Mass Spectrometer(MS)• 분자가 MS 내로 들어가면 분자는 이온화됨과 동시에 더 작은 이온들 (fragments) 로 쪼개진다 . 쪼개진 이온들은 그들의 질량 / 전하 (m/z) 비에 따라 선택적으로 분리되어 이온수에 비례해 signal 을 만든다 .• 이온들의 질량 / 전하비는 이온들의 생성된 양

(Abundance) 의 함수로 표시되어 mass spec-trum 이 그려지며 , 이 mass spectrum 을 이용하여 미지성분의 정성확인을 할 수 있다 .

• 이온은 양이온과 음이온 모두 사용

MS Component

MS component• Sample inlet 시료도입장치로 시료를 MS 내로 효율적으로 보내주는 역할을 한다• Ion source 시료분자를 이온화시키고 더 작은 이온으로 쪼갠다 . 생성된 이온들을 MS

analyzer 쪽으로 이동시킨다• Mass analyzer 이온들을 m/z ratio 에 따라 선택적으로 분리시킨다• Ion detector 이온 흐름을 그 양에 비례하게 전기적인 흐름으로 전환 , 증폭시켜 signal을 생성한다• Vacuum system MS 내 진공상태를 10-4 ~ 10-9 Torr 로 만들어 주어 최적의 상태로 분석이 진행될 수 있도록 한다 • Data System MS 내 각 구성성분들의 조절이 가능하며 시료분석과 동시에 데이터해석을 할 수 있는 곳이다

Sample introduction / ionization method:Ionization

methodTypical Analytes

Sample Introduction

Mass Range

Method Highlights

Electron  Impact (EI)Relatively 

small  volatile

GC or  liquid/solid 

probe

to  1,000  Daltons

Hard method  versatile  provides 

structure info

Chemical Ionization (CI)Relatively 

small  volatile

GC or  liquid/solid 

probe

to  1,000  Daltons

Soft method  molecular ion 

peak [M+H]+

Electrospray (ESI)Peptides  Proteins  nonvolatile

Liquid  Chromatography 

or syringe

to  200,000 

Daltons

Soft method  ions often  multiply  charged

Fast Atom Bombardment (FAB)

Carbohydrates  Organometallics 

Peptides  nonvolatile

Sample mixed  in viscous 

matrix

to  6,000  Daltons

Soft method  but harder  than ESI or 

MALDI

Matrix Assisted Laser Des-orption  (MALDI)

Peptides  Proteins 

Nucleotides

Sample mixed  in solid  matrix

to  500,000 

Daltons

Soft method  very high 

mass

Ion source • Gaseous sample introduction - EI(electron ionization) - CI(chemical Ionization)• Liquid sample introduction - FAB(fast atom bombardment) - ESI(electrospray ionization)(soft ionization)• Solid sample introduction - MALDI(soft ionization) (matrix-assisted laser desorption/ionization)

Ion Source - EI(electron ionization)

• 전자를 발생시키기 위한 filament 가 가열되고 (+) 극판에 전압이 걸리면 가속된 전자들이 흐르고 그 속을 지나던 기체화된 sample 은 전자와 충돌하여 에너지를 얻고 전자 하나를 잃어 분자이온 M+ 가 된다

• 이 방법은 큰 에너지를 사용하기 때문에 복잡한 spectrum 을 이루며 분자 이온을 얻기 힘들다

• M + e- ⇒ M+ + 2e-

Ion Source – CI(chemical Ionization)

• 가열된 filament 에서 발생 , 가속된 전자는 106 정도로 많은 reagent gas 와 충돌하여 이들을 이온화시키고 이 reagent gas ion 은 sample gas 와 충돌• 이 sample gas 는 fragmentation 되기도 하고 때로는 reagent gas ion 과 complex 를 이루기도 한다 . • 매우 낮은 에너지로 충돌하기 때문에 EI 보다 수백배 이상 많은 수의 분자 이온을 만들어 내기 때문에 분자량 확인에 많이 쓰인다 .• R(CH4) + e- ⇒ R+ + 2 e-

R+ + M ⇒ M1+ + N1 M1+ ⇒ M2+ + N2

Ion Source: ESIElectrospray ionization(ESI)• 용액 상태의 시료를 이온화 (LC-MS)• 기존의 방법으로는 얻기 힘들었던 intact

상태의 peptide 나 단백질을 이온화• 한 개 이상의 전하를 띤 이온을 생성

Ion Source: ESI• 시료용액이 고전압이 걸려 있는 capillary 를 통과하면서 분무되어 전하를 많이 띤 droplet 이 생성됨• dropolet 이 capillary 에서 orifice 를 지나면서 inert gas(or heat) 에 의해 desol-

vation• Desolvation 과정에서 ion 의 charge 는 더 증가하고 “ Coulombic explosion” 에 의해

droplet 의 ion 이 gas phase 로 된다 .• sample 에 가해지는 충격이 약하며 , multiple

charge 를 가진 peptide 이온이 생긴다 .

Ion Source: ESI

Ion Source: ESI

Ion Source: ESI

Ion Source: ESI

Ion Source: MALDIMatrix Assisted Laser Desorption Ion-

ization(MALDI)Laser

matrix + analyte

Sample support

a

mm

m

m

m

mm

m a

a

a

a

+

+

+

+m

am+

M A L D I

Why MALDI?-Less sensitive to salts-Lower PRACTICAL detection limits-Easier to interpret spectra(less multi-

ple charges)-Quick and easy-Higher mass detection-Higher Throughput(1000>samples per

hour)

Matrix

HO

CH C(CN)COOHOH

HO

COOH

HO

CH3O

CH3O

CH CHCOOH

-cyano-4-hydroxycinnamic acid 2,5-dihydroxybenzoic acid(2,5-DHB)

Sinapinic acid(3,5-Dimethoxy-4-hydroxy cinnamic acid)

HO

CH C(CN)COOHOH

HO

COOH

HO

CH3O

CH3O

CH CHCOOH

-cyano-4-hydroxycinnamic acid 2,5-dihydroxybenzoic acid(2,5-DHB)

Sinapinic acid(3,5-Dimethoxy-4-hydroxy cinnamic acid)

Biomolecule Analysis과거에는 ?• Electrophoresis, chromatography, ultra-

centrifugation• Not very precise

MS 이용하면 ?• Proteins, oligonucleotides, oligosaccha-

rides, lipids• Detect modifications and sequences

Biomolecule Analysis• Mass is one of first measurements to characterize biopolymers

• Up to 1970s, had to use–Elec-trophoresis–Chromatography–Ul-tracentrifugation–Not very precise (10 –100% relative error!!)

• May use MS on most biomolecules–Proteins–Oligonucleotides–Oligosaccha-rides–Lipids

• May detect modifications and se-quences–Post translational and other

Peptide Mass Fingerprinting

• Analytical technique for protein identifica-tion (protein sequence)

• Unknown protein of interest cleaved into peptide by protease

• Collection of peptides resulting from this cleavage comprise a unique identifier of the unknown protein

• Mass measured with MALDI-TOF and ESI-TOF

• in silico compared to the genome

• Computer programs translate the known genome of the organism into proteins

• Theoretically cut the proteins into peptides with the same protease (ex.Trypsin: K or R)

• Calculate the absolute masses of the peptides from each protein

• the masses of the peptides of the unknown protein vs the theoretical peptide masses of each protein encoded in the genome

• Results statistically analyzed to find the best match

In Gel Digestion & Mass Spectrometry

Trypsin Digest

Cut out 2D-Gel Spot

Protein Peptides

Peptide Mass Finger-printing

Trypsin

N KK

KK

KK

R

RR

RC

N

C

K

KK

K

K

K R

R

R

RProtein

Tryptic peptide mixture. Masses measured by MS. Every peptide has a basic C-terminus.

A protein can be identified in a database by matching masses of a subset of the tryptic peptides against calculated values.

MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT

intact protein enzyme

peptide fragments

Peptide Mass Finger-printing

2D-Gel

In Gel Digestion

MS

848.11272.5492.6

883.22978.9

812.61432.33127.1996.8702.4164.92748.2

848.31272.7493.2882.62978.3364.1948.93128.8

Database

3514.22837.1263.9147.41429.7199.6142.3640.8

Is identical to

In Silico Digestion“Spot removal”

Protein sequence Analy-sis

Protein sequence Analysis

Deduction of Full Amino Acid Sequence of a Proteinby Overlapping the Sequences Obtained from individual Peptides

Edman Degradation Sequentially Removes One Residue at a Timefrom the Amino End of a Peptide up to 50 times

Each round

can be complete

within 1 hr and

the Edman degradation

can be repeated

up to 50 cycles

in Practice.

Measured peptide mass 와 se-quence 가 맞지 않는 경우

• The additional masses are due to post-translational or artifactual modifications or post-translational processing

• Unspecific proteolysis had occurred or con-taminating protease was present

• Protein was part of a mixture of ‘contami-nating’ proteins

Post Translational Modifica-tions(PTM’s)

• PTM’s are very important in signal-ing as well as metabolic pathways (e.g. phosphorylation)

• Often we want to know not only which modification a protein has undergone, but exactly where in the sequence the modification lies.

• Many of the search engines allow for “variable” modifications, but very few at one time (combinato-rialy explosive)

• There is great opportunity here for robust searches that find PTM’s re-liably!

Phosphorylation site analysis strategies

• Complication of phosphoprotein analysis

- the frequently low stoichiometry of phosphorylation

- the presence of multiple, differentially phosphorylated forms

• In vitro analysis - scale up of protein by kinase reaction - comparison with 2D-PP maps of in vivo

(confirmation of identity indirectly) - MS analysis

Detection and isolation of phos-phoproteins

• For the analysis of the site(s) of protein phosphorylation - purification of phosphoprotein - enzymatic or chemical fragmentation of the phosphoprotein

- Isolation, separation, analysis of peptide• Isolation - separation of proteins by gel electrophoresis - fragmentation of the phosphoprotein band or spot - extraction of the generated phosphopeptide• More positive identification - 32 P radiolabelling : in vivo(32 PO4), in vitro([γ-32P]ATP) - western blotting : particularly tyrosine phosphorylated pro-

tein

Separation of phosphopeptides• 필요한 이유 - 농도를 농축하는 역할을 하여 S/N 비를 높임 - radiolabel 의 activity 를 이용하여 phos-

phopeptide 의 상대적 또는 절대적인 양을 구할 수 있음 - separation 에 의해 확보된 재현성으로 단백질의 phosphorylation 상태를 정량적으로 결정할 수 있음 - nonpeptide contaminants 를 제거하여 적은 양의 phosphopeptide 의 분석을 용이하게 함

Phosphopeptide separation tech-niques

• By 2-dimensional phosphopeptide map• Reversed-phase HPLC• High-resolution gel electrophoresis• Immobilized metal affinity

chromatogrphy(IMAC)• Phosphopeptide 는 상대적 , 절대적으로 적은 양 때문에 분석이 어려우므로 이러한 점을 극복할 수 있는 최적의 separation 방법을 선택해야

Separation by 2D-PP• 1st dimension by electrophoresis on thin-layer cellu-

lose plate + 2nd dimension by TLC on the same plate• information - radiolabelled spot 수 ⇒ phosphorylated sites

최대수 - radiolabelled spot 의 intensity ⇒ peptide 들의 상대적인 phosphorylation 정도 - relative state between phosphopeptide• MS analysis after extraction from plate - protease 양이 중요 • sensitive and reproducible by radiolabelling

Separation by RP-HPLC• Reproducible and simple• column 으로 분리하고 radioactivity count 로 fraction ⇒ count 를 시간의 함수로 하여 radioactive fraction 의 수를 알 수

있음• 단점 - very hydrophilic phosphopeptide, very hydrophobic phos-

phopeptide 의 분리가 어렵다 - 2D-PP 보다 resolution 이 낮다 - phosphopeptide will stick to metal surface• 장점 - ESI MS 와 on line 으로 연결하여 사용할 수 있다 (LC-MS/MS) - isotope 을 사용할 수 없는 인체 단백질 분석 가능

Separation by high-resolution electrophorsis and IMAC

• High-resolution gel electrophoresis - 2-DE - 특정 phosphopeptide 의 손실이 많지만 널리 보급되어 있어 사용하기 좋음• IMAC - 같은 sequence 를 갖는 nonphosphorylated peptide에 비하여 상대적으로 매우 적은 양의 phosphorylated

peptide 의 분석 어려움 - separation and enrichment 1) phosphopeptide 와 metal(Fe3+ ,Ga3+) 의 chelat-

ing 2) elution by phosphate or increased pH 3) acidic amino acid 도 enrichment 되는 단점

Determination of the type of phosphorylated amino acid

• 이유 가능한 phosphorylated site 의 수를 찾아냄으로써 polypep-

tide 내의 phosphorylated residues 의 assignment 를 쉽게 할 수 있음• Technique 1) phosphoamino acid analysis - 32P-amino acid(hydrolysate of 32P-labeled phosphoprotein or phosphopeptide) ⇒ autoradiogra-

phy - phosphoamino acid standard ⇒ ninhydrin staining - sample 과 standard 의 비교 분석 ( 보통 1site/phospho-

peptide) 2) phospho-amino acid-specific immunodetection - antibodies specific for particular phospho-amino acid - 상업적으로 antibody 판매

Determination of the site of phosphorylation

• Chemical phosphopeptide sequencing - phosphopeptide sequencing by step-wise chemical degradation(nonradioactive, radioactive methods) - analyzed as phenylthiohydantoyl derivatives - not available in very limited amount• Mass spectrometric analysis of phospho-

peptides - phosphopeptide 의 양이 1pmole 이상이면 2D-PP map 에서 extraction 이 가능하고 , MS 로 분석이 가능 - two basic theme 1) chemical lability of the phosphate ester bonds 2) the detection of the mass added to a peptide (80u) - product ion scan in a tandem MS 으로 phosphorylation site 확인 ⇒ phosphorylated amino acid type 을 알고 있으면 더 용이

Mass scan for phosphopeptides analysis

• In-source CID - identify phosphopeptides by observation of H2PO4

-(97U), PO3-(79U) and PO2

-(63U) - detect phosphopeptides in negative ion mode

and then switch to positive ion mode • Neutral loss scan - positive ion mode with ESI in a TQ MS - Q1, Q3 are scanned over different m/z ranges - neutral loss of phosphoserine and phosphothreonine : 98

Mass scan for phosphopeptides analysis

• Presursor ion scan - negative ion ESI( 다시 positive ion mode 로 변경 ) - Q1 : continous scan, Q2 : ion fragmentation Q3 : 79m/z(PO3

-) 를 잃은 ion 만 통과 • Product ion scanning - in-source CID, neutral loss and precursor ion scanning 는 특수한 경우에만 phosphorylated residue 를 identify - 상기 3 가지 방법을 이용할 수 없는 경우 peptide fragment ion 전체에 대한 해석이 필요

Mass scan for phosphopeptides analysis

• Post-source decay MALDI• Enzymatic and chemical dephosphorylation - MALDI-TOF 로 phosphopeptide 의 mass 측정 + phosphate 를 제거 후 MALDI-TOF 로 mass 측정 - nonphosphorylated peptide 에서 phosphopeptide 를 확인하는데 쉽게 이용 - identification of phosphorylation sites using MS/MS

Emerging methods and future direc-tions in phosphoprotien analysis

• in vivo 와 비교해서 in vitro 로 시험하나 동일하다는 보장이 없음 ⇒ in vivo 를 직접

• in vivo 32P-labeled protein 을 충분히 얻는다는 것은 어려우므로 분석기기 감도를 높이는 것이 유리

Present and future challeges and op-portunities

• Protein identification and char-acterization has to be performed in a high-throughput manner, ef -ficiently and with high accuracy and sensitivity

• Robotic system• 2D-chromatography MS/MS