryzae
pv. oryzae str. PX099A strongly suggests that this region is an insertion (data not
shown). The presence of three transposase genes and two phage-related genes in the
region provides additional evidence for this hypothesis. The central part of this region (7
kbp) duplicates a region found in Xac plasmid pXAC64, suggesting a chromosome-
plasmid DNA exchange. In the plasmid we find the effector gene xopE2 (XACb0011),
which - as described above - shares its N-terminal region with xopAI (XAC3230).
Transposons and phage elements in this region might thus have been responsible for a
shuffling process, described as terminal reassortment (Stavrinides et al. 2006),
resulting in the novel effector gene xopAI. Although we can characterize this region
completely only in Xac, XauB and XauC contigs contain the most important elements of
this region. Next to xopE3 (XAC3224) we find gene XAC3225, whose product is
annotated as tranglycosylase mltB. This gene has strong similarity (e-value 10-133,
100% coverage) to hopAJ1 from P. syringae pv. tomato strain DC3000, where it is
annotated as a T3SS helper protein. Although the hopAJ1 gene is not itself a T3SS
substrate, it contributes to effector translocation (Oh et al. 2007). A mutant with a
deletion of XAC3225 has reduced ability to cause canker (mutant phenotypes include a
reduction in water soaking, hyperplasia, and necrosis compared to wild type) (Laia et al.
2009). We thus conclude that the effector and effector-related genes in this region
probably play an important role in citrus canker.
145
Additional differences in effector repertoires among CC genomes
In addition to the pth differences noted above, other effectors that distinguish the
Xac genome from the two Xau genomes are XopB, XopE4, XopJ (AvrXccB), XopAF
(avrXv3), and XopAG, which are all present in both Xau genomes but absent from Xac
strain 306. (AvrXccB homologs were found in two Xac strains by Hajri et al. (2009). The
absence of these effectors from Xac strain 306 raises the possibility that these effectors
might be responsible for limiting the host range of both B and C strains. Interestingly,
XauB and XauC strains both contain xopAG, an effector gene belonging to the same
effector family as avrGf1 from X. citri Aw, which has been shown to be responsible for
triggering a hypersensitive defense response in C. paradisi (grapefruit) (Rybak et al.
2009). The xopAG gene from the B and C genomes shows 44% identity to avrGf1 at the
amino acid level. The XauB and and XauC genes are almost identical to each other,
with one important difference: in XauB xopAG is interrupted by a transposon. Therefore,
the incompatibility between XauC and grapefruit and the ability of XauB to cause
disease in grapefruit could be explained by this single gene difference. The xopE4 DNA
sequence is identical in the two Xau genomes and has similarity to avrXacE3 but only
with 31% identity at the amino acid level; this is why we named this gene xopE4 instead
of xopE2. Unlike other XopE family members, XopE4 does not have a predicted
myristoylation site, suggesting that it may not be targeted to the cell membrane as the
other XopE family members.
Presence of an additional effector gene, the avirulence gene avrXccA2, has been
shown in some X. aurantifolii B (CFBP3528, CFBP3530) and X. aurantifolii C
(CFBP2866) strains by hybridization and PCR analysis (Hajri et al. 2009). However, this
avirulence gene was not found in the two sequenced Xau genomes. A homolog of the
146
effector xopF1 (XAUC_20070) was found only in the XauC strain. It is located in a 5-kbp
region that lies between the T3SS genes hrpW (XAUC_20020) and hpa3
(XAUC_20080). The same two genes are adjacent in XauB. Two transposases are
present in this region, and the sequence of xopF1 has a frameshift, suggesting that this
gene is likely the result of a recent insertion and is not active.
There are four effector genes present in the Xac and XauB genomes that have not
been found in the genome of XauC: xopE2, xopN, xopP, and xopAE. These effectors
could explain the wider host range of Xac and XauB compared to XauC, assuming a
virulence activity of these effectors on citrus species. XopN has been shown to interact
with the plant protein TARK1 and to interfere with immunity triggered by pathogen-
associated molecular patterns (PAMP-triggered immunity) (Kim et al. 2009). Further
experiments are required to determine the possible role of XopN in extending host
range to lemon, grapefruit and sweet orange. Another effector that could have a similar
role is XopAE (a hpaF/PopC homolog) (Noel et al. 2002; Sugio et al. 2005).
The harpin-like protein HrpW with a pectate lyase domain is present in all CC
strains. In the sequenced Xac genome, it is not associated with the T3SS gene cluster,
whereas in the genomes of XauB and XauC it is. The role of harpin-like proteins like
HrpW as virulence factors or T3SS accessory proteins has not yet been determined in
the Xanthomonas genus.
Experiments will need to be performed to confirm translocation of the above
putative effectors and their putative function as virulence or avirulence genes.
Adhesins
As with many bacteria, Xanthomonas spp. synthesise adhesins of both the fimbrial
and non-fimbrial classes that are involved in bacterial attachment to surfaces and
147
contribute to virulence (Ray et al. 2002; Das et al. 2009; Gottig et al. 2009). The non-
fimbrial adhesins include filamentous haemagglutinin-like proteins such as FhaB,
homologues of the autotransporter adhesin YapH from Yersinia spp. and XadA and
XadB, which are both related to YadA from Yersinia spp. Fimbrial adhesins include type
IV pili and related proteins such the the type IV pilus secretin PilQ (Ray et al. 2002; Das
et al. 2009; Gottig et al. 2009). It has been shown for Xanthomonas oryzae pv. oryzae
that different adhesins are preferentially involved in the different stages of infection that
comprise attachment to leaf surfaces, entry, colonization and later survival inside plant
tissue (Das et al. 2009). For example, XadA and XadB affect leaf attachment and entry
into the host, but do not affect virulence after wound inoculation whereas PilQ appears
to have no role on leaf attachment or entry but has a role when bacteria are within
plants. In contrast, FhaB is involved in virulence both in epiphytic and wound
inoculations of Xanthomonas axonopodis pv. citri (Gottig et al. 2009). Comparative
genome analysis indicates that FhaB is absent in some strains of Xanthomonas
campestris pv. campestris and Xanthomonas oryzae pv. oryzae and in Xanthomonas
campestris pv. vesicatoria there are two related open reading frames, FhaB1 and
FhaB2. Two copies of xadA and yapH are found in Xanthomonas campestris pv.
campestris strain 306 and in Xanthomonas campestris pv. vesicatoria 85-10; two copies
two copies of yapH are also present in present In Xanthomonas oryzae pv. oryzae
KACC, and there are two pilQ orthologs in Xanthomonas campestris pv. vesicatoria 85-
10 (Xcv). Although different combinations of adhesins in each species might indicate
their specificity towards host tissues as has been speculated for Ralstonia
solanacearum (Guidot et al. 2007), no clear relationship is evident.
148
Lipopolysaccharides and Xanthan
Both lipopolysaccharides (LPS) and the extracellular polysaccharide xanthan
contribute to the ability of Xanthomonas spp. to cause disease (Qian et al. 2005; Chou
et al. 1997; Rajeshwari and Sonti 2000; Kingsley et al. 1993). A lipopolysaccharide
biosynthesis gene cluster defined by a 14-26 kb region flanked by etfA and metB is
highly variable in terms of identity and size across sequenced xanthomonads. This
variability is seen not only at the species and pathovar level but also between strains,
suggesting very recent horizontal gene transfer (Patil et al. 2007). However, a
comparative study for this cluster among sequenced xanthomonads indicated that
variation in the LPS biosynthesis cluster was not associated with host or tissue
specificity (Lu et al. 2008). The gum gene cluster comprises 12 genes, gumB to gumM,
that encode proteins involved in the synthesis and secretion of xanthan, a
polysaccharide characteristic of the genus Xanthomonas which is important for
virulence (Qian et al. 2005 Chou et al. 1997; Rajeshwari and Sonti 2000). The gum
cluster is absent from Xanthomonas albilineans (Pieretti et al. 2009) whereas Xylella
fastidiosa lacks some of the gum genes but is capable of synthesis of a related
polysaccharide that lacks the terminal mannose residues and is not pyruvylated.
Toxins
The production of toxins in Xanthomonas species is currently thought to be
restricted to Xanthomonas albilineans, which produces albicidin, an important virulence
factor (Pieretti et al. 2009). Albicidin is synthesised by a non-ribosomal pathway via a
hybrid modular nonribosomal peptide synthase- polyketide synthase (NRPS-PKS).
NRPSs related to SyrE, which is responsible for the synthesis of the phytotoxin
syringomycin in Pseudomonas syringae, are encoded by the genomes of Xanthomonas
149
axonopodis pv. citri (Van Sluys et al. 2002) and Xanthomonas oryzae pv. oryzicola
(unpublished data). Whether these direct synthesis of toxins is however not known. A
second NRPS found in several Xanthomonas species is related to EntF, which is
involved in the synthesis of the siderophore enterobactin in Escherichia coli.
Concluding Remarks
We have discussed the insights afforded by comparative genomics into the
pathogenesis, adaptation to host plants and evolutionary trends of Xanthomonas, the
impact that knowledge of genome sequences has made to functional genomics and the
new tools that have been developed to derive further benefits from the wealth of
information available.
The analysis of genomic data from phytopathogenic bacteria has remarkably
expanded the repertoire of genes thought to contribute to virulence in plants. These
genes encode proteins involved in a range of cellular functions including adhesion,
phytotoxin production, resistance to oxidative stress, degradation of plant cell walls,
production of plant hormones, production and injection of effector proteins into host cells
and interference with host defences. Comparative genomic analysis between
Xanthomonas spp. has revealed both the conservation of certain genes and gene
clusters associated with virulence as well as differences in genetic content that may be
related to host and/or tissue specificity. It is evident that differentiation with respect to
host- and tissue-specificity does not involve major modifications or wholesale exchange
of pathogenicity gene clusters, but is associated instead with subtle changes in a small
number of genes within these clusters, and/or differences outside the clusters,
potentially among secretory substrates or regulatory targets.
150
Table 5-1. Xanthomonas species and pathovars within species show host and tissue-specificity. Species
Pathovar
Strain
Strain abbreviation
Host
Disease Genome size (Mb)
Plasmids
Status Reference
X. campestris
campestris
ATCC 33913 Xcc Crucifiers
Black rot
5.08 n.a. Complete da Silva et al. 2002
X. campestris
campestris
8004 Xcc Crucifiers
Black rot
5.15 n.a. Complete Qian et al. 2005
X. campestris
campestris
B100 Xcc Crucifiers
Black rot
5.1 n.a. Complete Vorholter et al. 2008
X. campestris
armoraciae 756C Xca Crucifiers
Leaf spot
4.94 n.a. Complete Unpublished
X. campestris
musacearum NCPPB4381 Xvm Banana Enset wilt
4.7 Complete Unpublished
X. campestris (vasicola)
vasculorum NCPPB702 Xvv Sugarcane
Gumming disease
5.4 n.a. Complete Studholme et al. 2010
X. euvesicatoria
85-10 Xcv Tomato/ pepper
Leaf spot
5.42 pXCV38; pXVC2; pXCV19; pXCV183
Complete Thieme et al. 2005
X. oryzae oryzae KACC10331 Xoo Rice Bacterial blight
4.94 n.a. Complete Lee et al. 2005
X. oryzae oryzae PXO99A Xoo Rice Bacterial blight
5.2 n.a. Complete Salzberg et al. 2008
X. oryzae oryzae MAFF 311018 Xoo Rice Bacterial blight
4.94 n.a. Complete Ochiai et al. 2005
X. oryzae oryzae AX01947 Xoo Rice Bacterial blight
5.1 Draft Unpublished
151
Table 5-1. continued Species
Pathovar
Strain
Strain abbreviation
Host
Disease Genome size (Mb)
Plasmids
Status Reference
X. axonopodis
citri 306 Xac Citrus Citrus canker
5.27 pXAC64;PXCC33
Complete da Silva et al.2002
X. axonopodis
phaseoli Xap Beans Bacterial blight
n. a Draft Unpublished
X. axonopodis
manihotis Xam Cassava Bacterial blight
n. a. Draft Unpublished
X. fuscans aurantifolii ICPB 11122 Xaub Citrus Citrus canker
4.7 n.a. Draft Moreira et al. 2010
X. fuscans aurantifolii ICPB 10535 Xauc Citrus Citrus canker
5.0 n.a. Draft Moreira et al. 2010
X. oryzae oryzicola BLS256 Xoc Rice Bacterial streak
4.8 n.a Draft Unpublished
X. vesicatoria ATCC35937 Xv Pepper and Tomato
Bacterial spot
5.4 Draft Potnis et al. 2011
X. perforans 91-118 Xp Tomato Bacterial spot
5.1 Draft Potnis et al. 2011
X. gardneri ATCC19865 Xg Pepper and Tomato
Bacterial spot
5.4 Draft Potnis et al. 2011
X. albilineans GPE PC73 Xal Sugarcane
Leaf scald
3.77 n.a. Complete Pieretti et al. 2009)
152
Table 5-2. Xop nomenclature for xanthomonas effectors Effector class
Related proteins/ synonyms
Xoo MAFF311018
Xac 306
Xcv 85-10
Xcc
ATCC33913 Xoo AXO1947
Xcmu /Xvm
Xp 91-118
AvrBs1 AvrA N N XCVd0104 XCC2100 N N N AvrBs2 XOO0148 XAC0076 XCV0052 XCC0052 + + + AvrBs3 Pth, TAL 17 genes 4 genes Y (P14727) N ~8
genes N N
XopB (HopD1)
N N XCV0581 N N + N
XopC RSp1239 XOO3221 XAC1210/ XAC1209g
XCV2435 XCV1238/ XCV1237g
Yf (ACS12858)
+ + +
XopD N N XCV0437 XCC2896 N N + XopEh (HopX)
AvrPphE AvrXccE1 HopPmaB
N XAC0286 (E1) XAC3224 (E3) XACb0011(E2)
XCV0294(E1) XCV2280(E2)
XCC1629 (E2)
N N + +
XopFh Hpa4 XOO0103(F1)
XAC2785(F2)
XCV0414 (F1) XCV2942 (F2)
XCC1218 (F1)
+ +
+ +
XopG (HopH,HopAP)
AvrPtoH XOO4258 N XCV1298 XCC3258 N + N
XopH (HopAO)
AvrBs1.1 HopPtoD2
N N XCVd0105 XCC2099 N N N
XopI XOO3626 XAC0754 XCV0806 N + + +
153
Table 5-2. continued Effector classa
Related proteins/ synonyms
Xoo MAFF311018
Xacb 306
Xcvb 85-10
Xcc
ATCC33913 Xoo AXO1947
Xcmu /Xvm
Xp 91-118
XopJ (HopJ)
YopJ, AvrRxv AvrXv4, AvrBsT
N N XCV2156 XCV0471 Y (AAD39255)
Y
XCC3731 N + N
XopK XOO1669 XAC3085 XCV3215 XCC2899 + + +
XopL XOO1662 XAC3090 XCV3220 XCC4186 + + +
XopMi +
XopN (HopAU)
XOO0315 XAC2786 XCV2944 XCC0231 + + +
XopO (HopK)
AvrRps4 N XAC3666 XCV1055 XCV3786
N + + +
XopP XOO3222 XAC1208 XCV1236 XCC1247 + + +
XopQ (HopQ)
XOO4208 XAC4333 XCV4438 XCC1072 + + +
XopR XOO4134 XAC0277 XCV0285 XCC0258 + + +
XopSg +
XopT XOO2210 NA, I N N N N N
XopU XOO2877 N N N + N N
XopV XOO3803 XAC0601 XCV0657 N + + +
XopW XOO0037 N N N + N N
XopX XOO4042 XAC0543 XCV0572 XCC0529 XCC0530
+
+ +
+ +
XopY XOO1488 N N N + + N
154
Table 5-2. continued Effector classa
Related proteins/ synonyms
Xoob MAFF311018
Xac 306
Xcvb 85-10
Xcc
ATCC33913 Xoo AXO1947
Xcmu /Xvm
Xp 91-118
XopZ (HopAS)
AWR XOO2402 XAC2009 XCV2059 XCC1975 + + +
XopAA (HopAE)
ECF, HolPsyAE
XOO2875 N XCV3785 N + + N
XopAB XOO3150 N N N + + +
XopAC AvrAC N N N XCC2565 N N N
XopAD skwpj (BAH47290)
XOO4145 XAC4213 XCV4315/ XCV4314/ XCV4313g
N + + +
+
XopAE HpaF PopC
XOO0110 XAC0393 XCV0409/ XCV0408
N + + +
XopAF (HopAF)
AvrXv3 N N N N N + +
XopAG (HopG)
AvrGf1 N Y (ABB84189) N XCC3600 N +
N
XopAH AvrXccC AvrB, AvrC
N N N XCC2109 N N N
XopAI (HopO1)
N XAC3230 N N N N N
XopAJ AvrRxo1 N N XCV4428 N N N N
155
Table 5-3. Core effector genes from xanthomonads and their role in pathogenicity/ induction of resistance Core Effectors Functional domain/ motif Phenotype of mutant Possible role in
pathogenicity/ Induction of resistance
References
XopR Unknown Similar to wild type Xoo str. PXO99
Does not contribute individually to virulence in Xoo- rice system
Song et al. 2010; Furutani et al. 2009
AvrBs2 Sequence related to agrocinopine synthase, glycerol phosphodiesterase
Mutation in Xcv resulted in loss of avirulence, reduced virulence on pepper
Important for pathogen fitness; dual role in recognition and pathogenicity Bs2 (unusual member of NBS-LRR R gene family that does not have TIR or LZ domain.
Swords et al. 1996; Kearney and Staskawicz 1990; Wichman and Bergelson 2004.
XopK Unknown Similar to wild type Xoo PXO99
Does not contribute individually to virulence in Xoo-rice system
Song et al. 2010; Furutani et al. 2009
XopL LRR protein Mutant in Xcc less virulent on Chinese radish; However In Xoo, similar to wild type
Required for full virulence of Xcc on Chinese radish; But Does not contribute individually to virulence in Xoo-rice system
Jiang et al. 2009, Song et al. 2010.
XopN Alpha-helical ARM/HEAT repeats, Irregular alpha- helical repeats suggesting multiple protein-protein interactions.
Mutants in Xcv impaired in growth and reduced ability to elicit disease symptoms on susceptible tomato leaves.Also, virulence factor in Xcc.
Reduces PAMP-induced gene expression and callose deposition in host tissue.Interacts with cytoplasmic domain of TARK1 and 4 tomato 14-3-3 isoforms- TFT1, TFT3, TFT5, TFT6.
Roden et al. 2004b; Jiang et al. 2008; Kim et al. 2009.
156
Table 5-3. continued Core Effectors Functional domain/
motif Phenotype of mutant Possible role in pathogenicity/
Induction of resistance References
XopP Unknown No change in phenotype for Xoo PXO99 xopP mutant; No significant growth defect in Xcv mutant; Required for full virulence and growth of Xcc 8004 in Chinese radish
Virulence factors in Xcc-chinese radish system
Roden et al. 2004b; Jiang et al. 2009; Song et al. 2010
XopQ Inosine-uridine nucleoside N-ribohydrolase
No significant growth defect in Xcv mutant; Required for full virulence and growth of Xcc 8004 in Chinese radish
Virulence factors in Xcc-chinese radish system
Roden et al. 2004; Jiang et al. 2009
XopX Methionine-rich protein
Reduced in planta growth of Xcv in tomato and pepper
Virulence factors; targets basic innate immunity in plants by suppressing host defense function, which in turn allows for greater pathogen growth and an altered visual high titer inoculation response by N. benthamiana; Elicits non-host resistance reaction in N. benthamiana in presence of active T3SS.
Metz et al. 2005
XopZ Unknown Mutations in both the copies in PXO99 reduced virulence in terms of lesion length and bacterial multiplication in rice. Single copy mutation does not show visible change in symptoms.
Interferes with host innate immunity/ suppresses host basal defense responses.
Song et al. 2010
157
Table 5-4. Variable effectors which contribute to the pathogenicity Variable Effector genes
Functional domain/ motif Possible role in pathogenicity/ Induction of resistance
Distribution References
AvrBsT
(XopJ2)
C55 family cysteine protease, ser/thr acetyl
transferase
Responsible for cell death in pepper, but virulence factor in tomato.
Interacts with SnRK1 and suppresses HR elicited by avrBs1 in resistant peppers.
Certain Xcv strains (Plasmid borne)
Kim et al. 2010; Szczesny et al. 2010;
XopC Phosphoribosyl transferase domain and haloacid dehalogenase-like hydrolase
No significant growth defect in Xcv mutant on tomato/pepper,
No change in phenotype in Xoo PXO99 mutant(xopC2)
Only in Xcv (xopC);
Only in Xoo strains (xopC2- inactivated version in Xac, Xcv)
Roden et al. 2004; Song et al. 2010
XopF1 Unknown No significant growth defect in Xcv mutant on tomato/pepper
Xcv, Xca, Xoo, Xoc, Xvv, Xvm.
Roden et al. 2004
XopF2 Unknown No significant growth defect in Xcv mutant on tomato/pepper
Xcv, Xvm, Xvv Roden et al. 2004
XopJ C55-family cysteine protease or Ser/Thr acetyltransferase
No significant growth defect in Xcv mutant on tomato/pepper
Xcv Roden et al. 2004
XopO Unknown No significant growth defect in Xcv mutant on tomato/pepper
Xcv, Xoc Roden et al. 2004
158
Table 5-4. continued Variable Effector genes
Functional domain/ motif Possible role in pathogenicity/ Induction of resistance
Distribution References
XopAE LRR protein Role in virulence and disease symptomalogy in X. axonopodis pv. glycines (Xag)
Xag, Xac, Xoo, Xoc, Xvm, Xvv. (hpaG/hpaF pseudogene in Xcv)
Kim et al. 2003
XopAH
(AvrXccC)
Unknown Required for full bacterial virulence in the susceptible host cabbage (Brassica oleracea) and avirulence in the resistant host mustard (Brassica napiformis L.H. Baily).
Only in Xcc Wang et al. 2007b
XopE2 Putative transglutaminase
Required for full virulence and growth of Xcc 8004 in Chinese radish
Xcv, Xac and Xcc Jiang et al. 2009
XopAM Unknown Required for full virulence and growth of Xcc 8004 in Chinese radish
Xcc, Xvm, Xvv. Jiang et al. 2009
PthA/AvrBs3 family
Transcriptional activator Activate host genes e.g. hypertrophy related to virulence, resulting in pathogen spread and disease
Xac, Xoo, Xcv, Xg Yang et al. 2004, 2005; Sugio et al. 2007; Schornock et al. 2008
XopD C48-family SUMO cysteine protease; EAR motif; DNA-binding and nuclear localization domain
Virulence factor that mimics plant SUMO isopeptidase, targets SUMO-conjugated protein and interferes with regulation of host proteins, promotes pathogen multiplication and delays symptom development.
Xcv, Xcc str. B100.
(Chimeric version in Xcc str. 33913, 8004)
Kim et al. 2008; Noel et al. 2002; Hotson et al. 2003; Chosed et al. 2007
159
Table 5-5. Putative effectors found in the XAC, XauB, and XauC genome sequences. Some of the effectors appear to be pseudogenes (indicated by a Ψ). In column ‘effector family’ we provide the standard effector name along with the names of related proteins belonging to the same family; in column ‘effectors’ we provide the reference where the effector indicated was characterized.
Effector family XAC XauB XauC Pfam: functional/ structural domain
References
Candidate effectors common to XAC, XauB, and XAUC
AvrBs2 XAC0076 XAUB_16770 XAUC_23650 Glycerophosphoryl diester
phosphodiesterase
Kearney and Staskawicz 1990.
AvrBs3 XACa0022 (pthA1)
XACa0039 (pthA2)
XACb0015 (pthA3)
XACb0065 (pthA4)
XAUB_40130 XAUB_28490
XAUC_22430 XAUC_24060 XAUC_09900 XAUC_43080
Transcriptional activator, nuclear
localization
Al-Saadi et al. 2007
XopE1 (avrXacE1, hopX, avrPphE)
XAC0286 XAUB_37010 XAUC_37580 Putative transglutaminase
Thieme et al. 2007
XopE3 (avrXacE2, hopX, avrPphE)
XAC3224 XAUB_14680 XAUC_00040 Putative transglutaminase
Dunger et al. 2008
XopF2 XAC2785 Ψ XAUB_07540 /XAUB_07550 Ψ
XAUC_21010 Ψ /21000 Ψ
Gurlebeck et al. 2006
XopI XAC0754 XAUB_39080 XAUC_07100 F-box protein Thieme 2008
XopK XAC3085 XAUB_34090 XAUC_12520 Identified in Xoo by cya assay Furutani et al.
2009 XopL XAC3090 XAUB_34130 contig1165 (725-
3) and XAUC_02900
LRR protein Dunger et al. 2008
160
Table 5-5. continued Effector family XAC XauB XauC Pfam: functional/
structural domain Effectors
XopQ (hopQ1) XAC4333 XAUB_10220 XAUC_14670 Inosine uridine nucleoside N-ribohydrolase
Roden et al. 2004
XopR XAC0277 XAUB_36920 XAUC_37490 Furutani et al. 2009
XopV XAC0601 XAUB_23140 XAUC_21260 Identified in Xoo by cya assay Furutani et al.
2009 XopX (HolPsyAE) XAC0543 XAUB_14760 XAUC_20690 Metz et al. 2005
XopZ (HopAS, AWR) XAC2009 Ctg607 (28419-29915) and
XAUB_13710
Ctg1224 (21120-16957)
Furutani et al. 2009
XopAD (skwp, RSc3401)
XAC4213 XAUB_02510 XAUC_34870 SKWP repeat protein Skwp from Ralstonia Guidot
et al. 2007 XopAI (HopO1 (HopPtoO, HopPtoS), HopAI1 (HolPtoAI))
XAC3230 XAUB_26830 XAUC_23780 ADP-ribosyltransferase Thieme et al. 2007
XopAK (HopAK1 (HopPtoK, HolPtoAB)C terminal domain)
XAC3666 XAUB_02580 XAUC_32490 Not confirmed to be effector in
Xanthomonas; homolog of effector in
Pseudomonas HrpW (PopW) XAC2922 XAUB_19460
(associated with hrp cluster)
XAUC_20020 (associated with
hrp cluster)
Pectate lyase, may not be T3SE
Park et al. 2006
Candidate effectors present in XAC and XauB BUT ABSENT in XauC
XopE2 (avrXacE3, avrXccE1)
XACb0011 XAUB_31660 - Putative transglutaminase
XopE2 found in another C strain Thieme et al. 2007
161
Table 5-5. continued Effector family XAC XauB XauC Pfam: functional/
structural domain Effectors
XopN (hopAU1) XAC2786 XAUB_07520 - ARM/HEAT repeat Kim et al. 2009
XopP XAC1208 XAUB_06720 - Roden et al. 2004
XopAE (HpaF/G/PopC)
XAC0393 XAUB_19500 - LRR protein Noel et al. 2002
Candidate effectors present in XauB and XauC BUT ABSENT from XAC
XopB (hopD1, avrPphD1)
- (ctg622 (24545-24841) and ctg594 (2-745)
XAUC_00260 Noel et al. 2001
XopE4 (HopX) - XAUB_23330 XAUC_31730 New class introduced
XopJ (AvrXccB) - XAUB_20830 XAUC_08850 C55-family cysteine protease or Ser/Thr acetyltransferase
Xu et al. 2004
XopAF (avrXv3, HopAF1 (HopPtoJ))
- XAUB_02310 XAUC_00300 Astua-Monge et al. 2000a
XopAG (AvrGf1, HopG1 (HopPtoG). HolPtoW)
- Ctg529 (1957-2856)
XAUC_04910 Rybak et al. 2009
Candidate effectors present only in XauC
XopF1 (Hpa4) - - XAUC_20070 Ψ /20060 Ψ
Roden et al. 2004
162
CHAPTER 6 SUMMARY AND DISCUSSION
Bacterial spot disease is a devastating disease on tomato and pepper and has
been responsible for significant losses. Prior to 1995, Xanthomonas causing bacterial
spot was classified under a single species, Xanthomonas campestris pv. vesicatoria.
Jones et al. (2004) carried out multiphasic analysis based on biochemical and molecular
analyses and classified bacterial spot xanthomonads into four different genetic groups
A, B, C and D under species namely, Xanthomonas euvesicatoria, X. vesicatoria, X.
perforans, X. gardneri. All genetic groups infect tomato. Groups A, B and D infect
pepper as well. Avirulence gene avrXv3 responsible for limiting host range of X.
perforans on pepper has been identified (Astua-Monge et al. 2000a). However, avrXv3
deletion mutant is not completely virulent on pepper, indicating there are some
additional factors responsible for host range specificity. Xcv str.85-10 belonging to A
group has already been sequenced (Thieme et al. 2005). In order to get insights into the
host range specificity and diversity among the four groups, we sequenced genomes of
the strains belonging to the B, C and D groups.
Whole genome comparison using MUMmer and phylogenetic analysis based on
orthologous genes showed that Xp is closely related to Xcv; whereas Xg and Xv are
more closely related to Xcc. We compared different pathogenicity clusters from draft
genomes to the already sequenced xanthomonads. Type II and type III secretion
clusters of the two bacterial spot pathogens, Xg and Xv, were similar to Xcc in terms of
genetic organization and sequence identity. Type III secreted effectors are important
pathogenicity factors and host range determinants. Effectors are translocated into the
plant cell and they interfere with the plant immune responses favoring pathogen
163
survival, multiplication, and spread. Using a bioinformatics approach and experimental
validations, we screened the three bacterial spot draft genomes for effectors and found
interesting similarities and differences in the effector repertoires of the bacterial spot
xanthomonads. Common effectors like XopF1 and XopD are important pathogenicity
candidates on tomato. XopD has been shown to delay symptom development and
hence plays a potential role in the development in pathogen survival. Like tomato
specific pathogenicity factors, we found effectors common to pepper pathogens and
absent from Xp, namely xopE2 and xopG. We identified some unique effectors from Xg.
These include xopAO, xopAQ, xopAS and an avrBs1 member XGA_0724. Homologs of
xopAS, xopAO, and XGA_0724 are found in pseudomonads infecting tomato. Based on
the evidence of horizontal gene transfer along with the fact that Xg prefers lower
optimum temperature for disease development similar to pseudomonads, we can
speculate on the acquisition of these effectors in Xg from pseudomonads. Along with
the novel effectors, we found a few other virulence factors, homologs of which have
been identified and characterized in other plant pathogens. Xg appears to be
aggressive on pepper. The unique effectors and other virulence factors could explain
the aggressive nature of Xg.
The genomic analysis also provided candidates for pepper pathogenicity factors,
one of them being LPS O-antigen. Comparison of the LPS clusters between the four
species showed similar organization for all pepper pathogens, while Xp seems to have
acquired a novel LPS cluster during evolution. This novel cluster might be responsible
for limited host range of Xp. Another possibility is that common LPS antigen of pepper
pathogens might be the factor involved in pepper specificity. We tested three candidate
164
genes (LPS O-antigen, xopG, and a hypothetical protein XCV1839) experimentally for
their ability to increase in planta growth on pepper by conjugating candidate genes
individually and in combination in Xp ∆avrXv3 mutant. LPS cluster from pepper
pathogens contributes towards increased in planta growth of Xp ∆avrXv3 mutant on
pepper.
The computational predictions based on draft genome sequences of bacterial spot
pathogens have offered a wide scope for the studies involving experimental verification
of potential role of the candidate virulence factors and implementation of the essential
ones in the development of control strategies and breeding for durable resistance.
Screening for durable resistance continues to be a challenge due to plant-
pathogen co-evolution. While screening different Capsicum genotypes, Capsicum
chinense showed a new source of resistance against several strains of bacterial spot
xanthomonads. In an interspecific cross, this new resistance was transferred to
Capsicum annuum cv. Early Calwonder (ECW). The resistance gene was then
segregated in a backcross program and 7th backcross population (ECW-70R) was used
to determine genetic inheritance of the resistance.
X. gardneri strain Xv444 gave a strong HR on ECW-70R. We isolated a clone from
a genomic library of Xv444 showing an avirulence phenotype on ECW-70R by
mobilizing a library of Xv444 into the virulent, recipient strain, Xg51. The ORF showing
avirulence activity was referred to as avrBs7. Group A strain Xcv 85-10 shows a
delayed HR on the leaves of ECW-70R. Avirulence gene avrBs7 shows 67% identity at
amino acid level to avrBs1.1 from Xcv str. 85-10. Inoculation of Xg51 transconjugants
carrying avrBs1.1 showed delayed HR on ECW-70R confirming avirulence activity.
165
Segregation analysis of F2 population indicated that this resistance trait in ECW-70R is
controlled by single dominant resistance gene, which we designated as Bs7.
Comparing in-planta bacterial growth and electrolyte leakage indicating tissue
damage showed significant differences between transconjugants carrying avr clones
and the virulent wild type strain confirming that AvrBs7 and AvrBs1.1 were responsible
for eliciting HR on ECW-70R. Sequence analysis of both avr genes revealed the
presence of a consensus PTP active site domain (HCGVGQGRTG for AvrBs7 and
HCGMGLGRTT for AvrBs1.1) along with possible general acid motif (TVTDH) 24 amino
acids upstream in the carboxy-terminal regions of both avirulence genes. Alanine
mutants at the catalytic site of AvrBs7 did not elicit HR on ECW-70R indicating
importance of tyrosine phosphatase domain in recognition of the avr protein by Bs7
gene transcripts. In order to explain the differences in the timing of HR elicitation by the
two avr genes, we constructed a fusion protein exchanging AvrBs7 catalytic site with
AvrBs1.1 catalytic site. Exchanging catalytic domains abolished HR activity. AvrBs7 and
AvrBs1.1 possess more or less similar three-dimensional structure.
The newly identified resistance gene Bs7 is effective against few of the tested A, B
and D group strains. Avirulence gene avrBs7 has is found only in D group X. gardneri
strains, while avrBs1.1 is present among A and B group strains. However, the avr genes
appear to be located on the plasmid, making it easier for the pathogen to lose the avr
gene and attain virulence. Future studies will be focused on characterization of motifs in
the avr genes and their role in pathogenicity.
Type III effectors are secreted and translocated into the host cell via a specialized
type III secretion system. The process of translocation of effectors is highly regulated.
166
Effectors are believed to contain secretion and translocation signals in the N-terminal
region that direct them through the secretion apparatus. In xanthomonads, these two
signals are not well characterized. The characteristic features of such signals have been
used in the identification of effectors from other plant pathogens e.g. pseudomonads.
We compared the predictive rules for N terminal signal sequences from pseudomonads
to that of xanthomonads and we found that although a few Xanthomonas effectors
contain Pseudomonas effector-like features, the majority of the amino acid bias features
do not strictly follow for Xanthomonas effectors, indicating the need to develop separate
predictive rules and programs for screening type III effectors using signal features.
Based on amino acid biases in N-terminal region of Xanthomonas effectors, we
searched for motifs and corresponding matrices of each motif were searched within
whole genomes using C-based program. Although we could identify all the known
effectors, the program also identified type II and type IV secreted proteins with high
score hit indicating that false positive and negatives could not be avoided with this
program as well. We used the same program to screen our three bacterial spot
Xanthomonas draft genomes. Candidate effectors were tested for their translocation
using in planta avrBs2 reporter gene assay. We identified 2 novel effectors, xopZ2,
xopAO.
In order to narrow down the location of translocation signal of the Xanthomonas
effectors, we selected effector XopF1 as a model. Based on comparative genomic
analysis, XopF1 appears to be a tomato-specific effector. It also has been shown to be
dependent on chaperone HpaB for its translocation. Without HpaB binding, it is not
translocated into the host cell (Buttner et al. 2006). HpaB is an important pathogenicity
167
factor in xanthomonads, hence HpaB dependent effectors also must be playing
important role in the initial steps of pathogen infection. We were interested in identifying
the translocation signal and HpaB binding site in XopF1. The first 70 amino acids of
XopF1 fused to reporter gene avrBs262-574 elicited an HR on ECW-20R in in-planta
assay, indicating that first 70 amino acids of XopF1 are sufficient for translocation and
hence contain translocation signal as well as HpaB-binding site. However, the first 40
amino acids were not sufficient to deliver the reporter into the plant cell. The first 40
amino acids of XopF1 either lack translocation signal or they lack an HpaB binding site.
Another possibility that the translocation signal and HpaB binding site could be
overlapping and absent in first 40 amino acids can’t be disregarded, especially in case
of chaperone-dependent effectors. The secondary structure analysis of XopF1 showed
presence of two alpha helices, one from amino acid 27 through 33 and another from
amino acid 47 through 59. According to the effector-chaperone interaction models
proposed by Lilic et al. (2006); alpha helices and β motif residues are involved in the
interaction. We found β motif residues in the second helix region. Alanine mutants
carrying mutations at both sites, 27 through 33 and 47 through 59 were tested by in-
planta assay for their ability to deliver reporter gene into the plant cell and elicit HR on
ECW-20R. Both the mutants failed to elicit HR on 20R indicating that either they had
lost HpaB-binding site or translocation signal due to mutations. To confirm the HpaB-
XopF1 protein-protein interaction, we carried out in vitro experiments namely, yeast two-
hybrid assay and pull-down assay. In both in-vitro experiments, weak binding of HpaB
to XopF1 alanine mutants was observed. Based on in-vitro and in-planta results, we can
speculate the model for XopF1 and HpaB interaction. HpaB could be binding to XopF1
168
in the alpha helix region and β motif and directing it to the translocation apparatus. In-
vitro, HpaB could be binding to the alanine mutants but complex may not be stable and
active and hence not translocated in in-planta assay.
Such a model for effector-chaperone interaction for Xanthomonas system will
highlight the role of chaperones in regulating the type III effector translocation and in
turn regulation of pathogenicity during the infection process.
Apart from studying genomics of bacterial spot xanthomonads, we also analyzed
other 15 available Xanthomonas genomes infecting different plant species including
dicots and monocots. Diversity among xanthomonads is reflected in their genome
organization and the repertoires of pathogenicity genes. We analyzed different
pathogenicity clusters among these xanthomonads with respect to their core function in
pathogenicity and host as well as tissue specificity. Certain pathogenicity genes, a
majority of which are type III effectors, could be associated with their preference on
particular hosts. Knowledge based on these analyses could serve as basis to
experimentally verify role of such genes in disease progression, host preference, and
evolution of xanthomonads and efforts could be directed towards better understanding
of plant-pathogen interaction and designing durable disease control strategies.
169
LIST OF REFERENCES
Alavi, S. M., Sanjari, S., Durand, F., Brin, C., Manceau, C., and Poussier, S. 2008. Assessment of the genetic diversity of Xanthomonas axonopodis pv. phaseoli and Xanthomonas fuscans subsp. fuscans as a basis to identify putative pathogenicity genes and a type III secretion system of the SPI-1 family by multiple suppression subtractive hybridizations. Appl Environ Microbiol. 74:3295-3301.
Alfano, J. R., and Collmer, A. 2004. Type III secretion system effector proteins: double agents in bacterial disease and plant defense. Annu Rev Phytopathol. 42:385-414.
Almeida, N. F., Yan, S., Cai, R., Clarke, C. R., Morris, C. E., Schaad, N. W., Schuenzel, E. L., Lacy, G. H., Sun, X., Jones, J. B., Castillo, J. A., Bull, C. T., Leman, S., Guttman, D. S., Setubal, J. C., and Vinatzer, B. A. 2010. PAMDB, A multilocus sequence typing and analysis database and website for plant-associated microbes. Phytopathology. 100:208-215.
Al-Saadi, A., Reddy, J. D., Duan, Y. P., Brunings, A. M., Yuan, Q. P., and Gabriel, D. W. 2007. All five host-range variants of Xanthomonas citri carry one pthA homolog with 17.5 repeats on citrus, but that determines none determine host-range pathogenicity variation. Molecular Plant-Microbe Interactions. 20(8):934-943.
Altschul, S. F., Madeen, T. L., Schaffer, A. A., Zhang, J., Zhang, Z., Miller, W., and Lipman, D. J. 1997. Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res. 25:3389-3402.
Anderson, D. M., Fouts, D. E., Commer, A., and Schneewind, O. 1999. Reciprocal secretion of proteins by the bacterial type III machines of plant and animal pathogens suggests universal recognition of mRNA targeting signals. Proc. Natl. Acad Sci USA. 96:12839-12843.
Araujo, E. R., Pereira, R. C., Moita, A. W., Ferreira, MASV., Café-Fiho, A. C., Quezado-Duval, A. M. 2010. Effect of temperature on pathogenicity components of tomato bacterial spot and competition between Xanthomonas perforans and X. garnderi. III International symposium on tomato diseases. P12:24-28.
Arnold, D., Gibbon, M., Jackson, R., Wood, J., Brown, J., Mansfield, J., Taylor, J., and Vivian, A. 2001. Molecular characterization of avrPphD, a widely distributed gene from Pseudomonas syringae pv. phaseolicola involved in non-host recognition by pea (Pisum sativum). Physiol Mol Plant Pathol. 58:55-62.
Arnold, R., Brandmaier, S., Kleine, F., Tischler, P., Heinz, E., Behrens, S., Niinikoski, A., Mewes, H. W., Horn, M., and Rattei, T. 2009. Sequence-based prediction of type III secreted proteins. PLoS Pathogens. 5(4):e1000376. Doi:10.1371/journal.ppat.1000376.
170
Astua-Monge, G., Minsavage, G. V., Stall, R. E., Davis, M. J., Bonas, U., and Jones, J. B. 2000a. Resistance of tomato and pepper to T3 strains of Xanthomonas campestris pv. vesicatoria is specified by a plant-inducible avirulence gene. Mol Plant Microbe Interact. 13:911-921.
Astua-Monge, G., Minsavage, G. V., Stall, R. E., Vallejos, C. E., Davis, M. J., and Jones, J. B. 2000b. Xv4-Avrxv4: A new gene-for-gene interaction identified between Xanthomonas campetris pv. vesicatoria race T3 and the wild tomato relative Lycopersicon pennellii. Mol Plant Microbe Interact. 13:1346-1355.
Ausubel, F. M., Brent, R., Kingston, R. E., Moore, D. D., Seidman, J. G., Smith, J. A., and Struhl, K. 1994. Current protocols in molecular biology. New York, N. Y.: John Wiley and Sons. 1:2.4.1-2.4.2.
Bailey, T. L., and Elkan, C. 1994. Fitting a mixture model by expectation maximization to discover motifs in biopolymers. Proceedings of the Second International Conference on Intelligent Systems for Molecular Biology. AAAI press, California, 28-36.
Barber, C. E., Tang, J. L., Feng, J. X., Pan, M. Q., Wilson, T. J. G., Slater, H., Dow, J. M., Williams, P., and Daniels, M. J. 1997. A novel regulatory system required for pathogenicity of Xanthomonas campestris is mediated by a small diffusible signal molecule. Mol Microbiol. 24:555-566.
Bartetzko, V., Sonnewald, S., Vogel, F., Hartner, K., Stadler, R., Hammes, U. Z., and Bornke, F. 2009. The Xanthomonas campestris pv. vesicatoria type III effector XopJ inhibits protein secretion: evidence for interference with cell wall-associated defense responses. Mol. Plant Microbe Interact. 22:655-664.
Bentley, D. R. 2006. Whole genome resequencing. Curr Opinion Genet Dev. 16:545-552.
Biely, P., Vrsanska, M. M., Tenkanen, M., and Kluepfel, D. 1997. Endo-beta-1,4-xylanase families: differences in catalytic properties. J Biotechnol. 57:151-166.
Bonas, U., Schulte, R., Fenselau, S., Minsavage, G. V., Staskawicz, B. J., and Stall, R. E. 1991. Isolation of a gene cluster from Xanthomonas campestris pv. vesicatoria that determines pathogenicity and hypersensitive response on pepper and tomato. Mol Plant Microbe Interact. 4:81-88.
Bouzar, H., Jones, J. B., Somodi, G. C., Stall, R. E., Daouzli, N., Lambe, R. C., Felix Gastelum, R., Trinidad Correa, R. 1996. Diversity of Xanthomonas campestris pv. vesicatoria in tomato and pepper fields of Mexico. Can J Plant Pathol. 18:75-77.
171
Bouzar, H., Jones, J. B., Stall, R. E., Louws, F. J., Schneider, M., Rademaker, J. L. W., de Bruijn, F. J., and Jackson, L. E. 1999. Multiphasic analysis of xanthomonads causing bacterial spot disease on tomato and pepper in the Caribbean and Central America: Evidence for common lineages within and between countries. Phytopathology. 89:328-335.
Boyd, A. P., Lambermont, I., and Cornellis, G. R. 2000. Competition between the Yops of Yersinia enterocolitica for delivery into eukaryotic cells: Role of the SycE chaperone binding domain of YopE. J. Bacteriol. 182:4811-4821.
Boyer, F., Fichant, G., Berthod, J., Vandenbrouck, Y., and Attree, I. 2009. Dissecting the bacterial type VI secretion system by genome wide in silico analysis: what can be learned from available microbial genomic resources? BMC Genomics. 10:104.
Bretz, J. R., Mock, N. M., Charity, J. C., Zeyad, S., Baker, C. J., and Hutcheson, S. W. 2003. A translocated protein tyrosine phosphotase of Pseudomonas syringae pv. tomato DC3000 modulates plant defense response to infection. Molecular microbiology. 49(2):389-400.
Büttner, D., Gurlebeck, D., Noel, L. D., and Bonas, U. 2004. HpaB from Xanthomonas campestris pv. vesicatoria acts as an exit control protein in type III-dependent protein secretion. Mol. Microbiol. 54:755-768.
Büttner, D., Lorenz, C., Weber, E., and Bonas, U. 2006. Targeting of two effector protein classes to the type III secretion system by a HpaC- and HpaB-dependent protein complex from Xanthomonas campestris pv. vesicatoria. Molecular microbiology. 59(2):513-527.
Büttner, D., and Bonas, U. 2006. Who comes first? How plant pathogenic bacteria orchestrate type III secretion. Curr. Opin. Microbiol. 9:193-200.
Büttner, D., Noel, L., Stutmann, J., and Bonas, U. 2007. Characterization of the nonconserved hpaB-hrpF region in the hrp pathogenicity island from Xanthomonas campestris pv. vesicatoria. Mol Plant Microbe Interact. 20:1063-1074.
Büttner, D., and He, S. Y. 2009. Type III protein secretion in plant pathogenic bacteria. Plant physiology. 150:1656-1664.
Büttner, D., and Bonas, U. 2010. Regulation and secretion of Xanthomonas virulence factors. FEMS Microbiol. Rev. 34(2):107-133.
Castaneda, A., Reddy, J., El-Yacoubi, B., and Gabriel, D. 2005. Mutagenesis of all eight avr genes in Xanthomonas campestris pv. campestris had no detected effect on pathogenicity, but one avr gene affected race specificity. MPMI. 18 (12):1306-1317.
Castresana, J. 2000. Selection of conserved blocks from multiple alignments for their use in phylogenetic analysis. Mol Biol Evol 17:540-552.
172
Chan, J. W. Y. F., and Goodwin, P. H. 1999. The molecular genetics of virulence of Xanthomonas campestris. Biotechnol. Adv. 17:489-508.
Chatterjee, S., and Sonti, R. V. 2002. rpfF mutants of Xanthomonas oryzae pv. oryzae are deficient for virulence and growth under low iron conditions. Mol Plant Microbe Interact. 15:463-471.
Chosed, R., Tomchick, D. R., Brautigam, C. A., Mukherjee, S., Negi, V. S., Machius, M., and Orth, K. 2007. Structural analysis of Xanthomonas XopD provides insights into substrate specificity of ubiquitin-like protein proteases. J. Biol. Chem. 282(9):6773-82.
Chou, F., Chou, H., Lin, Y., Yang, B., Lin, N., Weng, S., and Tseng, Y. 1997. The Xanthomonas campestris gumD gene required for synthesis of xanthan gum is involved in normal pigmentation and virulence in causing black rot. Biochem. Biophys. Res. Commun. 233:265-279.
Chow, V., Nong, G., and Preston, J. F. 2007. Structure, function and regulation of the aldouronate-utilization gene cluster from Paenibacillus sp. JDR-2. J. Bacteriol. 189: 8863-8870.
CLC Genomics Workbench. January 13, 2010. White paper on de novo assembly in CLC NGS Cell 3.0 beta. www.clcbio.com.
Cook, A. A., and Stall, R. E. 1968. Effect of Xanthomonas vesicatoria on loss of electrolytes from Capsicum annuum. Phytopathology. 58:617-620.
Cook, A. A., and Guevara, Y. G. 1984. Hypersensitivity in Capsicum chacoense to race 1 of the bacterial spot pathogen of pepper. Plant Disease. 68(4):329-330.
Crossman, V. C., Gould, J. M., Dow, G. S., Vernikos, A., Okazaki, M., Sebaihia, D., Saunders, C., Arrowsmith, T., Carver, N., Peters, E., Adlem, A., Kerhornou, A., Lord, L., Murphy, K., Seeger, R., Squares, S., Rutter, M. A., Quail, M. A., Rajandream, D., Harris, C., Churcher, S. D., Bentley, J., Parkhill, N. R., Thomson, Avison M. B. 2008. The complete genome, comparative and functional analysis of Stenotrophomonas maltophilia reveals an organism heavily shielded by drug resistance determinants. Genome Biol. 9:R74.
Cunnac, S., Wilson, A., Nuwer, J., Kirik, A., Baranage, G., and Mudgett, M. 2007. A conserved carboxylesterase is a suppressor of AvrBsT-elicited resistance in Arabidopsis. The Plant Cell. 19(2):688-705.
Daniels, M. J., Barber, C. E., Turner, P. C., Sawezye, M. K., Byrde, R. J. W., and Fielding, A. H. 1984. Cloning of genes involved in pathogenicity of Xanthomonas campestris pv. campestris using the broad host range cosmid pLAFR1. EMBO J. 3:3323-3328.
173
Das, A., Rangaraj, N., and Sonti, R. 2009. Multiple adhesion-like functions of Xanthomonas oryzae pv. oryzae are involved in promoting leaf attachment, entry and virulence on rice. MPMI. 22(1):73-85.
Da Silva, F. G., Shen, Y., Dardick, C., Burdman, S., Yadav, R. C., de Leon, A. L., and Ronald, P. C. 2004. Bacterial genes involved in type I secretion and sulfation are required to elicit the rice Xa21-mediated innate immune response. Mol Plant Microbe Interact. 17:593-601.
De Ley, J. 1978. Modern molecular methods in bacterial taxonomy: evaluation, application, prospects. In Proceedings of the 4th International Conference on Plant Pathogenic Bacteria, Angers. 347-357.
Delonger, M., Karoui, M. E., and Petit, M. 2009. A genomic distance based on MUM indicates discontinuity between most bacterial species and genera. J Bacteriol. 191:91-99.
Ditta, G., Stanfield, S., Corbin, D., and Helinski, D. 1980. Broad host range DNA cloning system for gram-negative bacteria: Construction of a gene bank of Rhizobium meliloti. Proc. Natil. Acad. Sci. USA. 77:7347-7351.
Dixon, R. A., Achnine, L., Kota, P., Liu, C., Reddy, M. S., and Wang, L. 2002. The phenylpropanoid pathway and plant defence – a genomics perspective. Mol Plant Pathol. 3:371-390.
Domingues, M. N., De Souza, T. A., Cernadas, R. A., De Oliveira, M., Docena, C., Farah, C. S., and Benedetti, C. E. 2010. The Xanthomonas citri effector protein PthA interacts with citrus proteins involved in nuclear transport, protein folding and ubiquitination associated with DNA repair. Molecular plant pathology. 11(5):663-675.
Dow, J., Milligan, D., Jaison, L., Barber, C., and Daniels, M. 1987. A gene cluster in Xanthomonas campestris required for pathogenicity controls the excretion of polygalacturonate lyase and other enzymes. Physiological and molecular plant pathology. 31:261-271.
Dow, J. M., Crossman, L., Findlay, K., He, Y. Q., Feng, J. X., and Tang, J. L. 2003. Biofilm dispersal in Xanthomonas campestris is controlled by cell-cell signaling and is required for full virulence to plants. Proc Natl Acad Sci. USA. 100:10995-11000.
Dow, M. 2008. Diversification of the function of cell-to-cell signaling in regulation of virulence within plant pathogenic xanthomonads. Sci Signal. 1:23.
Duan, Y. P., Castaneda, A. L., Zhao, G., Erdos, G., and Gabriel, D. W. 1999. Expression of a single, host-specific, bacterial pathogenicity gene in plant cells elicits division, enlargement and cell death. MPMI. 12:556-560.
174
Dunger, G., Pereda, R., Farah, C., Orellano, E., Jorgelina, O. Protein-protein interactions identified for effector proteins of the phytopathogen Xanthomonas axonopodis pv. citri [Abstract]. Proceedings of the V Congreso Argentino de Microbiologia General 2008.
Edgar RC. 2004. MUSCLE: multiple sequence alignment with high accuracy and high throughput. Nucleic Acids Res. 32:1792-1797.
El Tahir, Y., Kuusela, P., and Skurnik, M. 2000. Functional mapping of the Yersinia enterocolitica adhesin YadA. Identification of eight NSVAIG – S motifs on the amino-terminal half of the protein involved in collagen binding. Mol Microbiol. 37:192-206.
El Yacoubi, B., Brunings, A. M., Yuan, Q., Shankar, S., and Gabriel, D. W. 2007. In planta horizontal transfer of a major pathogenicity effector gene. Applied and Environmental Microbiology. 73(5):1612-1621.
Espinosa, A., Guo, M., Tam, VC, Fu, Z.Q., and Alfano, J. R. 2003. The Pseudomonas syringae type III-secreted protein HopPtoD2 possesses protein tyrosine phosphatase activity and suppresses programmed cell death in plants. Mol. Microbiol. 49(2):377-387.
Fauman, E. B., and Saper, M. A. 1996. Structure and function of the protein tyrosine phosphatases. Trends in Biochem. Sci. 21(11):413-417.
Feldman, M. F., and Cornelis, G. R. 2003. The multitalented type III chaperones: all you can do with 15kDa. FEMS Microbiology letters. 219:151-158.
Figurski, D., and Helinski, D. R. 1979. Replication of an origin-containing derivative of plasmid RK2 dependent on a plasmid function provided in trans. Proc. Natl. Acad. Sci. USA. 76:1648-1652.
Finn, R. D., Mistry, J., Tate, J., Coggill, P., Heger, A., Pollington, J. E., Gavin, O. L., Gunesekaran, P., Ceric, G., Forslund, K., Holm, L., Sonnhammer, E. L., Eddy, S. R., and Bateman A. 2010. The Pfam protein families database. Nucleic Acid Research Database issue. 38:D211-222.
Flor, H. H. 1971. Current status of the gene-for-gene concept. Annu. Rev. Phytopathol. 9:275-296.
Fuller, C. W., Middendorf, L. R., Benner, S. A., Church, G. M., Harris, T., Huang, X., Jovanovich, S., Nelson, J. R., Schloss, J. A., Schwartz, D. C., and Vezenov, D. V. 2009. The challenges of sequencing by synthesis. Nature Biotechnology. 27(11):1013-1023.
Furutani, A., Takaoka, M., Sanada, H., Noguchi, Y., Oku, T., Tsuno, K., Ochiai, H., and Tsuge, S. 2009. Identification of novel type III secretion effectors in Xanthomonas oryzae pv. oryzae. MPMI. 22:96-106.
175
Garnier, J., Gibrat, J-F, Robson, B. 1996. GOR secondary structure prediction method version IV. Meth Enzymol. 266:540-553
Gassmann, W., Dahlbeck, D., Cjesnokova, O., Minsavage, G. V., Jones, J. B., and Staskawicz, B. J. 2000. Molecular evolution of virulence in natural field strains of Xanthomonas campestris pv. vesicatoria. J. Bacteriol. 182:7053-7059.
Goesaert, H., Gebruers, K., Brijs, K., Courtin, C. M., and Delcour, J. A. 2003. XIP-type endoxylanase inhibitors in different cereals. J. Cereal Sci. 38:317-324.
Gottig, N., Garavaglia, B., Garofalo, C., Orellano, E., and Ottado, J. 2009. A filamentous hemagglutinin-like protein of Xanthomonas axonopodis pv. citri, the phytopathogen responsible for citrus canker, is involved in bacterial virulence. PLoS ONE. 4(2):e4358.
Goto, Y., Li, B., Claesen, J., Shi, Y., Bibb, M. J., and van der Donk, W. A. 2010. Discovery of unique lanthionine synthetases reveals new mechanistic and evolutionary insights. PLoS Biol. 8:e1000339.
Grant, S. R., Fisher, E. J., Chang, J. H., Mole, B. M., and Dangl, J. L.2006. Subterfuge and manipulation: Type III effector proteins of phytopathogenic bacteria. Annu Rev Microbiol. 60:425-449.
Guidot, A., Prior, P., Schoenfeld, J., Carrere, S., Genin, S., and Boucher, C. 2007. Genomic structure and phylogeny of the plant pathogen Ralstonia solanacearum from gene distribution analysis. Journal of bacteriology. 189 (2):377-387.
Gurlebeck, D., Thieme, F., and Bonas, U. 2006. Type III effector proteins from plant pathogen Xanthomonas and their role in the interaction with the host plant. J. Plant Physiol. 163:233-255.
Hajri, A., Brin, C., Hunault, G., Lardeux, F., Lemaire, C., Manceau, C., Boureau, T., and Poussier, S. 2009. Repertoire for repertoire hypothesis : Repertoires of type three effectors are candidate determinants of host specificity in Xanthomonas. PLoS One. 4(8):e6632. Doi:10.1371/journal.pone.0006632.
Hamza, A. A., Robene-Soustrade, I., Jouen, E., Gagnevin, L., Lefeuvre, P., Chiroleu, F., and Pruvost, O. 2010. Genetic and pathological diversity among Xanthomonas strains responsible for bacterial spot on tomato and pepper in the southwest Indian Ocean region. Plant Disease. 94:993-999.
He, Y., Zhang, L., Jiang, B., Zhang, Z., Xu, R., Tang, D., Qin, J., Jiang, W., Zhang, X., Liao J., Cao, J., Zhang, S., Wei, M., Liang, X., Lu, G., Feng, J., Chen, B., Cheng, J., and Tang, J. 2007. Comparative and functional genomics reveals genetic diversity and determinants of host specificity among reference strains and a large collection of Chinese isolates of the phytopathogen Xanthomonas campestris pv. campestris. Genome Biol. 8(10):R218.
176
He, Y. W., and Zhang, L. H. 2008. Quorum sensing and virulence regulation in Xanthomonas campestris. FEMS Microbiol Rev. 32:842-857.
He, Y. W., Boon, C., Zhou, L., and Zhang, L. H. 2009. Co-regulation of Xanthomonas campestris virulence by quorum sensing and a novel two-component regulatory system RavS/RavR. Mol Microbiol. 71:1464-1476.
Hengge, R. 2009. Principles of c-di-GMP signalling in bacteria. Nature Rev Microbiol. 7:263-273.
Hert, A. P., Roberts, P. D., Momol, M. T., Minsavage, G. V., Tudor-Nelson, S. M., and Jones, J. B. 2005. Relative importance of bacteriocin-like genes in antagonism of Xanthomonas perforans tomato race 3 to Xanthomonas euvesicatoria tomato race 1 strains. Appl Environ Microbiol. 71:3581-3588.
Heuer, H., Yin, Y. N., Xue, Q. Y., Smalla, K., and Guo, J. H. 2007. Repeat domain diversity of avrBs3-like genes in Ralstonia solanacearum strains and association with host preferences in the field. Appl Environ Microbiol. 73(13):4379-4384.
Hibberd, A. M., Stall, R. E., and Bassett, M. J. 1987. Different phenotypes associated with incompatible races and resistance genes in bacterial spot disease of pepper. Plant Dis. 71:1075-1078.
Hotson, A., Chosed, R., Shu, H. Orth, K., and Mudgett, M. B. 2003. Xanthomonas type III effector XopD targets SUMO-conjugated proteins in planta. Mol. Microbiol. 50(2):377-89.
Huguet, E., Hahn, K., Wengelnik, K., Bonas, U. 1998. HpaA mutants of Xanthomonas campestris pv. vesicatoria are affected in pathogenicity but retain the ability to induce host-specific hypersensitive reaction. Molecular microbiology. 29:1379-1390.
Humphreys, D., Hume, P.J., and Koronakis, V. 2009. The Salmonella effector SptP dephosphorylates host AAA+ ATPase VCP to promote development of its intracellular replicative niche. Cell Host and Microbe. 5(3):225-233.
Hurlbert, J. C., and Preston, J. F. 2001. Functional characterization of a novel xylanase from corn strains of Erwinia chrysanthemi. J. Bacteriol. 183:2093-2100.
Jenal, U, and Malone, J. 2006. Mechanisms of Cyclic-di-GMP Signaling in Bacteria. Annu Rev Genet. 40:385-407.
Jha, G., Rajeshwari, R., and Sonti, R. 2005. Bacterial type two secretion system secreted proteins: double-edged swords for plant pathogens. MPMI. 18:891-898.
177
Jiang, W., Jiang, B. L., Xu, R. Q., Huang, J. D., Wei, H. Y., Jiang, G. F., Cen, W.J., Liu, J., Ge, Y. Y., Li, G.H., Su, L. L., Hang, X. H., Tang, D. J., Lu, G. T., Feng, J. X., He, Y. Q., and Tang, J. L. 2009. Identification of six type III effector genes with the PIP box in Xanthomonas campestris pv. campestris and five of them contribute individually to full pathogenicity. MPMI. 22(11):1401-1411.
Jiang, B. L., He, Y. Q., Cen, W.J., Wei, H. Y., Jiang, G. F, Jiang, W., Hang, X. H., Feng, J. X., Lu, G. T., Tang, D. J., and Tang, J. L. 2008. The type III secretion effector XopXccN of Xanthomonas campestris pv. campestris is required for full virulence. Res. Microbiol. 159(3):216-220.
Jones, D. T. 1999. Protein secondary structure prediction based on position-specific scoring matrices. J. Mol. Biol. 292:195-202.
Jones, J. B., Bouzar, H., Somodi, G. C., Stall, R. E., Pernezny, K., El-Morsy, G., and Scott, J. W. 1998a. Evidence for the Preemptive Nature of Tomato Race 3 of Xanthomonas campestris pv. vesicatoria in Florida. Phytopathology. 88:33-38.
Jones, J. B., Stall, R. E., and Bouzar, H. 1998b. Diversity among xanthomonads pathogenic on pepper and tomato. Annu Rev Phytopathol. 36:41-58.
Jones, J. B., Bouzar, H., Stall, R. E., Almira, E. C., Roberts, P. D., Bowen, B. W., Sudberry, J., Strickler, P. M., and Chun, J. 2000. Systematic analysis of xanthomonads (Xanthomonas spp.) associated with pepper and tomato lesions. Int J Syst Evol Microbiol. 50:1211-1219.
Jones, J. B., Lacy, G. H., Bouzar, H., Stall, R. E., and Schaad, N. W. 2004. Reclassification of the xanthomonads associated with bacterial spot disease of tomato and pepper. Syst Appl Microbiol. 27:755-762.
Kay, S., Hahn, S., Marois, E., Hause, G., and Bonas, U. 2007. A bacterial effector acts as a plant transcription factor and induces a cell size regulator. Science 318:648-651.
Kearney, B. and Staskawicz, B.J. 1990. Widespread distribution and fitness contribution of Xanthomonas campestris avirulence gene avrBs2. Nature. 346:385-386.
Kim, J., Park, B., Yoo, C., Jeon, E., Oh, J. and Hwang, I. 2003. Characterization of Xanthomonas axonopodis pv. glycines Hrp pathogenicity island. Journal of bacteriology. 185(10):3155-3166.
Kim, J. G., Taylor, K.W., Hotson, A., Keegan, M., Schmelz, E.A., and Mudgett, M.B. 2008. XopD SUMO protease affects host transcription, promotes pathogen growth, and delays symptom development in Xanthomonas-infected tomato leaves. Plant Cell. 20:1915–1929.
178
Kim, J.G., Li, X., Roden, J.A., Taylor, K.W., Aakre, C.D., Su., B., Lalonde, S., Kirik, A., Chen, Y., Baranage, G., McLane, H., Martin, G.B., and Mudgett M.B. 2009. Xanthomonas T3S effector XopN suppresses PAMP-triggered immunity and interacts with a tomato atypical receptor-like kinase and TFT1. The Plant cell. 21(4):1305-1323.
Kim, S. H., Olson, T. N., Peffer, N. D., Nikolaeva, E. V., Park, S., and Kang, S. 2010. First report of bacterial spot of tomato caused by Xanthomonas gardneri in Pennsylvania. Plant Disease. 94:638.
Kingsley, M., Gabriel, D., Marlow, G., and Roberts, P. 1993. The opsX locus of Xanthomonas campestris affects host range and biosynthesis of lipopolysaccharide and extracellular polysaccharide. Journal of bacteriology. 175(8):5839-5850.
Kjemtrup, S., Nimchuk, Z., and Dangl, J. L. 2000. Effector proteins of phytopathogenic bacteria: bifunctional signals in virulence and host recognition. Curr. Opin. Microbiol. 3:73-78.
Kurtz, S., Phillippy, A., Delcher, A. L., Smoot, M., Shumway, M., Antonescu, C., and Salzberg, S. L. 2004. Versatile and open software for comparing large genomes. Genome Biol. 5:R12.
Laia, M. L., Moreira, L. M., Dezajacomo, J., Brigati, J. B., Ferreira, C. B., Ferro, M. I., Silva, A. C., Ferro, J. A., and Oliveira, J. C. 2009. New genes of Xanthomonas citri subsp. citri involved in pathogenesis and adaptation revealed by a transposon-based mutant library. BMC Microbiol. 9:12.
Lally, E. T., Hill, R. B., Kieba, L. R., and Korstoff, J. 1999. The interaction between RTX toxins and target cells. Trends Microbiol. 7:356-361.
Lee, B. M., Park, Y. J., Park, D. S., Kang, H. W., Kim, J. G., Song, E. S., Park, I C., Yoon, U. H., Hahn, J. H., Koo, B. S., Lee, G. B., Kim, H., Park, H. S., Yoon, K, O., Kim, J. H., Jung, C. H., Koh, N. H., Seo, J. S., and Go, S. J. 2005. The genome sequence of Xanthomonas oryzae pv. oryzae KACC10331, the bacterial blight pathogen of rice. Nucleic Acids Research. 33(2):577-586.
Lee, S. W., Jeong, K. S., Han, S. W., Lee, S. E., Phee, B. K., Hahn, T. R., and Ronald, P. 2008. The Xanthomonas oryzae pv. oryzae PhoPQ two-component system is required for AvrXA21 activity, hrpG expression, and virulence. J Bacteriol. 190:2183-2197.
Lee, S. W., Han, S. W., Sririyanum, M., Park, C. J., Seo, Y. S., and Ronald, P. C. 2009. A type I-secreted, sulfated peptide triggers XA21-mediated innate immunity. Science. 326:850-853.
Li, L., Stoeckert, C. J. Jr., and Roos, D. S. 2003. OrthoMCL: identification of ortholog groups for eukaryotic genomes. Genome Res. 13:2178-2189.
179
Lilic, M., Vujanac, M., and Stebbins, C. E. 2006. A common structural motif in the binding of virulence effectors to bacterial secretion chaperones. Mol. Cell. 21:653-664.
Linhartova, I., Bumba, L., Masin, J., Basler, M., Osicka, R., Kamanova, J., Prochazkova, K., Adkin, I., Hejnova-Holubova, J., Sadilkova, L., Morova, J., and Sebo, P. 2010. RTX-toxins: a highly diverse family secreted by a common mechanism. FEMS Microbiol Rev. 34:1076-1112.
Lloyd, S. A., Norman, M., Rosqvist, R., and Wolf-Watz, H. 2001. Yersinia YopE is targeted for type III secretion by N-terminal, not mRNA, signals. Mol microbial 39:520-532.
Lorang, J. M., Shen, H., Kobayashi, D., Cooksey, D., and Keen, N. T. 1994. AvrA and avrE in Pseudomonas syrinage pv. tomato PT23 play a role in virulence on tomato plants. MPMI. 7:508-515.
Louws, F. J., Wilson, M., Campbell, H. L., Cuppels, D. A., Jones, J. B., Shoemaker, P. B., Sahin, F., and Miller, S. A. 2001. Field control of bacterial spot and bacterial speck of tomato using a plant activator. Plant Disease. 85:481-488.
Löwer, M., and Schneider, G. 2009. Prediction of type III secretion signals in genomes of Gram-negative bacteria. PLoS ONE. 4(6):e5917. Doi:10.1371/journal.pone.0005917.
Lu, H., Patil, P., Van Sluys, M., White, F., Ryan, R., Dow, M., Rabinowicz, P., Salzberg, S., Leach, J., Sonti, R., Brendel, V., and Bogdanove, A. 2008. Acquisition and evolution of plant pathogenesis- associated gene clusters and candidate determinants of tissue-specificity in Xanthomonas. PLoS One. 3(11): e3828.
Maniatis, T. A., Fritsch, E. F., and Sambrook, J. 1982. Molecular Cloning: A Laboratory Mnaual. Cold Spring Harbor Laboratory, Cold Spring Harbor, NY.
Margulies, M., Egholm, M., Altman, W., Attiya, S., Bader, J., Bemden, L., Berka, J., Braverman, M., Chen, Y., Chen, Z., Dewell, S., Du, L., Fierro, J., Gomes, X., Begley, R., and Rothberg, J. 2005. Genome sequencing in open microfabricated high density picoliter reactions. Nature. 437:376-380.
Marois, E., Van den Ackerveken, G., and Bonas, U. 2002. The Xanthomonas type III effector protein AvrBs3 modulates plant gene expression and induces cell hypertrophy in the susceptible host. Mol Plant Microbe Interact 15:637-646.
Metz, M., Dahlbeck, D., Morales, C. Q., Al Sady, B., Clark, E. T., and Staskawicz, B. J. 2005. The conserved Xanthomonas campestris pv. vesicatoria effector protein XopX is a virulence factor and suppresses host defense in Nicotiana benthamiana. Plant J. 41:801-814.
180
Minsavage, G. V., Dahlbeck, D., Whalen, M. C., Kearny, B., Bonas, U., Staskawicz, B. J., and Stall, R. E., 1990. Gene-for-gene relationships specifying disease resistance in Xanthomonas campestris pv. vesicatoria–pepper interactions. MPMI. 3:41–47.
Molinaro, A., Silipo, A., Lanzetta, R., Newmann, M., Dow, M., and Parrilli, M. 2003. Structural elucidation of the O-chain of the lipopolysaccharide from Xanthomonas campestris strain 8004. Carbohydr Res. 338:277-281.
Mooi, F. R., and Bik, E. M. 1997. The evolution of epidemic Vibrio cholerae strains. Trends Microbiol. 5:161-165.
Moreira, L. M., De Souza, R. F., Digiampietri, L. A., Da Silva, A. C., and Setubal, J. C. 2005. Comparative analyses of Xanthomonas and Xylella complete genomes. Omics 9(1):43-76.
Moreira, L., Almeida, N., Potnis, N., Digiampietri, L., Vinatzer, B., and Setubal, J., et al., 2010. Novel insights into the genomic basis of citrus canker based on the genome sequences of two strains of Xanthomonas fuscans subsp. aurantifolii. BMC Genomics. 11:238.
Mudgett, M. B., Chesnokova, O., Dahlbeck, D., Clark, E. T., Rossier, O., Bonas, U., and Staskawicz, B. J. 2000. Molecular signals required for type III secretion and translocation of the Xanthomonas campestris AvrBs2 protein to pepper plants. Proc. Natl. Acad. Sci. U.S.A. 97:13324-13329.
Mukaihara, T., Tamura, N., and Iwabuchi, M. 2010. Genome-wide identification of large repertoire of Ralstonia solanacearum type III effector proteins by a new functional screen. MPMI. 23:251-262.
Myung, I. S., Moon, S. Y., Jeong, I. H., Lee, Y. K., Lee, Y. H., and Ra, D. S. 2009. Bacterial spot of tomato caused by Xanthomonas perforans, a new disease in Korea. Plant Disease. 93:1349.
Nimchuk, Z. L., Fisher, E. J., Desveaux, D., Chang, J. H., and Dangl, J. L. 2007. The HopX (AvrPphE) family of Pseudomonas syringae type III effectors require a catalytic triad and a novel N-terminal domain for function. Mol Plant Microbe Interact. 20(4):346-357.
Nimura, K., Melotto, M., and He, S. 2005. Suppression of host defense in compatible plant- Pseudomonas syringae interactions. Current opinion in biology. 8(4):361-368.
Nodzon, L., and Song, W. 2004. Yeast two-hybrid technology. Encyclopedia of plant and crop science. DOI: 10.1081/E-EPCS 120016292.
181
Noel, L., Thieme, F., Nennstiel, D., and Bonas, U. 2001. C-DNA-AFLP analysis unravels a genome-wide hrpG-regulon in the plant pathogen Xanthomonas campestris pv. vesicatoria. Mol Microbiol. 41:1271-1281.
Noel, L., Thieme, F., Nennstiel, D., and Bonas, U. 2002. Two novel type III-secreted proteins of Xanthomonas campestris pv. vesicatoria are encoded within the hrp pathogenicity island. J Bacteriol. 184(5):1340-1348.
Obradovic, A., Jones, J. B., Momol, M. T., Balogh, B., and Olson, S. M. 2004. Management of tomato bacterial spot in the field by foliar applications of bacteriophages and SAR inducers. Plant Disease. 88:736-740.
Ochiai, H., Inoue, Y., Takeya, M., Sasaki, A., Kaku, H. 2005. Genome sequence of Xanthomonas oryzae pv. oryzae suggests contribution of large numbers of effectorgenes and insertion sequences to its race diversity. JARQ 39:275-287
Oh, H. S., Kvitko, B. H., Morello, J. E., and Collmer, A. 2007. Pseudomonas syringae lytic transglycosylases coregulated with the type III secretion system contribute to the translocation of effector proteins into plant cells. J Bacteriol. 189(22):8277-8289.
Park, D. S., Hyun, J. W., Park, Y. J., Kim, J. S., Kang, H. W., Hahn, J. H., and Go, S. J. 2006. Sensitive and specific detection of Xanthomonas axonopodis pv. citri by PCR using pathovar specific primers based on HrpW gene sequences. Microbiol Res. 161:145-149.
Parsot, C., Hamiaux, C., and Page, A. L. 2003. The various and varying roles of specific chaperones in type III secretion systems. Curr. Opin. Microbiol. 6:7-14.
Patil, P. B., Bogdanove, A. J., and Sonti, R. V. 2007. The role of horizontal transfer in the evolution of a highly variable lipopolysaccharide biosynthesis locus in xanthomonads that infect rice, citrus and crucifers. BMC Evol Biol. 7:243.
Persson, C., Carballeira, N, Wolf-Watz, H., and Fallman, M. 1997. The PTPase YopH inhibits uptake of Yersinia, tyrosine phosphorylation of p130Cas and FAK, and the associated accumulation of these proteins in peripheral focal adhesions. The EMBO journal. 16:2307-2318.
Petnicki-Ocwieja, T., Schneider, D. J., Tam, V.C., Chancey, S. T., Shan, L., Jamir, Y., Schechter, L.M., Janes, M. D., Buell, C. R., Tang, X., Commer, A., and Alfano, J. R. 2002. Genomewide identification of proteins secreted by the Hrp type III protein secretion system of Pseudomonas syringae pv. tomato DC3000. Proc. Natl. Acad Sci. 99(11):7652-7657.
182
Pieretti, I., Royer, M., Barbe, V., Carrere, S., Koebnik, R., Cociancich, S., Couloux, A., Darrasse, A., Gouzy, J., Jacques, M., Lauber, E., Manceau, C., Mangenot, S., Poussier, S., Segurens, B., Szurek, B., Verdier, V., Arlat, M., and Rott, P. 2009. The complete genome sequence of Xanthomonas albilineans provides new insights into the reductive genome evolution of the xylem-limited Xanthomonadaceae. BMC Genomics. 10:616.
Pohronezny, K., and Volin, R. B. 1983. The effect of bacterial spot on yield and quality of fresh market tomatoes. Hort Science. 18:69-70.
Potnis, N., Krasileva, K., Chow, V., Almeida, N.F., Patil, P. B., Ryan, R. P., Sharlach, M., Behlau, F., Dow, J. M., Momol, M. T., White, F. F., Preston, J. F., Vinatzer, B. A., Koebnik, R., Setubal, J. C., Norman, D. J., Staskawicz, B. J., and Jones, J. B. 2011. Comparative genomics reveals diversity among xanthomonads infecting tomato and pepper. BMC Genomics. 12:146.
Preston, J. F., Hurlbert, J. C., Rice, J. D., Ragunathan, A., and St. John, F. J. 2003. Microbial Strategies for the Depolymerization of Glucuronoxylan: Leads to the Biotechnological Applications of Endoxylanases. In Application of Enzymes to Lignocellulosics. eds S.D. Mansfield and J. N. Saddler, ACS Symposium Series No. 855. Ch 12:191-210.
Qian, W., Jia, Y., Ren, S., He, Y., Feng, J., Lu, L., Sun, Q., Ying, G., Tang, D., Tang, H., Wu, W., Hao, P., Wang, L., Jiang, B., Zeng, S., Gu, W., Lu, G., Rong, L., Tian, Y., Yao, Z., Fu, G., Chen, B., Fang, R., Qiang, B., Chen, Z., Zhao, G., Tang, J., and He, C. 2005. Comparative and functional genomics analyses of the pathogenicity of phytopathogen Xanthomonas campestris pv. campestris. Genome Res. 15:757-767.
Qian, W., Han, Z., and He, C. 2008. Two component signal transduction systems of Xanthomonas spp.: a lesson from genomics. MPMI. 21:151-161.
Rajeshwari, R., and Sonti, R. 2000. Stationary phase variation due to transposition of novel insertion elements in Xanthomonas oryzae pv. oryzae. J. Bacteriol. 182:4797-4802.
Rajeshwari, R., Jha, G., and Sonti, R. 2005. Role of an in planta-expressed xylanase of Xanthomonas oryzae pv. oryzae in promoting virulence on rice. MPMI. 18:830-837.
Ray, S.K., Rajeshwari, R., Sharma, Y., and Sonti, R. V. 2002. A high molecular-weight outer membrane protein of Xanthomonas oryzae pv. oryzae exhibits similarity to non-fimbrial adhesins of animal pathogenic bacteria and is required for optimum virulence. Mol Microbiol. 46:637-647.
Reddy, J. D., Reddy, S. L., Hopkins, D. L., and Gabriel, D. W. 2007. TolC is required for pathogenicity of Xylella fastidiosa in Vitis vinifera grapevines. MPMI. 20:403-410.
183
Roden, J., Eardley, L., Hotson, A., Cao, Y., and Mudgett, M. B. 2004a. Characterization of the Xanthomonas AvrXv4 effector, a SUMO protease translocated into plant cells. Mol. Plant Microbe Interact. 17:633–643
Roden, J. A., Belt, B., Ross, J. B., Tachibana, T., Vargas, J., and Mudgett, M. B. 2004b. A genetic screen to isolate type III effectors translocated into pepper cells during Xanthomonas infection. Proc Natl Acad Sci USA. 101:16624-16629.
Rohmer, L., Guttman, D. S., and Dangl, J. L. 2004. Diverse evolutionary mechanisms shape the type III effector virulence factor repertoire in the plant pathogen Pseudomonas syringae. Genetic. 167:1341-1360.
Romer, P., Hahn, S., Jordan, T., Strauss, T., Bonas, U., and Lahaye, T. 2007. Plant pathogen recognition mediated by promoter activation of the pepper Bs3 resistance gene. Science 318:645-648.
Romling, U., Gomelsky, M., and Galperin, M. Y. 2005. C-di-GMP: the dawning of a novel bacterial signalling system. Mol Microbiol. 57:629-639.
Rosebrock, T. R., Zeng, L., Brady, J. J., Abramovitch, R.B., Xiao, F., and Martin, G. B. 2007. A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity. Nature 448:370-374.
Ryan, R. P., Fouhy, Y., Lucey, J. F., Crossman, L. C., Spiro, S., He, Y. W., Zhang, L. H., Heeb, S., Camara, M., Williams, P., and Dow, J. M. 2006. Cell-cell signaling in Xanthomonas campestris involves an HD-GYP domain protein that functions in cyclic di-GMP turnover. Proc Natl Acad Sci USA. 103:6712-6717.
Ryan, R. P., Fouhy, Y., Lucey, J. F., Jiang, B. L., He, Y. Q., Feng, J. X., Tang, J. L., and Dow, J. M. 2007. Cyclic di-GMP signalling in the virulence and environmental adaptation of Xanthomonas campestris. Mol Microbiol. 63:429-442.
Ryan, R. P., McCarthy, Y., Andrade, M., Farah, C. S., Armitage, J. P., and Dow, J. M. 2010. Cell-cell signal dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proc Natl Acad Sci USA. 107:5989-5994.
Ryan, R. P., Vorholter, F., Potnis, N., Jones, J. B., Van-Sluys, M., Bogdanove, A., and Dow, J. M. 2011. Pathogenomics of Xanthomonas: understanding bacterium-plant interactions. Nature Reviews Microbiology. 9:344-355.
Rybak, M., Minsavage, G. V., Stall, R.E., and Jones, J.B. 2009. Identification of Xanthomonas citri ssp. citri host specificity genes in a heterologous expression host. Molecular plant pathology. 10(2):249-262.
184
Salzberg, S. L., Sommer, D. D., Schatz, M. C., Phillippy, A.M. ,Rabinowicz, P. D., Tsuge, S., Furutani, A., Ochiai, H., Delcher, A. L., Kelley, D., Madupu, R., Puiu, D., Radune, D., Shumway, M., Trapnell, C., Aparna, G., Jha, G., Pandey, A., Patil, P. B., Ishihara, H., Meyer, D. F., Szurek, B., Verdier, V., Koebnik, R., Dow, J. M., Ryan, R. P., Hirata, H., Tsuyumu, S., Won Lee, S., Ronald, P. C., Sonti, R. V., Van Sluys, M. A., Leach, J. E., White, F. F., Bogdanove, A. J. 2008 Genome sequence and rapid evolution of the rice pathogen Xanthomonas oryzae pv. oryzae PXO99A. BMC Genomics 9:204
Samudrala, R., Heffron, F., and McDermott, J. E. 2009. Accurate prediction of secreted substrates and identification of a conserved putative secretion signal for type III secretion systems. PLoS Pathogens. 5(4):e1000375. Doi:10.1371/journal.ppat.1000375.
Sarkar, S., Gordon, J., Martin, G., and Guttman, D. 2006. Comparative genomics of host-specific virulence in Pseudomonas syringae. Genetics. 174:1041-1056.
Schechter, L. M., Roberts, K. A., Jamir, Y., Alfano, J. R., and Collmer, A. 2004. Pseudomonas syringae type III secretion system targeting signals and novel effectors studied with a CyaA translocation reporter. J. Bacteriol. 186:543-555.
Schesser, K., Frithz-Lindsten, E., and Wolf-Watz, H. 1996. Delineation and mutational analysis of the Yersinia pseudotuberculosis YopE domains which mediate translocation across bacterial and eukaryotic cellular membranes. J. Bacteriol. 178:7227-7233.
Schornack, S., Minsavage, G. V., Stall, R. E., Jones, J. B., and Lahaye, T. 2008. Characterization of AvrHah1, a novel AvrBs3-like effector from Xanthomonas gardneri with virulence and avirulence activity. New Phytologist. 179(2):546-556.
Shulami, S., Gal, O., Sonenshein, A. L., and Shoham, Y. 1999. The glucuronic acid-utilization gene cluster from Bacillus stearothermophilus T-6. J Bacteriol. 181:3695-3704.
Shulami, S., Zaide, G., Zolotnitsky, G., Langut, Y., Feld, G., Sonenshein, A. L., and Shoham, Y. 2007. A two-component system regulates the expression of an ABC transporter for xylo-oligosaccharides in Geobacillus stearothermophilus. Appl Environ Microbiol. 73:874-84.
Silva, A. C. R., Ferro, J.A., Reinach, F.C., Farah, C. S., Furlan, L. R., Quaggio, R. B., Monteiro-Vitorello, C. B., Van Sluys, M. A., Almeida, N. F., Alves, L. M. C., Amaral, A. M., and Bertolini, M. C., et.al. 2002. Comparison of the genomes of two Xanthomonas pathogens with differing host specificities. Nature. 417(6887):459-463.
Siciliano, F., Torres, P., Sendín, L., Bermejo, C., Filippone, P., Vellice, G., Ramallo, J., Castagnaro, A. 2006. Analysis of the molecular basis of Xanthomonas axonopodis pv. citri pathogenesis in Citrus limon. Electron J Biotechnol 9.
185
Slater, H., Alvarez-Morales, A., Barber, C. E., Daniels, M. J., and Dow, J. M. 2000. A two-component system involving an HD-GYP domain protein links cell-cell signalling to pathogenicity gene expression in Xanthomonas campestris. Mol Microbiol. 38:986-1003.
Song, C. and Yang, B. 2010. Mutagensis of 18 type III effectors reveals virulence function of XopZPXO99 in Xanthomonas oryzae pv. oryzae. MPMI. 23(7):893-902.
Sory, M. P., Boland, A., Lambermont, I., and Cornelis, G. R. 1995. Identification of the YopE and YopH domains required for secretion and internalization into the cytosol of macrophages, using the cyaA gene fusion approach. Proc. Natl. Sci. U.S.A. 92:11998-12002.
Stall, R. E., Jones, J. B., and Minsavage, G. V. 2009. Durability of resistance in tomato and pepper to xanthomonads causing bacterial spot. Annu Rev Phytopathol. 47:265-84.
Stamatakis A. 2006. RAxML-VI-HPC: maximum likelihood-based phylogenetic analyses with thousands of taxa and mixed models. Bioinformatics. 22:2688-2690.
Staskawicz, B. J., Dahlbeck, D., and Keen, N. T. 1984. Cloned avirulence gene of Pseudomonas syringae pv.glycinea determines race-specific incompatibility on Glycine max (L.) Merr. Proc. Natl. Acad. Sci. USA. 81:6024-6028.
Staskawicz, B. J., Dahlbeck, D., Keen, N., and Napoli, C. 1987. Molecular characterization of cloned avirulence genes from race 0 and race 1 of Pseudomonas syringae pv. glycinea. J. Bacteriol. 169:5789-5794.
Stavrinides, J., Ma, W., and Guttman, D. 2006. Terminal reassortment drives the quantum evolution of type III effectors in bacterial pathogens. PLoS Pathogens. 2:e104.
Stebbins, C. E., and Galan, J. E. 2001. Maintenance of an unfolded peptide by a cognate chaperone in type III secretion. Nature. 414:77-81.
Stevens, C., Bennett, M. A., Athanassopoulos, E., Tsiamis, G., Taylor, J. D., and Mansfield, J. W. 1998. Sequence variations in alleles of the avirulence gene avrPphE.R2 from Pseudomonas syringae pv. phaseolicola lead to loss of recognition of the AvrPphE protein within bean cells and a gain in cultivar-specific virulence. Mol Microbiol. 29(1):165-177.
St. John, F. J., Rice, J. D., and Preston, J. F. 2006. Characterization of XynC from Bacillus subtilis subspecies subtilis strain 168 and Analysis of Its Role in Depolymerization of Glucuronoxylan. J. Bacteriol. 24:8617-8626.
186
Studholme, D. J., Kemen, E., MacLean, D., Schornack, S., Aritua, V., Thwaites, R., Grant, M. Smith, J., and Jones, J. D. 2010. Genome-wide sequencing data reveals virulence factors implicated in banana Xanthomonas wilt. FEMS Microbiology Letters. 310(2):182-192.
Sugio, A., Yang, B., and White, F. F. 2005. Characterization of the hrpF pathogenicity peninsula of Xanthomonas oryzae pv. oryzae. MPMI. 18(6):546-554.
Sugio, A., Yang, B., Zhu, T., and White, F. 2007. Two type III effector genes of Xanthomonas oryzae pv. oryzae control the induction of the host genes OsTFIIAγ1 and OsTFX1 during bacterial blight of rice. PNAS. 10(25):10720-10725.
Sun, Q., Hu, J., Huang, G., Ge, C., Fang, R., and He, C. 2005. Type-II secretion pathway structural gene xpsE, xylanase- and cellulase secretion and virulence in Xanthomonas oryzae pv. oryzae. Plant Pathol. 54:15-21.
Sutic, D. 1957. Bakterioze crvenog patlidzana (Tomato bacteriosis). In Posebna Izd Inst Zasht Bilja Beograd. 6:1-65 (special edition). Beograd: Institute of Plant Protein. (English summary: Rev Appl Mycol 1957, 36:734-735.)
Swarup, S., de Feyter, R., Brlansky, R. H., and Gabriel, D. W. 1991. A pathogenicity locus from Xanthomonas citri enables strains from several pathovars of X. campestris to elicit cankerlike lesions on citrus. Phytopathology 81:802-809.
Swords, K. M., Dahlbeck, D., Kearney, B., Roy, M. and Staskawicz, B. J. 1996. Spontaneous and induced mutations in a single open reading frame alter both virulence and avirulence in Xanthomonas campestris pv. vesicatoria avrBs2. J. Bacteriol. 178(15):4661-4669.
Szczesny, R., Jordan, M., Schramm, C., Schulz, S., Cogez, V., Bonas, U., and Buttner, D. 2010. Functional characterization of the Xcs and Xps type II secretion systems from the plant pathogenic bacterium Xanthomonas campestris pv. vesicatoria. New phytologist. doi: 10.1111/j.1469-8137.2010.03312.x.
Tamaki, S., Dahlbeck, D., Staskawicz, B., Keen, N. T. 1988. Characterization and expression of two avirulence genes cloned from Pseudomonas syringae pv. glycinea. J. Bacteriol. 170:4846-4854.
Tamura, K., Dudley, J., Nei, M., and Kumar, S. 2007. MEGA4: Molecular Evolutionary Genetics Analysis (MEGA) software version 4.0. Mol Biol Evol. 24:1596-1599.
Thieme, F., Koebnik, R., Bekel, T., Berger, C., and Boch, J., et al. 2005. Insights into genome plasticity and pathogenicity of the plant pathogenic bacterium Xanthomonas campestris pv. vesicatoria revealed by the complete genome sequence. J Bacteriol 187:7254–7266.
187
Thieme, F., Szczesny, R., Urban, A., Kirchner, O., Hause, G., and Bonas, U. 2007. New type III effectors from Xanthomonas campestris pv. vesicatoria trigger plant reactions dependent on a conserved N-myristoylation motif. MPMI. 20:1250-1261.
Thieme F. 2008. Genombasierte Identifizierung neuer potentieller Virulenzfaktoren von Xanthomonas campestris pv. vesicatoria. Thesis, Mathematisch- Naturwissenschaftlich-Technische Fakultät der Martin-Luther Universität, Halle-Wittenberg.
Triplett, L. R., Melotto, M., and Sundin, G. W. 2009. Functional analysis of the N-terminus of the Erwinia amylovora secreted effector DspA/E reveals features required for secretion, translocation, and binding of the chaperone DspB/F. MPMI. 22(10):1282-1292.
Tudor-Nelson, S. M., Minsavage, G. V., Stall, R. E., and Jones, J. B. 2003. Bacteriocin-like substances from tomato race 3 strains of Xanthomonas campestris pv. vesicatoria. Phytopathology. 93:1415-1421.
Underwood, W., Zhang, S., and He, S.Y. 2007. The Pseudomonas syringae type III effector tyrosine phosphatase HopAO1 suppresses innate immunity in Arabidopsis thaliana. Plant Journal. 52(4):658-672.
Van den Ackerveken, G., Marois, E., and Bonas, U. 1996. Recognition of the bacterial avirulence protein avrBs3 occurs inside the host plant cell. Cell. 87:1307-1316.
Van Sluys, M. A., Monteiro-Vitorello, C. B., Camargo, L. E. A., Menck, C. F. M., Da Silva, A.C R., Ferro, J. A., Oliveira, M. C., Setubal, J. C., Kitajima, J. P., and Simpson, A. J. 2002. Comparative genomic analysis of plant-associated bacteria. Annual Review in Phytopathology. 40:169-189.
Vernikos, G. S., and Parkhill, J. 2006. Interpolated variable order motifs for identification of horizontally acquired DNA: revisiting the Salmonella pathogenicity islands. Bioinformatics. 22:2196-2203.
Vorhölter, F. J., Niehaus, K., and Pühler, A. 2001. Lipopolysaccharide biosynthesis in Xanthomonas campestris pv. campestris: a cluster of 15 genes is involved in the biosynthesis of the LPS O-antigen and the LPS core. Mol Genet Genomics. 266:79-95.
Vorhölter, F. J., Schneiker, S., Goesmann, A., Krause, L., Bekel, T., Kaiser, O., Linke, B., Patschkowski, T., Ruckert, C., Schmid, J., Sidhu, V. K., Sieber, V., Tauch, A., Watt, S. A., Weisshaar, B., Becker, A., Niehaus, K., and Puhler, A. 2008. The genome of Xanthomonas campestris pv. campestris B100 and its use for the reconstruction of metabolic pathways involved in xanthan biosynthesis. J Biotechnol 134:33-45
188
Wang, X., Preston, 3rd J. F., and Romeo, T. 2004. The pgaABCD locus of Escherichia coli promotes the synthesis of a polysaccharide adhesin required for biofilm formation. J Bacteriol. 186:2724-2734.
Wang, L., Makino, S., Subedee, A., and Bogdanove, A. J. 2007a. Novel candidate virulence factors in rice pathogen Xanthomonas oryzae pv. oryzicola as revealed by mutational analysis. Appl Environ Microbiol. 73:8023-8027.
Wang, L., Tang, X, and He, C. 2007b. The bifunctional effector avrXccC of Xanthomonas campestris pv. campestris requires plasma membrane-anchoring for host recognition. Mol. Plant Pathol. 8(4):491-501.
Wang, L., Rong, W., and He, C. 2008. Two Xanthomonas extracellular polygalacturonases, PghAxc and PghBxc, are regulated by type III secretion regulators HrpX and HrpG and are required for virulence. MPMI. 21(5):555-563.
Whalen, M. C., Stall, R. E., and Staskawicz, B. J. 1988. Characterization of a gene from a tomato pathogen determining hypersensitive response in non-host species and genetic analysis of this resistance in bean. Proc. Natl. Acad. Sci. USA. 85:6743-6747.
Whalen, M. C., Richter, T., Zakhareyvich, K., Yoshikawa, M., Al-Azzeh, D., Adefioye, A., Spicer, G., Mendoza, L. L., Morales, C. Q., Klassen, V., Perez-Baron, G., Toebe, C. S., Tzovolous, A., Gerstman, E., Evans, E., Thompson, C., Lopez, M., and Ronald, P. C. 2008. Identification of a host 14-3-3 protein that interacts with Xanthomonas effector avrRxv. Physiological and molecular plant pathology. 72:46-55.
White, F. F., Potnis, N., Jones, J. B., and Koebnik, R. 2009. The Type III effectors of Xanthomonas. Mol Plant Pathol.10:749-766.
Wichmann, G. and Bergelson, J. 2004. Effector genes of Xanthomonas axonopodis pv. vesicatoria promote transmission and enhance other fitness traits in the field. Genetics. 166(2):693-706.
Xu, R. Q., Li, X. Z., Wei, H. Y., Jiang, B., Li, K., He, Y. Q., Feng, J. X., and Tang, J. L. 2006. Regulation of eight avr genes by hrpG and hrpX in Xanthomonas campestris pv. campestris and their role in pathogenicity. Progress in Natural Science. 16:1288-1294.
Yang, B., and White, F. F. 2004. Diverse members of the AvrBs3/PthA family of type III effectors are major virulence determinants in bacterial blight disease of rice. MPMI. 17(11):1192-1200.
Yang, Y., Zhao, J., Morgan, R., Ma, W., and Jiang, T. 2010. Computational prediction of type III secreted proteins from gram-negative bacteria. BMC Bioinformatics, 11(Suppl 1): S47.
189
BIOGRAPHICAL SKETCH
Neha Potnis was born in Pune, Maharashtra State, India in 1985. She obtained
her bachelor’s degree in microbiology in 2005 from University of Pune, India where she
specialized in industrial microbiology. During her bachelor’s degree, she was offered a
scholarship to conduct research in University of Mysore Indian Academy of Sciences.
During this fellowship, she got opportunity to work under the guidance of Prof. H. S.
Shetty and Dr. Sarosh. The research project was focused on screening for microsatellite
markers from Sclerospora graminicola genomic library. This was the first time she
worked with a plant pathogen and microbial genetics. In 2005, she was admitted to the
Master of Science program in Microbiology from University of Pune. After completing
her master’s studies, she received research assistantship to pursue her Ph.D. studies in
Department of Plant Pathology, University of Florida, under the guidance of Dr. Jeffrey
B. Jones and Dr. David J. Norman. Her research focused on comparative genomics of
xanthomonads and study of pathogenicity factors of xanthomonads in disease
development.