Upload
others
View
3
Download
0
Embed Size (px)
Citation preview
1
Introduction to Bioinformatics
Dr. rer. nat. Gong Jing
Cancer Research center
Medicine School of Shandong University
2012.11.14
Introduction to Introduction to BioinformaticsBioinformatics
2
Case
Study
Introduction to Introduction to BioinformaticsBioinformatics
3
How SIGIRR inhibit the TLR4 and 7 signaling pathways?
Case 1
Model Construction for Toll-like receptor ectodomains.
Case 2
Introduction to Introduction to BioinformaticsBioinformatics
4
Case 1
How SIGIRR inhibit the Toll-like receptors TLR4 and 7 signaling pathways?
Introduction to Introduction to BioinformaticsBioinformatics
5
Leucine-rich repeat (LRR)
Ectodomain(ECD)
Transmembranedomain
TIR domain
Background : Structure of Toll-like receptors (TLRs)
Introduction to Introduction to BioinformaticsBioinformatics
6
Introduction to Introduction to BioinformaticsBioinformatics
TLR signaling pathways
7
Determined crystal structures of TLR ECD-ligand-ECD complexes:
A: human TLR2-1 C: human TLR4-4 E: human TLR5-5 B: mouse TLR3-3 D: mouse TLR2-6
Introduction to Introduction to BioinformaticsBioinformatics
E
8
Upon receptor activation, an intracellular TIR signaling complex is formed between the receptor and downstream adaptor TIR domains.
MyD88 (Myeloid differentiation primary response protein 88) was the first intracellular adaptor molecule characterized among all known adaptors in the TLR signaling. It consists of an N-terminal death domain (DD) separated from its C-terminal TIR domain by a linker sequence.
MyD88 also forms a dimer through DD-DD and TIR-TIR domain interactions when recruited to the receptor complex. MyD88 can recruit IRAK (IL-1RI-associated protein kinases) through its DD to continue signaling and, finally, to induce the nuclear factor-kB (NF-kB) leading to the expression of type I interferons.
TIR
DD
Introduction to Introduction to BioinformaticsBioinformatics
9
Leucine-rich repeats (LRRs)
(single immunoglobulin interleukin-1 receptor-related molecule)
Single immunoglobulin (Ig)
Toll/interleukin-1receptor (TIR) domain
TIR domain
73 AA C-terminal tail
TLR SIGIRR
SIGIRR (Single immunoglobulin interleukin-1 receptor-related molecule, TIR8) was initially identified as an Ig domain-containing receptor of the TLR/IL-1R superfamily. But, both the extracellular and intracellular domains of SIGIRR differ from those of other Igdomain-containing receptors
Introduction to Introduction to BioinformaticsBioinformatics
10
SIGIRR acts as an endogenous inhibitor for MyD88-dependent TLR and IL-1R signaling.
Systemic Lupus Erythematosus(SLE, 系统性红斑狼疮) is caused by TLR7-mediated induction of type I
interferons.
mouse B6lpr/lprSigirr-/-mouse B6lpr/lprSigirr+/+
Lech et al., JEM, 2008
Introduction to Introduction to BioinformaticsBioinformatics
11
bind to TLR4 inhibit signaling
ΔN yes yes
ΔC yes yes
ΔTIR no no
Full-length
yes yes
ΔN : lacking the extracellular Ig domain
ΔTIR : lacking the intracellular TIR domain
ΔC : lacking the C-tail of the TIR domain
Conclusion: only the TIR domain (excluding the C-tail part) is necessary for SIGIRR to inhibit TLR4 signaling.
Qin et al., 2005 JBC
Introduction to Introduction to BioinformaticsBioinformatics
12
Objective: to find a structural explanation for these TIR-TIR interactions.
1. Structure prediction of TIR domains of TLRs, MyD88 and SIGIRR.2. Structure analysis/docking.
Hypothesis: SIGIRR blocks the molecular interface of TLR4 and MyD88 via its TIR domain
Introduction to Introduction to BioinformaticsBioinformatics
13
Step 1 : model construction
Amino acid sequences of the target proteins, human TLR4, TLR7, MyD88, and SIGIRR were extracted from the Expasy Uniprot Database.
Three-dimensional models of TLR4, TLR7, MyD88 and SIGIRR (without the C-tail) were constructed by homology modeling. Due to the homology of the target proteins, four common templates were obtained via BLAST search against the Protein Data Bank (PDB). They were TIR domains of TLR1 (1FYV), TLR2 (1FYW), TLR10 (2J67) and IL-1RAPL (1T3G).
In the secondary structure-aided alignments for the homology modeling, the average target-template sequence similarity of TLR4, TLR7, MyD88 and SIGIRR was 51.7%, 50.4%, 44.5% and 42.7%, respectively
Multiple sequence alignment of each target with the templates was generated with MUSCLE and analyzed with Jalview. Because the secondary structure of the TIR domain is composed of well-organized alternating β-strands and α-helixes, the alignments were adjusted manually according to the secondary structure information to improve the alignment quality. The secondary structure of each target was predicted by PSIPRED.
Introduction to Introduction to BioinformaticsBioinformatics
14
Step 1 : model construction
The resulting structures exhibit a typical TIR domain conformation in which a central five-stranded parallel β-sheet (βA- βE) is surrounded by a total offive α-helixes (αA–αE) on both sides. The loops are named by the letters of the secondary structure elements that they connect. For example, the BB-loop connects β-strand B and α-helix B. The structure of NSF-N was identified as a template for SIGIRR’s C-tail through protein threading.
crystal structure of IL1-RAPL (1T3G)
To improve the model quality, ModLoop was used to rebuild the coordinates of the low quality loop regions. Finally, model quality assessment programs: ProQ, ModFOLD and MetaMQAP were used to evaluate the output candidate models and select the most reliable one.
Introduction to Introduction to BioinformaticsBioinformatics
15
Step 1 : model construction
The BB-loop and αE of TLR4, TLR7 and MyD88, along with the BB-loop of SIGIRR, may be important to ensure binding specificity achieved by different combinations of TIRs during signaling.
Introduction to Introduction to BioinformaticsBioinformatics
16
Step 1 : model construction
Surface charge distribution (APBS electrostatics generated by VMD) of BB-loop and αE were represented with red indicating areas of negative charge and blue indicating positive charge.
Accordingly, all BB-loops can be divided into two self-complementary parts. The N-terminal (upper region of BB-loops) is negatively charged, whereas the C-terminal (lower region of BB-loops) is positively charged. The αEs, by contrast, are predominantly positive.
Introduction to Introduction to BioinformaticsBioinformatics
17
Step 2 : protein-protein docking
Unrestrained pairwise model docking included eight complexes of TIR domains: TLR4-TLR4, TLR7-TLR7, MyD88-MyD88, TLR4 dimer-MyD88 dimer (tetramer), TLR7 dimer-MyD88 dimer (tetramer), TLR4-SIGIRR, TLR7-SIGIRR and MyD88-SIGIRR. We used GRAMM-X and ZDOCK, which are widely accepted rigid-body protein-protein docking programs, to predict and assess the interactions between these complexes.
The buried surface interaction area of dimer models were calculated with the protein interfaces, surfaces and assemblies service (PISA) at the European Bioinformatics Institute (EBI).
Introduction to Introduction to BioinformaticsBioinformatics
18
Step 3 : hypothesis model construction
From a large number of docking results we established such a model of SIGIRR inhibiting the TLR7 signaling pathways.
Introduction to Introduction to BioinformaticsBioinformatics
19
Step 3 : hypothesis model construction
From a large number of docking results and we established such a model of SIGIRR inhibiting the TLR7 signaling pathways.
Introduction to Introduction to BioinformaticsBioinformatics
20
Step 3 : hypothesis model construction
From a large number of docking results and we established such a model of SIGIRR inhibiting the TLR7 signaling pathways.
Lech et al., 2010 J. Pathol.
Introduction to Introduction to BioinformaticsBioinformatics
21
Step 3 : hypothesis model construction
From a large number of docking results and we established such a model of SIGIRR inhibiting the TLR4 signaling pathways.
Introduction to Introduction to BioinformaticsBioinformatics
22
Step 4 : Conclusion
In summary, we propose a residue-detailed structural framework of SIGIRR inhibiting the TLR4 and 7 signaling pathways. These results were obtained by computer modeling and are expected to facilitate efforts to design further site-directed mutagenesis experiments to clarity the regulatory role of SIGIRR in inflammatory and innate immune responses.
Inhibition of the Toll-like receptors TLR4 and 7 signaling pathways by SIGIRR: a computational approach
J. Struct. Biol., 2010, 169:323-330
IF: 4.06, SCI citation times: 10
Jing Gong, Tiandi Wei, Robert W. Stark, Ferdinand Jamitzky, Wolfgang M. Heckl, Hans-Joachim Anders,
Maciej Lech and Shaila C. Röessle.
Introduction to Introduction to BioinformaticsBioinformatics
23
Case 2
Model Construction for Toll-like receptor ectodomains
Introduction to Introduction to BioinformaticsBioinformatics
24
TLR sequencesSo far, there are about 3000 protein sequences of different TLRs from different species saved in primary protein databases. The number will continue growing.
… …
Introduction to BioinformaticsEnglish Courses for Graduate Students
25
Leucine-rich repeat (LRR)
Ectodomain(ECD)
Transmembranedomain
TIR domain
Background : Structure of Toll-like receptors (TLRs)
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
26
ECD ofhuman TLR3
23 LRRs+
2 N/CT LRRs
22 LRR + 1 CT
22 LRR6 LRR + 2 N/CT
6 LRR + 1 CT 17 LRR
+ 2 N/CT
LRR identification
LRR identification
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
27
LxxLxLxxNxLxxLxxxxFxxLxx
PTNITVLNLTHNQLRRLPAANFTR
PTNITVLNLTHNQLRRLPAANFTR
NITVLNLTHNQLRRLPAANFTRY
PTNITVLNLTHNQLRRLPAA
NITVLNLTHNQLRRLPAANFTRY
LRR identification
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
28
Structural Motifs (3 Levels)Domains of each TLR
Signal Peptide (SP)Ectodomain (ECD)Transmembrane Domain (TD)TIR Domain
LRRs of each ECD
Segments of each LRRHighly Conserved Segment (HCS)Variable Segment (VS)Inserted Segment (IS)
2734 sequences, 2011/08/01
TollML database
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
29
Construction pipeline
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
30
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
Domain
s
LRRs
Segments
31
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
Position
Am
ino
acid
sLRR Finder
main algorithm :a position-specific weight matrix of LRR motifs
YesYes%
Example: … LPTNLTVLMLLHNQLRRLPAANFTRYSQLTSLDVGFNT …3.800 1.054
cutoffcutoff
NoNo2.232
32
Sens
itivi
ty/ S
peci
ficity
Cutoff score
Cutoff 1.5 1.6 1.7 1.8 1.9 2.0 2.1 2.2 2.3 2.4 2.5Sensitivity 0.942 0.933 0.924 0.916 0.907 0.886 0.868 0.858 0.842 0.822 0.805
Specificity 0.852 0.882 0.902 0.916 0.935 0.954 0.970 0.981 0.988 0.992 0.994
Spe. (filter) 0.914 0.930 0.953 0.959 0.972 0.981 0.987 0.991 0.994 0.996 0.997
3.800 1.0542.232Yes No No
Example: … LPTNLTVLMLLHNQLRRLPAANFTRYSQLTSLDVGFNT …
filterfilter
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
33
TollML and LRRFinder are freely available at http://tollml.lrz.de. Any internet user can search and download data from the database, but only registered users can define and save labels for arbitrary entries.
TollML: a database of toll-like receptor strutural motifs
J. Mol. Model., 2010, 16(7):1283-1289
IF: 2.34, SCI citation times: 4
Jing Gong, Tiandi Wei, Ning Zhang, Ferdinand Jamitzky, Wolfgang M. Heckl, Shaila C. Rössle and Robert W. Stark
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
34
2010/11
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
35
Construction pipeline
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
36
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
37
Every LRR structure can be viewed with an online molecular viewer – Jmol.
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
38
To simplify the homology modeling, the similarity search was implemented. It returns the structures of the most similar LRRs for a structure unknown LRR. At first, a global pairwisesequence alignment with sequence identity will be generated for the target LRR and each of the LRRs in the user selected set. Then, the most similar LRRs will be returned as template candidates, ranked by sequence identity.
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
39
LRRML contains individual three-dimensional LRR structures with manual structural annotations. It presents useful sources for homology modeling and structural analysis of LRR proteins. This database is freely available at http://tollml.lrz.de.
LRRML: a conformational database and an XML description of leucine-rich repeats (LRRs)
BMC Struct. Biol., 2008, 8:47
IF: 3.06, SCI citation times: 10
Tiandi Wei, Jing Gong*, Ferdinand Jamitzky, Wolfgang M. Heckl, Robert W. Stark and Shaila C. Rössle
*corresponding author
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
40
In mammalian, 13 TLRs have been identified. Protein sequences are available for a number of mammalian species. Using these sequences, a complete molecular phylogeneticanalysis and a phylogenetic tree of the known TLRs were reported. According to this tree, mammalian TLRs can be divided into six subfamilies. TLR1, 2, 6 and 10 belong to the TLR1 subfamily. TLR3 constitutes the TLR3 subfamily. TLR4 constitutes the TLR4 subfamily and TLR5 constitutes the TLR5 subfamily. TLR7, 8 and 9 compose the TLR7 subfamily. TLR11, 12 and 13 belong to the TLR11 subfamily.
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
41
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
E
Since 2000 the crystal structure of human TLR3 ECD was firstly reported, five crystal structures of receptor-ligand complexes have been determined.
They are :human TLR2-1 heterodimer, mouse TLR3 homodimer, human TLR4 homodimer, mouse TLR2-6 heterodimer, human TLR5 homodimer
42
TLR sequences
~3000 known TLR sequences
… …
Compared with the small number of crystal structures, there are about 3000 known protein sequences of different TLRs from different species. Because the X-ray crystallography remains time-consuming and sometimes it is very difficult to crystallize proteins, computational methods can perform fast and large-scale structural predictions based on the sequences. Currently, the most accurate protein structure prediction method is homology modeling.
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
43
When applying the homology modeling on the TLR ectodomains, we encountered a problem. The sequence identity between the target and the full-length template(s), namely the aforementioned crystal structures, is much lower than 30% because of diverse numbers and arrangements of LRRs contained in the TLR ectodomains. This problem is also described by the phylogenetic tree. Thus we could not get a proper model.
To solve this problem we developed an LRR template assembly approach with the help of both TollML and LRRML databases.
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
44
Flowchart of the LRR template assembly approach
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
45
Threading method Our Crystal structureFull-length templates LRR assembly TLR3 ECD
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
46
Superimposition of the model (blue) and crystal structure (orange) of TLR3 at the two ligand interaction regions. Global root mean square deviation: 1.96 Å and 1.90 Å.
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
47
Zhang et al., 2009.
If the root mean square deviation between a model and a structure is < 3 Å, the model is very good and can be used to perform ligand-docking and molecular replacement.
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
48Average target-template sequence identity >= 45%
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
49
Superimposition of the model (green) and crystal structure (orange) of TLR6. Global root mean square deviation: 1.94 Å; ligand-binding region: 1.18 Å.
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
50
These models can be used to perform ligand-docking studies or to design mutagenesis experiments to investigate TLR ligand-binding mechanisms, and thus help to develop new TLR agonists and antagonists that have therapeutic significance for infectious diseases.
A leucine-rich repeat assembly approach for homology modeling of human TLR5-10 and mouse TLR11-13 ectodomains.
J. Mol. Model ., 2011, 17(1):27-36
IF: 2.34, SCI citation times: 4
Tiandi Wei, Jing Gong*, Ferdinand Jamitzky, Wolfgang M. Heckl, Shaila C. Rössle and Robert W. Stark
*corresponding author
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
51
Exam
Thesis
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
52
Exam Thesis
Topic : What can bioinformatics do for you?
Language : English
Word count : 1000 - 2000
Deadline : 2012/11/30
Submit to : [email protected]
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
53
Format : 1. The following word processor file formats are acceptable for the thesis:
Microsoft Word (.doc) Rich text format (RTF) Portable document format (PDF)
2. You should choose a legible font and use double line-spacing. Your font should be no smaller than 11 pt font and no bigger than 12 pt font with standard margins.
3. All references must be numbered consecutively, in square brackets, in the order in which they are cited in the text, followed by any in tables or legends.
4. All pages should be numbered.
5. Greek and other special characters may be included. If you are unable to reproduce a particular special character, please type out the name of the symbol in full.
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
54
Thank you very much for your attention!
English Courses English Courses for for
Graduate StudentsGraduate Students
Introduction to Introduction to BioinformaticsBioinformatics
asdfsadf