Upload
others
View
5
Download
0
Embed Size (px)
Citation preview
Evolution of Specifications and Analytical
Methods During Synthetic Peptide Drug
Development
Michael Verlander, D.Phil., Proactive Quality Compliance
Biologics Monographs 1 – Peptides & Insulins Expert Committee Member
Webinar, March 14, 2019
2
© 2017 USP
Definitions
Challenges
Regulatory guidance – specifications
Quality attributes/specifications for peptides
Characterization methods
Qualification/validation requirements
Peptide-related impurities
Origins
Regulatory guidance
Examples of Purity/Related Substances method development
Setting limits for peptide-related impurities
Bioassay/bioidentity considerations
Final thoughts
Agenda
3
© 2017 USP
Protein
“Any alpha amino acid polymer with a specific defined sequence that is greater than 40 amino acids in size” (May be regulated as biological products or drugs, e.g., insulin and human growth hormone)
Chemically synthesized polypeptide
“Any alpha amino acid polymer that is (a) made entirely by chemical synthesis, and (b) is less than 100 amino acids in size”(Regulated as drugs unless they meet the statutory definition of “biological products”)
Peptide
“Any alpha amino acid polymer with specific defined sequence composed of 40 or fewer amino acids” (Regulated as a drugs unless they meets the statutory definition of “biological products”, e.g.
peptide vaccines)
FDA Draft Guidance. Biosimilars: Questions and Answers Regarding Implementation of the Biologics Price Competition and Innovation Act of 2009. February 2012
Definitions
4
© 2017 USP
Biological product
“A virus, therapeutic serum, toxin, antitoxin, vaccine, blood, blood component or derivative, allergenic product, protein (except any chemically synthesized polypeptide), or analogous product, or arsphenamine or derivative of arsphenamine (or any other trivalent organic arsenic compound), applicable to the prevention, treatment, or cure of a disease or condition of human beings”
Proposed Rule: Definition of the Term “Biological Product”. Federal Register, Vol. 83, No. 238.
Wednesday, December 12, 2018
Definitions (Continued)
5
© 2017 USP
Because of improved manufacturing technology, the complexity of synthetic peptides entering clinical development is increasing:
Longer sequences (up to 50 AAs or more)
Macrocyclic/multicyclic structures
Conjugates with e.g. lipids, PEG, proteins, etc.
Characterization of the drug substances and their related impurities becomes correspondingly more challenging
In order to keep pace with the clinical development program, the manufacturing process and the associated analytical methods (in-process and final product) must be developed in parallel
Because of their complexity, a relatively large number of tests is required to adequately describe the quality characteristics of peptides (the specification)
Challenges
6
© 2017 USP
Additional testing is performed during characterization studies (ongoing throughout development)
Meeting regulatory requirements presents some challenges, since synthetic peptides are specifically excluded from most guidance documents, particularly those for product-related impurities
Challenges (Continued)
7
© 2017 USP
ICH Q6A Specifications: Test Procedures and Acceptance Criteria for New Drug Substances and New Drug Products: Chemical Substances
Specification:
“A specification is defined as a list of tests, references to analytical procedures, and
appropriate acceptance criteria which are numerical limits, ranges, or other criteria for
the tests described. It establishes the set of criteria to which a new drug substance or
new drug product should conform to be considered acceptable for its intended use.”
“The following tests and acceptance criteria are considered generally applicable to all new drug substances:”
Description:
“A qualitative statement about the state (e.g. solid, liquid) and color of the new drug
substance.”
Regulatory Guidance – Specifications
8
© 2017 USP
Identification:
“Identification testing should optimally be able to discriminate between compounds of
closely related structure which are likely to be present. Identification tests should be
specific for the new drug substance, e.g., infrared spectroscopy.”
Assay:
“A specific, stability-indicating procedure should be included to determine the content of
the new drug substance. In many cases it is possible to employ the same procedure
(e.g., HPLC) for both assay of the new drug substance and quantitation of impurities.”
Impurities:
“Organic and inorganic impurities and residual solvents are included in this category.”
Regulatory Guidance – Specifications (Continued)
9
© 2017 USP
Guidance for Industry. CGMP for Phase I Investigational Drugs
(US FDA, 2008)
“You should perform laboratory testing of the phase 1 investigational drug to evaluate
quality attributes including those that define the identity, strength, potency, purity, as
appropriate. Specified attributes should be monitored, and acceptance criteria applied
appropriately. For known safety-related concerns, specifications should be established and
met.”
Guidance for Industry. INDs for Phase 2 and Phase 3 Studies. Chemistry, Manufacturing and Controls Information (US FDA, 2003)
“During the clinical investigation process, the sponsor would establish tentative
acceptance criteria that are continually refined based on data obtained from analysis of
batches of drug substance and new information that becomes available. In the course of
product development, the analytical technology or methodology often evolves parallel to
the clinical investigations. In setting subsequent acceptance criteria, relevant correlations
should be established between data generated during early and late drug development.“
Regulatory Guidance – Specifications (Continued)
10
© 2017 USP
Quality Attribute Method Comments
Appearance Visual inspection
Identification Mass spectral analysis
Amino acid analysis
HPLC comparison with standard
(co-elution)
Peptide mapping
Monoisotopic mass
Hydrolysis and derivatization methods
should be specified
Method may be same as related substances
Only rarely required (for complex
sequences)
Assay HPLC Preferred method if quantitative standard
available
Peptide Content Quantitative amino acid analysis
Nitrogen determination
Hydrolysis method must be validated; only
stable amino acids used for calculation
Elemental analysis preferred; Kjeldahl and
HPLC using chemiluminescence nitrogen
detector (CLND) may also be used
Routine Quality Attributes for Peptide APIs
11
© 2017 USP
Quality Attribute Method Comments
Organic Impurities
Peptide-related Impurities, including aggregates (for more complex sequences)
HPLC methods (RP-HPLC, IEX-HPLC, SEC-HPLC, etc.)
UHPLC methods preferred; must be validated for both process-related and degradation impurities; limits for individual and total impurities should be specified
Non-peptide Impurities:Residual solvents
Residual TFA
Gas chromatography
RP-HPLC, Ion chromatography
May be limited to those used in the final process steps (after validation)Only if used in manufacturing process
Inorganic Impurities
Other anions Ion chromatography Only those used in manufacturing process (e.g., phosphate)
Fluoride Ion selective electrode orion chromatography
Only if used in manufacturing process
Routine Quality Attributes for Peptide APIs (Continued)
12
© 2017 USP
Quality Attribute Method Comments
Inorganic Impurities (Continued)
Elemental impurities ICP-MS Required if metal catalysts used in manufacturing process; justification based on data from development if not tested
Other (Specific) Tests
Counterions, e.g.AcetateChloride
Other anions
Water content
Mass balance
BioburdenEndotoxins
RP-HPLC, ion chromatographyAgNO3 titration or ion chromatographyIon chromatography
Karl Fischer titration
Calculation
USP <61>, <62>USP <85>
Coulometric method most commonly used
Peptide content + counterion content + water contentTAMC and TYMCOften required for drug substances used for manufacture of parenteral products
Routine Quality Attributes for Peptide APIs (Continued)
13
© 2017 USP
Specification:
A list of tests, analytical procedures and numerical limits or ranges which are used to establish the quality of the product
The specification tests must always be executed and results must be within the ranges/limits prior to batch release
Characterization:
A number of characteristics meant to describe the API, independent of process variation (but not necessarily independent of process)
Complete characterization may eliminate the need for tests in the specification (e.g., characterization of chiral impurity levels during development can eliminate need for this test as part of release)
Characterization studies typically start during process development to evaluate attributesof the API without knowing whether they may prove important or not; studies continue throughout development
Impurity understanding and tracking is a part of the characterization which can support process optimization studies
Characterization studies are summarized in section 3.2.S.3.1 of the registration file
Specification versus Characterization
14
© 2017 USP
Method Comments
Sequence AnalysisMS-MS SequencingN-terminal Edman Degradation
May be complicated for longer sequencesNot applicable to N-terminally blocked sequences
Peptide Mapping Mainly for longer, more complex sequences; complementary to MS-MS sequence analysis
NMR Spectroscopy Complex interpretation for longer sequences
Infrared Spectroscopy Limited utility for peptides
Enantiomeric Purity (Chiral Amino Acid Analysis by GC-MS)
Non-routine, can be challenging for certain sequences
Optical Rotation Enantiomeric purity preferred
Higher Order Structure(by CD, NMR, FTIR)
Relevant for longer, more complex sequences
Bioidentity/Bioassay May be required for complex sequences where secondary structure essential for activity; mainly used for drug product
Small Molecule Impurities (from manufacturing process)
Non-peptide impurity limits required to follow ICH Q3A guidelines; potential genotoxic impurities should be evaluated
Examples of Supplementary Characterization Methods
15
© 2017 USP
Requirements for many quality attributes are “generic” and provided in regulatory guidance documents, for example:
Residual solvents (limits provided in USP <467>)
Residual TFA (guidance for PDE calculation provided in USP <467>)
Elemental Impurities (limits provided in USP <232>)
Bioburden (limits for TAMC and TYMC provided in Ph. Eur. 2.6.12)
Bacterial endotoxins (calculation of limits provided in USP <85>)
Limits for product-specific attributes may be set on a theoretical basis and/or process experience, for example:
Counterion content (calculation of theoretical content + “safety factor”)
Water content (based on experience with lyophilized peptides)
Considerations for Development of Specifications
16
© 2017 USP
Specifications for Purity/Related Substances are generally developed and refined throughout development, as the manufacturing process is optimized, analytical methods are improved and impurities are identified and controlled
In general, limits for all parameters should be set as loosely as possible initially, while still providing adequate control of critical variables, e.g. impurity profile (process flexibility) – should be tightened during development, based on data and process capability
Considerations for Development of Specifications (Continued)
17
© 2017 USP
Test Tentative Acceptance Criteria Method
Description
Appearance White to off-white powder Visual inspection
Solubility Determined by formulation
requirements
Visual inspection
Identification
Mass Spectrometry Theoretical monoisotopic mass ± 1-2 amu (depending on MW)
USP <736>
MS/MS Sequence Analysis
(Tandem Mass Spectrometry)
Conforms to sequence USP <736>
Amino Acid Analysis (AAA) Theoretical ratios ±15%, except for
except for Cys, Ser, Trp, Ile, Val and
Pro, whose recovery may be low
USP <1052>; hydrolysis
method 1, analysis method 1
RP-HPLC Co-elutes with standard (if available) Product specific
Preliminary Specifications for Peptide APIs
18
© 2017 USP
Test Tentative Acceptance Criteria Method
Peptide Content Report result Quantitative AAA
Nitrogen Content
Organic Impurities [Related Substances by (U)HPLC]
Peptide Purity ≥95% (by area integration; excluding
pyroglutamic acid or dimer formation,
if applicable)
Product specific
Related Substances ≤5% total
Individual Impurities ≤1%
Other tests
Counterion Content (RP-HPLC
or ion chromatography)
Report result USP <503> or
USP <1065>
Water Content (Karl Fischer) ≤10% USP <921> (method 1c)
Total Mass Balance 90 to 105% Calculation
(peptide content + counterion
content + water content)
Preliminary Specifications for Peptide APIs (Continued)
19
© 2017 USP
Test Tentative Acceptance Criteria Method
Other tests
Residual Organic Solvents Complies with USP <467> limits;
piperidine, diisopropylethylamine:
report results (if applicable)
USP <467>
Residual TFA (RP-HPLC or ion
chromatography)
≤0.25% (justify on basis of PDE
calculation)
USP <503.1> or
USP <1065>
Elemental Impurities Complies with USP <232> limits USP <233>
Bioburden
TAMC
TYMC
<1000 CFU/g
<100 CFU/g
USP <61>
(membrane filtration method)
Bacterial Endotoxins (LAL) To be determined (based on maximum
allowed exposure limit, e.g., 5 EU/kg/hr
for IV)
USP <85>
Preliminary Specifications for Peptide APIs (Continued)
20
© 2017 USP
Compendial methods
Must be shown to be suitable for all phases of development
– Lack of interference
– Recovery studies
Non-compendial methods (mainly related substances)
Phase I/II:
– Appropriate qualification required, particularly with respect to specificity
– Must be shown to be stability-indicating using forced degradation studies, where appropriate, to support ongoing stability studies
Phase III:
– All methods should be validated prior to initiating process validation
In-process methods
– Should be appropriately validated prior to initiating process validation, e.g.:
▪ In-process HPLC methods used during purification should be validated, at a minimum, for
specificity, linearity, robustness and LOQ
Note: Methods are often an adaptation of release methods
Validation Recommendations
21
© 2017 USP
I. Eggen, B. Gregg, H. Rode, A. Swietlow, M. Verlander and A. Szajek (2014). Control Strategies for Synthetic
Therapeutic Peptide APIs. Part III: Manufacturing Process Considerations. Pharm. Tech. May edition.
Formation of Product-related Impurities in Synthetic Peptides
22
© 2017 USP
*Note: possibility of β-Ala containing impurities derived from Fmoc-amino acid derivatives
HPLC = high performance liquid chromatography; LC-MS = liquid chromatography-mass spectrometry;
LC-MS/MS = liquid chromatography-tandem mass spectrometry; AAA = amino acid analysis
Process-derived Related Substances in Synthetic Peptides
Impurities Origin of Impurities Identification MethodHPLC
Detectability
Deletion Synthesis LC-MS or LC-MS/MS +/-
Insertion* Raw material
or Synthesis
LC-MS or LC-MS/MS +/-
Truncation Synthesis LC-MS +
Diastereomer Raw material
or Synthesis
HPLC spiking with synthesized
diastereomeric analogs; chiral GC-MS
+/-
Substitution
(Leu/Ile)
Raw material HPLC spiking with synthesized
analogs or isolation/AAA
-
Functional group
modification
Synthesis
or Stability
LC-MS or LC-MS/MS +/-
Disulfide
modification
Synthesis
or Stability
LC-MS or LC-MS/MS ++
23
© 2017 USP
HPLC = high performance liquid chromatography; LC-MS = liquid chromatography-mass spectrometry; LC-MS/MS =
liquid chromatography-tandem mass spectrometry;
HPLC-IEX = high performance liquid chromatography-ion exchange chromatography;
HPLC-SEC = high performance liquid chromatography-size exclusion chromatography.
Related Substances in Peptides – Degradants
ImpuritiesIdentification
Method
HPLC
Detectability
Deamidation of Gln/Asn/
C-terminus
LC-MS or LC-MS/MS; HPLC-IEX; HPLC
spiking with synthesized analogs
+/-
Acetylation of amino functions LC-MS or LC-MS/MS ++
Oxidation (especially Met sequences) LC-MS ++
β-Asp formation in Asp or Asn sequences LC-MS or LC-MS/MS; (HPLC-IEX) -
Backbone cleavage LC-MS ++
Disulfide modification LC-MS or LC-MS/MS ++
Aggregation HPLC-SEC ++
Modifications caused by excipients (e.g.
degradants of PLGA or PEG)
LC-MS or LC-MS/MS ++
24
© 2017 USP
ICH Q3A Impurities in New Drug Substances
Note: Applies only to new drug substances manufactured by chemical synthesis; peptides and
biological/biotechnology products specifically excluded
Impurity Thresholds in Drug Substances
Maximum
Daily Dose
Reporting
Threshold
Identification
Threshold
Qualification
Threshold
≤2g/day 0.05% 0.10% or 1.0 mg per day
intake (whichever is lower)
0.15% or 1.0 mg per day
intake (whichever is lower)
>2g/day 0.03% 0.05% 0.05%
25
© 2017 USP
EP General Monograph 2034 Substances for Pharmaceutical Use
Table 2: Reporting, identification and qualification of organic impurities in peptides obtained by chemical synthesis
Not accepted by US FDA and some other regulatory agencies which work on a case-by-case
basis and require specification limits to be justified
Impurity Thresholds in Drug Substances (Continued}
Reporting threshold Identification threshold Qualification threshold
≥0.1% >0.5% >1.0%
26
© 2017 USP
Draft Guidance: ANDAs for Certain Highly Purified Synthetic Drug Products That Refer to Listed Drugs of rDNA Origin (US FDA, October 2017)
Scope limited to the following products:
Glucagon, liraglutide, nesiritide, teriparatide and teduglutide
“Given the current state of technology for peptide synthesis and characterization, FDA believes it is now possible for an ANDA applicant to demonstrate that the active ingredient in a proposed generic synthetic peptide drug product (proposed generic synthetic peptide) is the “same” as the active ingredient in a previously approved peptide of rDNA origin.”
Recent Peptide Guidance Document
27
© 2017 USP
Draft Guidance: ANDAs for Certain Highly Purified Synthetic Drug Products That Refer to Listed Drugs of rDNA Origin (US FDA, October 2017)
Impurities :
New impurities ≤0.5%
Common impurities (including degradants) ≤RLD
New impurities ≥0.10% and ≤0.5% must be identified and justified on the basis of lack of
impact on physicochemical properties, biological activity or immunogenicity risk
Use of UHPLC-HRMS methods recommended
Recent Peptide Guidance Document (Continued)
28
© 2017 USP
Regulatory expectations are increasingly focused on the use of UHPLC methods, especially for longer, more complex sequences
It is strongly recommended that method development should start early so that the impact of process changes during manufacturing process development can be assessed (also stability studies)
Multiple, orthogonal methods are recommended in order to minimize therisk of co-elution of impurities with the main peak, or with each other
At least one method should be MS-compatible
Additional characterization methods may be required, e.g.:
–Chiral analysis if stereoisomers are not resolved
–Peak purity analysis by LC-MS (UV peak purity may not be sufficient)
Maintaining resolution: assess method robustness
Expectations for Related Substances Methods
29
© 2017 USP
The suitability of the method(s) should be assessed for process-related impurities and degradation products
Forced degradation studies should be performed to support method suitability
Structural assignments should be confirmed through synthesis where possible
Tox batch should be used as standard for impurity profile
Should be manufactured by same process as clinical batches but of lower purity than
routine production batches
Impact of process changes on impurity profile should be assessed against tox batch
Expectations for Related Substances Methods (Continued)
30
© 2017 USP
Requirements unclear since most general guidance documents specifically exclude synthetic peptides
Likely to be treated on a case-by-case basis by US FDA
Focus of development should be resolution and quantitation of process-related impurities and degradation products from the substance and also from each other, if possible
Should be confirmed using HR-MS studies
May be difficult for complex sequences
May not be possible with a single method
Identification of Related Substances
31
© 2017 USP
2-Dimensional LC-MS can facilitate identification of impurities in non-LC-MS compatible mobile phases
Identification can be used for optimization/control of manufacturing process
Quantitation may be difficult or impossible for co-eluting peaks (i.e., coelution of impurities with the product or co-elution of impurities with each other)
Note: Area percentages expected to reflect wt. %, based on similar UV extinction coefficients of product and impurities (Kuipers B.J.H. and Gruppen H., J. Agric. Food Chem. 2007, 55, 5445)
Identification of Related Substances (Continued)
Examples from Method Development Studies
33
© 2017 USP
Peptides containing Asx-Gly, Asx-Ala, Asx-Ser, and Asx-Phe (and often other Asx dipeptide sequences) are known to undergo the transformations indicated on the scheme below, where R1 denotes the N-terminal part of the sequence, R3 denotes the C-terminal part of the sequence and R2 depends on the amino acid (Gly: R2 = H; Ala: R2 = CH3, Ser: R2 = CH2-OH; Phe: R2 = CH2-Phe). Low pH (<7) typically favors form (2), whereas high pH favors form (3) and/or cleavage (4).
*Asx = Asp, Asn; Y = Gly, Ala, Ser, Phe
Degradation of Peptides Containing Asx-Y Sequences*
R3
NH
O
O
N CH
O
R1 R2
R3
NH
O
O
NH
CH
O
R1 R2
OH
R3
NH
O
O
NH
CH
O
R1 R2OH
R3NH2
CH
O
R2NH
O
O
R1
OH
OH
(1) (2) (3)
+
(4)
34
© 2017 USP
ACTH (1-39): SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF
System: TFA* System: TEAP*27 to 47% in 40 min 21 to 41% in 40 minRs = 0.7 Rs = 1.2
System: NaClO4* System: IEX, pH 7.0**31 to 51% in 40 min 5 to 65% in 40 minRs <0.5 Rs = 6.7
*Column: Supelco Discovery HS C18, 150 x 4.6 mm, 3 µm, 120 Å
**Column: Polysulfoethyl A, 200 x 4.6 mm, 5 µm, 200 Å
Analytical Development: ACTH (1-39) vs. [Asp]25-ACTH (1-39)
0 10 20 30
Time (min)
020
040
0
0 10 20 30
Time (min)
010
020
030
040
0
mA
U0 10 20 30
Time (min)
010
020
030
0
mA
U
0 10 20 30
Time (min)
020
4060
8010
012
014
0
mA
U
35
© 2017 USP
GLP-2: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Mobile Phase A = 0.1% TFA/H20 Mobile Phase A = TEAP, pH 2.3 Mobile Phase A = KPF6
Mobile Phase B = 0.1% TFA/ACN Mobile Phase B = ACN Mobile Phase B = ACNFlow Rate = 1.5 mL/min Flow Rate = 1.5 mL/min Flow Rate = 1.5 mL/minTemperature = Ambient Temperature = Ambient Temperature = AmbientGradient = 35% - 60% B Gradient = 35% - 60% B Gradient = 35% - 60% B Time = 25 min Time = 25 min Time = 25 min
Separation of Degradants in Peptides Containing Asx-Y Sequences
97.82% 93.58% 86.73%
36
© 2017 USP
Column: ACQUITY UPLC Peptide CSH 130 C18, (150 x 2.1 mm) 1.7 µm; flow rate = 0.1 mL/min; run time = 90 min
UHPLC Separation of Impurities During Development
37
© 2017 USP
LOQ of method(s) must be taken into account
For shorter peptides (≤10 AAs), FDA may require ICH Q3A limits for related substances (i.e., identification at the level of 0.10%)
For generic products, limits generally determined by those present in the innovator’s product
Limits for individual impurities may not exceed those for the same impurities in the
innovator’s product (comparison may be difficult since API from innovator usually not
available)
Limits for new impurities (i.e., not present in the innovator’s product) likely to be
negotiated with FDA and may be relatively strict (e.g., 0.1-0.2% for smaller peptides and
up to 0.3-0.5% for longer sequences)
If monograph exists, limits for identified and unidentified impurities usually specified
Setting Limits for Related Substances
38
© 2017 USP
For new, proprietary products limits for identified and specified (e.g., by RRT or MW), unidentified impurities may be set on the basis of levels that have been qualified in tox studies and process capability established during development
Limits for unidentified impurities are likely to be negotiated with FDA on a case-by-case basis
Setting Limits for Related Substances (Continued)
39
© 2017 USP
Bioassay
Traditionally used to measure the potency of products relative to a standard
–reflects the mechanism of action of the product and is defined in “units” of activity, not mass
Generally not a requirement for release testing of synthetic peptide APIs
Bioidentity
Like bioassay, must reflect mechanism of action, maintaining a link to clinical activity
May be similar to a bioassay but generally requires less replicates since the specification is usually “not less than” a specified value
While this may be a requirement for release testing of some peptide APIs manufactured by recombinant techniques (e.g., teriparatide, salmon calcitonin), generally not required for synthetic peptides, since they can be fully characterized by physicochemical techniques (exception: bivalirudin).
Expectation that bioidentity should be included as part of characterization studies, especially for more complex sequences.
Bioassay/Bioidentity considerations
40
© 2017 USP
Peptides are specifically excluded from most guidance documents
To date, the US FDA has not published any general guidance for peptides, specifically for impurities (identification and qualification)
FDA may require ICH Q3A limits for related substances in shorter peptides (≤10 AAs)
Characterization studies should be used throughout development to support the establishment of specifications
Specifications for many quality attributes based on existing guidance
Impurity identification important for manufacturing process optimization
Specifications and associated limits should evolve during development, based on process refinements, development of analytical methods and process experience
The October 2017 Draft Guidance may be indicative of FDA’s current thinking for complex synthetic peptide therapeutics
Final Thoughts
41
© 2017 USP
Send USP your comments on the new General Chapter <1503> Quality Attributes of Synthetic Peptide Drug Substances, online May 1, 2019in the Pharmacopeial Forum 45(3), see: https://www.uspnf.com/pharmacopeial-forum-new
Submit your abstract for a talk or poster (or attend) in the next USP Workshop on Peptide and Oligonucleotide Therapeutics: Regulations, Standards and Quality, November 4-5, 2019, see: https://www.usp.org/events-training/workshops.
Opportunities to Get Involved with USP Standard Setting
Thank You!