Upload
others
View
2
Download
0
Embed Size (px)
Citation preview
PreviousdiseasereportscanbeseenontheRuVASAwebsitewww.ruvasa.co.za
ClickonDiseaseReports
Thefollowingpracticesandlaboratories(121)submittedreportsduringNovember2016:Mpumalanga(11)Balfour–Dr.LouisvanJaarsveldBethal–Dr.HardusPietersBushbuckridge–Dr.MartinJansenErmelo–Drs.PotgieterandSteinbergGrootvlei–Dr.NeelsvanWykKarino(Nelspruit)–Dr.SilkePfitzerNelspruit–Dr.AndréBeytellMiddelburg–Malan,ErasmusanBernitzPietRetief–Drs.NiebuhrandWeberStanderton–Dr.KobieKroonVolksrust–Drs.Watson,SolomonandScheepersGauteng(6)Bronkhorstspruit–Drs.DeBruin,DeBruin,RudolphandSlabberMagaliesburg–Dr.RyanJefferyNigel–Dr.CindyvanderWesthuizenPretoria–Dr.HannekePienaarPretoria–Dr.RosalySteynVanderbijlpark–Dr.KobusKokLimpopo(9)Bela-Bela–Dr.NeleSabbeBela-Bela–Drs.DuToit,Bester,HansenandHerbstLephalale–Dr.BrigitteLuckMakhado(LouisTrichardt)–Drs.Harris,KlopperandJacosModimolle–Drs.Bredell,BarnardandSlabbertMokopane(Potgietersrus)-Dr.HenkVisser
MonthlyreportonlivestockdiseasetrendsasinformallyreportedbyveterinariansbelongingtotheRuminantVeterinaryAssociationofSouthAfrica(RuVASA),agroupoftheSouthAfricanVeterinaryAssociation
November2016
Polokwane(Pietersburg)–Drs.Watson,Viljoen,JansenVanVuuren,VanRooyen,SnymanandCremonaVaalwater–Dr.HampievanStadenVaalwater–Dr.AnnemiekevanderGootNorthWest(9)Brits–Drs.BoshoffandCoertzeChristiana-Dr.PieterNelKlerksdorp–Drs.VandenBergandTheronLeeudoringstad–Dr.IanJonkerLichtenburg–Dr.NelmarieKruger-RallRustenburg–Drs.Grobler,Sparks,VanEgdom,VanRooyen,GoosenandVanRensburgStella-Dr.MagdaleenVosserVentersdorp/Koster–Drs.MaraisandBenadéVryburg–Dr.JurieKritzingerFreeState(23)Bethlehem–Dr.J.CduPlessisBethlehem–Drs.StrydomandStrydomBultfontein–Dr.SantjiePieterseClocolan–Dr.LiezelWassermanDewetsdorp–Dr.MarikeBadenhorstFicksburg–Drs.KotzeandCoetzerFrankfort-Drs.Lessing,CilliersandJansevanRensburgGariepDam–Dr.MarniStraussHarrismith–Drs.Prtorius,BesteandNelHertzogville–Dr.NicoHndrikzHoopstad–Dr.KobusPretoriusKroonstad–Drs.Daffue,Eksteen,VanZylandVanderWaltLadybrand/Excelsior-Drs.DeVosandNelMemel–Drs.NixonandNixonParys–Drs.Wessels,WesselsandVanVuurenReitz-Dr.MurraySmithSmithfield–Dr.NienkevanHasseltViljoenskroon-Dr.JohanKahtsVilliers–Drs.HattinghandHauptfleischVrede–Drs.MyburghandBester-CloeteWesselsbron–Dr.JohanJacobsWinburg–Drs.AlbertynandAlbertynZastron–Drs.TroskieandStraussKwaZulu-Natal(17)Bergville-Dr.ArienaShepherdBergville–Dr.JubieMullerCamperdown–Dr.AnthonyvanTonder
Dundee–Drs.MaraisandFynnEshowe–Drs.PrykeandHoffmanEstcourt–Drs.Turner,Tedder,Taylor,Tratschler,VanRooyenandAlwarGreytown–Dr.MikeCaldicottHowick–Drs.Hughes,Lund,Gordon,AllisonandTaylorKokstad-Drs.ClowesandShrivesMooiRiver-Drs.Fowler,Hartley,WatermanandMalletMtubatuba–Dr.TreverViljoenNewcastle–Dr.BarryRaffertyPietermaritzburg–Dr.PhillipKretzmannPietermaritzburg–Dr.RickMaphamPongola–Dr.HeinzKohrsUnderberg-Drs.Collins,KingandDelaneyVryheid–Drs.TheronandTheronEasternCape(14)Alexandria-Drs.OlivierandDreyerAliwalNorth/Zastron–Drs.TroskieandStraussBathurst–Dr.JanePistoriusCradock–Dr.FransErasmusGraaff-Reinet-Dr.RolandLarsonGraaff-Reinet–Hobson,StrydomandHennesyHumansdorp–Drs.VanNiekerkandJanseVanVuurenJeffreysBay–Drs.Hoek,LateganandMcFarlaneKareedouw-Dr.MartenBootsmaMiddelburg/Steynsburg–Drs.VanRooyenandViljoenQueenstown-Drs.DuPreez,Godley,Klopper,JansenvanVuuren,DeKlerkandCatherineStutterheim-Dr.DaveWatermanUitenhage–Drs.MulderandKrügerWitelsbos–Dr.BernadinevandenBergWesternCape(16)BeaufortWest-Drs.PienaarandGroblerCaledon–Drs.Retief,Coetzer,ConradieandWoudstraDarling–Drs.VanderMerwe,AdamandSenekalGeorge-Drs.Strydom,TruterandPettiferHeidelberg–Dr.AlbertvanZylMalmesbury–Dr.OttoKriekMalmesbury–Dr.MarkusFourieMontagu–Dr.TrudiePrinslooOudtshoorn–Dr.GlenCarlisleOudtshoorn–Dr.AdriaanOlivierPiketberg–Dr.AndrévanderMerwePlettenbergBay–Dr.AndréReitzStellenbosch–Dr.AlfredKidd
Swellendam–Drs.MalanandVenter
Vredenburg–Dr.IzakRustWellington–Dr.WilliamvaZylNorthernCape(9)DeAar–Dr.DonaldAndersonCalvinia–Dr.BertusNelKathu–Dr.JanVorsterKimberley–Drs.VanHeerdenandSwartKuruman-Dr.LeaShudaKuruman–Dr.GerhardvanderWesthuizenPhilipstown–Dr.StephanVermeulenPostmasburg–Dr.BoetavdMerweUpington–Drs.VorsterandVisserFeedlots(1)Drs.MorrisandDuPreezLaboratoryreports(6)Dr.MarijkeHenton-Vetdiagnostix,JohannesburgDr.LizaduPlessis–IdexxSAOnderstepoortDr.LucyLange–Pathcare,CapeTownDr.AlanFisher–QueenstownProvinciallaboratoryDr.RickLast–Vetdiagnostix,PietermaritzburgDr.EmilyLane–NationalZoologicalGardens
KeyMessageVisitthewebsiteoftheNationalAnimalHealthForumThewebsiteoftheNationalAnimalHealthForum(NAHF)isnowoperational.www.nahf.co.zaReadwhattheForumisallabout:http://nahf.co.za/about/ThiswebsitewillbetheinformationcentreofanimalhealthinSouthernAfrica.OnthetoolbarclickonStakeholdersandyouwillfindlinkstoproducerorganizationsandotherorganizationswhoareparticipatingintheNAHFhttp://nahf.co.za/stakeholders/ProvincialAnimalHealthForumshavetheirownsite–clickonProvinceshttp://nahf.co.za/provinces/
ImportantistostudytheVeterinaryStrategy(2016-2026)asitgivesdirectiontowherewearegoingwithAnimalHealthinSouthAfrica.http://nahf.co.za/wp-content/uploads/Vet-strategy-final-signed.pdfClickonInfocentreformoreinformationonthe“war”wehaveagainstBovineBrucellosis.Pleasebeuptodateontheroleallhavetoplaytocontrolthiszoonoticdisease.http://nahf.co.za/category/diseases/brucellosis/Informationonothercontrolleddiseases(OvineJohne’sDisease,Pestofsmallstock–PPR,andAfricanHorseSickness)isavailableThislinkwillcontinuouslybeupdated.Informationonantibioticresistanceisalsoavailableatthisaddress:http://nahf.co.za/category/antibiotic-resistance/BetterrelationshipsarebeingbuiltbetweentheStateVeterinarydepartmentsandtheprivatesector.
ForadditionalinformationonBrucellosisinAfrikaansgotothefollowingwebsite:Besoekookwww.landbou.comKlikopIndeksvanantwoordeKlikopBeesteKlikopSiektesKlikopBruselloseKlikopdieverskillendeantwoorde
SummaryofdiseasereportforNovember2016
121Reportsfromveterinarypracticesandlaboratorieswerereceived(Mpumalanga(MP)11;Gauteng(G)6;Limpopo(L)9;NorthWest(NW)9;FreeState(FS)23;KwaZulu-Natal(KZN)17;EasternCape(EC)14;WesternCape(WC)16;NorthernCape(NC)9;Feedlots(FL)1andLaboratories(Lab)6).
Internalparasites
Thefollowingreportswerereceivedfrompracticesregardinginternalparasiteinfestations:
Internalparasites MP G L NW FS KZN EC WC NCRoundworms x x x x x x x x Resistantroundworms x x x x x Wireworm x x x x x x Brownstomach-worm x x x Large-mouthedbowelworm Nodularworm xLungworm
Eyeworm Parafilaria x x x Tapeworms x x x x x xLiverfluke x x x x x Conicalfluke x x x x Cysticercosis(measles) x x x Schistosomiasis(bilharzia) Coccidiosis x x x x x x x xCryptosporidiosis x x x
Parasitesthrivewhengoodrainshavefallen!Internalparasiteoutbreakswithnumerousmortalities,especiallyduetowirewormwerereported.Clinicalsignsofparasitismare:anaemia(palemucousmembranes),bottlejaw,weightlossanddiarrhoea.Visitwww.wormx.infoformoreinformationandvideosontheFAMACHAandFivepointcheckmanagementsystems.ContactyourveterinarianregardingtheFaecalEggCountReductionTest(FECRT)toestablishwhichdewormerscanstillbeusedeffectivelyinyourflocktocontrolworms.
Externalparasites
Thefollowingreportswerereceivedfrompracticesregardingexternalparasiteinfestations:
Externalparasites MP G L NW FS KZN EC WC NCBlueticks x x x x x x x xResistantblueticks x x x Heartwaterticks x x x x x x Brownear-ticks x x x x x x x Bont-leggedticks x x x x x x xRed-leggedticks x x x x x x xParalysisticks x x Tampans xBitinglice x Suckinglice x xItchmites Sheepscab x xMangemites x Nuisanceflies x x x x x Midges x x x x x xMosquitoes x Blowflies x x x x x Screw-worm x x x x Gedoelstia(uitpeuloogsiekte) x Nasalbot x x
Summerrainsmeansanincreaseinticknumbers.TickstransmitdiseasessuchasAfricanandAsiaticredwater,heartwater,anaplasmosisandlumpyskindisease.
Preventlossesbystudyingthelife-cycleofthevarioustickspeciesandvaccinationprogrammestopreventthesediseases.
Thetoxininjectedintoanimalsbybontlegged-tickscausesweatingsicknessandseriouswoundswhichbecomeinfestedwithscrew-worms.Bluetickresistancetodruggroupsisontheincrease–askyourveterinariantoassistyouwithinformationsoastominimizethechancesofselectingblueticksforresistance.Biosecurityisofutmostimportancewhenbuyinginanimals.
Tickbornediseases
Thefollowingtickbornediseaseswerereportedbypracticesintheprovinces:
Tickbornediseases MP G L NW FS KZN EC WC NCAfricanredwater x x x x x x Asiaticredwater x x x x x x x x Anaplasmosis x x x x x x x xHeartwater x x x x x x Lumpyskindisease x x x xCorridordisease Theileriosis x
Thefollowingticktoxicoseswerereportedbypracticesintheprovinces:
Ticktoxicosis MP G L NW FS KZN EC WC NCSweatingsickness x x x x
Insecttransmittablediseases
Thefollowinginsecttransmittablediseaseswerereportedbypracticesintheprovinces:
Insecttransmittablediseases MP G L NW FS KZN EC WC NCLumpyskindisease x x x x Ephemeralfever(Threedaystiffsickness) x x x x x x x Bluetongue x x x x x RiftValleyFever Wesselsbron Nagana
Donotneglectvaccinatinganimals!Goodrainshavefalleninsomeareasandanincreaseininsectswhicharecarriersofdiseaseshavealreadybeenreported.Haveyouvaccinateyouranimalstopreventlosses!?
Venerialdiseases
Thefollowingvenerealdiseaseswerereportedbypracticesintheprovinces:
Venerealdiseases MP G L NW FS KZN EC WC NC
Trichomonosis x x x x x x xVibriosis x x x x Pizzledisease xActinobacillusseminis x
Newcasesoftrichomonosisarereportedeverymonthandthisdiseaseisoutofcontrolandasoneveterinarianreported:“Itisspreadinglikeawildfire”.Makesurethatyoubuybullsfromfarmerswherebiosecuritymeasuresareinplace!
MakesurethatfencesareintactandgatesclosedsothatbullscannotescapetoneighbouringcowsthatmaybeinfectedwithTritrichomonasandbecomeinfectedornnfectedneighbouringbullsarejumpingfenes.
Cattlestudygroupsshoulddiscusspreventativeandcontrolmeasureswiththeirveterinarians.Besuretotestbullsregularlyforthesediseases.
Bewarewhenbuyinginorsharingbulls!Rememberfemaleanimalsmayalsobeinfected.
Bacterialdiseases
Thefollowingbacterialdiseaseswerereportedbypracticesintheprovinces:
Bacterialdiseases MP G L NW FS KZN EC WC NCAnthrax Blackquarter x x x x x x xBotulism x x x x Pulpykidney x x x x x x xLambdysentery x Swelledhead x x x x Redgut(cattle) x x x x x Bloodgut(sheep) x x x x xTetanus x x xSalmonellosis x x x Bovinebrucellosis x x x x x x xOvinebrucellosis((Ram’sdisease) x x xActinobacillusseminis Bovinetuberculosis Johne’s x Leptospirosis x Listeriosis Pseudomonas Fusibacteriumnecrophorum Septicemia E.coli x x x x x x x x xEnzooticabortion x xLumpywool x Uterinegangrene xBovinedermatophilosis(Senkobodisease) x x
Woodentongue Lumpyjaw
Viraldiseases
Thefollowingviraldiseaseswerereportedbypracticesintheprovinces:
Viraldiseases MP G L NW FS KZN EC WC NCBMC(snotsiekte) x x x x x Rabies(cattle) x x BVD x x x IBR x BRSV PI3 Maedivisnavirus Rotavirus/Coronavirus Enzooticbovineleucosis(EBL) x x x Sheepleucosis Jaagsiekte x Orf x x x x x x x xWarts x x x x x x x
Thereisnotreatmentforviraldiseaseswiththeresultthatanimalshavetobeprotectedbyvaccinationsiftheyareavailable.
Thereisnotavaccineavailableagainstsnotsiekte.Thisdeadlyvirusisassociatedwithwildebeestbutrememberthereisalsoasheepassociatedstrain.Wildebeestshedsthevirusespeciallyduringthecalvingseason,whencalvesareweanedandduringthehuntingseasonwhentheyarestressed.Avaccineagainstsnotsiekteisatpresentbeingtested.
Wewillkeepyouupdatedontheprogress.
Discussvaccinationprogrammesandbiosecuritymeasureswithyourveterinarian.
Fungaldiseases
Thefollowingfungaldiseasewasreportedbypracticesintheprovinces:
Fungaldiseases MP G L NW FS KZN EC WC NC
Ringworm x x x x x x x
Protozoaldiseases
Protozoaldiseases MP G L NW FS KZN EC WC NCBesnoitiosis(olifantsvelsiekte)
Toxicities
Thefollowingtoxicitieswerereportedbypracticesintheprovinces:
Toxicities MP G L NW FS KZN EC WC NCCardiacglycoside x x Slangkop Crotularia Gifblaar x Gousiekte Cestrum(inkberry) x x Tulip x x x x Cynanchum(bobbejaantou) x Facialeczema x Lantana x x Prussicacid x x x Senecio x x Cotulanigellifolia(staggerwood) Geeldikkop(duwweltjies) x Vermeersiekte xHertiapallens(nenta,krimpsiekte) x Solanumincanum(maldronksiekte) Gomphocarpus(Asclepias)fruticosus(milkweed)
Brackenfern Januarybush(Gnidiapolycephalatus) Chinkerenchee Kikuyu Ryegrass Ganskweek x Paspalumstaggers Photosensitivity(Turknael,Erodiummoschatum)
Photosensitivity(Stellenbosch) Lusern Mycotoxicosis Diplodiosis x Lupins Harpuisbos Syringaberries Kraalbos Crotolaria Radish Carrotpoisoning
Onionpoisoning Brackenfern Pollenbeetle(Astylusatromaculatus) Watercontamination x xNitrate x Urea x x x Snakebite x x x Mothcocoons(impaction) Bluegreenalgae Copper Selenium Zinc Fluoride Lead Paraquat Phosamine Organophosphate Zincphosphide Pyrethroid Amitraz Levamisole Tilmicosin Ionophor Hypo
Toxicplantsareusuallygreenerthanthenaturalgrazingandfarmersshouldbeawareoftheseplantsandwhichclinicalsignsareseenwhentheyareeaten.Tulptoxicitieswerethemajorcausesofdeaths.
Bewarewhenbuyinginanimalsastheyaretheanimalswhichusuallyeattoxicplantssuchastulp.
Forfurtherinformationontreatmentoftulpandotherpoisoningsvisit:
www.landbou.com
KlikopIndeksvanantwoorde
KlikopBeesteofSkape
KlikopVergiftigings
KlikopdieOpskrifte
Ureapoisoningwasontheincreasewhichisduetoamanagementproblem.
Beforetreatinganimalsreadthelableorpacketinsertandmakesureofthedosagerateandwarnings.
Chemicalsubstancesarerecordedeverymonthasbeingthecauseofhugelosses.Topofthelistisureapoisoning.InOctoberover90cowsdiedasaresultofzincphosphidepoisoning!
Nutritionaldeficiencies
Thefollowingnutritionaldeficiencieswerereportedbypracticesintheprovinces:Deficiencies MP G L NW FS KZN EC WC NC
Energy x x x x x x xProtein x x x x x x xPhosphate x x xCalcium x x x x
Duetotheseveredroughtconditionsanimalssufferonmanyfarmsfromnutritinaldeficiences.Theresultsarepoorconceptionrates,retainedafterbirths,poorqualityofcolostrumandadecreaseintheimmunestatusofanimals.
Micro-nutritionaldeficiencies
Thefollowingmicro-nutritionaldeficiencieswerereportedbypracticesintheprovinces:Deficiencies MP G L NW FS KZN EC WC NC
Iodine Copper x x x x xZinc x x Selenium x x x x Magnesium x Manganese VitaminA x x x x x xVitaminB1 x x
Thereareantagonistssuchascalcium,ironandsulphurwhichhampertheuptakeofmicro-minerals.Havewaterandsoilsamplesanalysedtoseewhatthelevelsoftheseantagonistsare.Arrangewithyourveterinariantohaveliversamplesanalysedtodeterminethestatusofthesemicro-mineralsinyourherdorflock.
Withthedroughtandlackofpropergrazing,mineraldeficiencieswillincrease.
Bewareoffluoridepoisoningasboreholewaterlevelsfall.
SupplementanimalswithvitaminAduringdroughtconditions.
Multifactorialdiseasesandotherconditions
Thefollowingconditionswerereportedbypracticesintheprovinces
Multifactorialdiseasesandotherconditions MP G L NW FS KZN EC WC NCAbortions x x x x x x x x xStillbirths x x x x
Abscesses x x x x x x x x xIntestinalulcers Bladderstones-urolithiasis x x Blindness x x x xBloat x x x x x Bloodgut(sheep) Blueudder x x x x Diarrhoea x x x x x x x xEpididymitis xEyecancer x x x xEyeinfections x x x x x x x x xJointill x x x x x xLameness/footproblems x x x x x x x xLunginfection x x x x x x x x xMastitis x x x x x x x Navelill x x x x Redgut(sheep,torsionofgut) Rectalprolaps Trauma x Plasticbags(ingestion) Downer x x x x x
Discusstheorigin,treatmentandpreventionofthesediseaseswithyourveterinarian
Diarrhoea
Numerousreportswerereceived,especiallyfromtheFreeState,oflambsandcalvesdyingandnumerousanimalswithclinicalsignsofdiarrhoea.Samplesweresentawayfordiagnosisandrapidtestswereusedonthefarm.ItseemsthatCryptosporidiumspp.,E.coli,rotavirus,coronavirus,clostridialspp(especiallyClostridiumperfringenstypeA)andSalmonellaserotypesplayedaroleinthediseasecomplex.WhilenotmuchisknownaboutCryptosporidium,thefollowingisgiven:
Cryptosporidiosis is caused by a protozoal parasite of the genus Cryptosporidium and is usually an inapparent infection (no clinical signs seen) in a wide range of animals, fish, reptiles and humans. Clinical cases may occur as a result of lesions in the gastro-intestinal tract caused by the organism. Clinical sign seen is a diarrhoea, especially in neonatal animals and in animals where the immune system is supressed. The infection is also a zoonosis which means that humans may become infected when in contact with infected animals.
Cryptosporidium spp. is smaller in size compared to Coccidia and complete their life-cycle in the epithelial cells of the gastro-intestinal tract. In young animals the life-cycle is completed in 3 to 4 days which is a shorter period compared to coccidia.
The OIE (World organization for animal health) has the following information on the web regarding cryptosporidiosis: http://fliphtml5.com/pfug/ebtp
Contact your veterinarian for advice.
Kriptosporidiose word veroorsaak deur ‘n protosoa van die genus Cryptosporidium en is gewoonlik ‘n onopsigtelike infeksie in ‘n groot verskeidenheid van diere, visse, reptiele en mense. Daar mag ook
kliniese gevalle voorkom deurdat letsels, veroorsaak deur die organisme, in die dermkanaal kan voorkom met gevolglike diarree. Hierdie besmetting kom veral voor in pasgebore diere en waar diere se immuunstelsel onderdruk is. Die besmetting is ook ‘n soönose wat beteken dat die besmetting van diere na mense oorgedra kan word.
Cryptosporidium spp. is kleiner as koksidia en voltooi hulle lewensiklus in die dermkanaal se epiteelselle. In jong diere word die lewensiklus in 3 tot 4 dae voltooi en is korter as die van koksidia.
http://landbou.com/kundiges/vra-vir-faffa/koksidiose-in-bokke-skape-en-beeste/
Epidemiologie
In diere kom die infeksie die algemeenste in kalwers voor, maar word ook gevind in varke, lammers, bokkies en immuunonderdrukte vulletjies. Uitbreke van kliniese siekte kom meestal voor gedurende die een tot 4 weke ouderdom. Kalwers met diarree skei so veel as 10 miljoen oösiste (lyk soos baie klein eiertjies) per gram mis uit, wat die omgewing besmet. Hierdie oösiste word ook in die mis van diere wat subklinies (diere wys nie siektetekens nie) besmet is, gevind.
Oösiste is baie weerstandig teen omgewingsfaktore, maar die oorlewingsperiode van die oösiste buite die gasheer is onbekend. Gechloriniseerde water het weinig effek op die organisme en kriptosporidiose is dan ook ‘n groot publieke gesondheidsprobleem deurdat die parasiete wateroordraagbaar is. Onder eksperimentele toestande is die besmetlikheid verloor nadat water gestoor is vir 6 maande by 4 grade Celcius.
Oordraging
Oordraging geskied deur die inname van oösiste in besmette kos of water terwyl aërosoloordraging ook kan plaasvind. Lg. is bevestig deurdat lugweginfeksies ook gevind is.
Diere wat genoegsame gamma globulien bevattende kolostrum ingeneem het, behoort minder vatbaar vir infeksie te wees.
Herstel van diere met kriptosporidiose vind gewoonlik binne 30 dae plaas.
Daar is gevalle gerapporteer waar Cryptosporidium die enigste oorsaak was waar diere ‘n diarree gehad het, maar gewoonlik kom die parasiet saam met ander dermpatogene soos rotavrus, coronavirus, Salmonella serovars en E. coli voor. Hierdie gesamentlike infeksies verhoog die mortaliteitsyfer.
Erge stresfaktore soos bv. koue mag die vrektesyfer verhoog. Waar die immuniteit van diere onderdruk word, is die kliniese tekens, wat deur Cryptosporidium veroorsaak word, ook hoër. Erge infeksies is gerapporteer in Arabierperdvullens wat gely het aan die immuniteittekortsindroom binne die eerste maand na geboorte.
Mense kan die siekte opdoen deur kontak te maak met besmette mense en diere en is ‘n algemene oorsaak van diarree wanneer gereis word. Dit is nog nie duidelik of besmette mense diere kan aansteek nie.
Siekteverloop
Cryptosporidium spesies het ‘n aansienlike uitwerking op die membraangebonde verteringsensiemes wat veroorsaak dat daar swak vertering van voedsel plaasvind. Swak opname van voedingstowwe vind plaas omdat die villi van die derm se grootte afneem.
Behalwe in baie jong diere is die infeksie gewoonlik onopsigtelik of mild. Die inkubasieperiode na aanvanklike besmetting varieer gewoonlik twee tot sewe dae.
Diarree kom voor tussen een en 4 weke oudedom en duur gewoonlik een tot 4 weke lank. Aantastingsyfer is gewoonlik hoog, maar vrektesyfer laag. Die aanvang van kliniese siekte is gewoonlik skielik en tekens is min of meer dieselfde in al die spesies. Diere is depressief en wil nie vreet nie waarna daar ’n erge geel waterige diarree voorkom met ontwatering van die dier. Parsing mag voorkom. Na ‘n paar dae wat die siekte verloop het, kom diarree met tussenposes voor. Die konsistens van die mis is nog papperig vir tot 10 dae. Gewigsverlies is opmerklik. Terugslag mag ook na aanvanklike herstel voorkom. Varke mag opgooi. Meeste diere herstel spontaan behalwe waar komplikasies met ander besmettings soos reeds hierbo genoem gesamentlik voorkom. Erge kroniese besmetting kan in immuunonderdrukte diere voorkom.
Diagnose en onderskeiding van ander siektes (differensiële diagnose)
Diagnose word gemaak wanneer daar baie oösiste in die mis van jong diere met kliniese tekens gevind word. Smere van die mis word gemaak, gefikseer in metanol en gekleur met die gemodifiseerde Ziehl-Neelsen of safranienmetode. Monsters word van die dermkanaal geneem en na ‘n laboratorium gestuur vir histologiese ondersoek. Dit is belangrik dat daar ook vir ander siekteveroorsakende oorsake gesoek word (E. coli, rotavirus, coronavirus, salmonellose en koksidiose) wat saam met Cryptosporidium kan voorkom.
http://landbou.com/kundiges/vra-vir-faffa/e-coli-in-diere/
Voorkoming en Beheer
In meeste gevalle is die siekte selfbeperkend. Dit is belangrik om die besmetting simptomaties te behandel veral vir dehidrasie en elektrolietvervanging waar erge diarree voorkom. Probleme geskied veral waar infeksies soos bv. E. coli en Salmonella Tipes gelyktydig met Cryptosporidium voorkom.
Daar is ’n publikasie waar decoquinate (Deccox 6%, Zoetis, G3282) vir die vermindering van oösiste in die mis van kalwers en lammers in die voer gebruik is teen ‘n dosis van 2,5 mg/kg vir 3 weke.
Voorkom en verminder die inname van oösiste deur jong diere in ‘n skoon droë omgewing groot te maak. Mis moet gereeld verwyder word en diere met ‘n diarree moet geїsoleer word.
Oösiste is weerstandig teen baie ontsmettingsmiddels maar kan vernietig word deur blootstelling aan 5% ammoniakoplossing of 10% formalien.
Geen geregistreerde entstof is tans beskikbaar nie.
Vir foto’s van Cryptosporidium in herkouers besoek:
https://www.google.co.za/search?hl=af&biw=1036&bih=527&site=imghp&tbm=isch&sa=1&q=Cryptosporidium+in+ruminants&oq=Cryptosporidium+in+ruminants&gs_l=img.12...11531.18018.0.19754.0.0.0.0.0.0.0.0..0.0....0...1c.1.64.img..0.0.0.TPJS5bmIY7w
Lees ook:
https://en.wikipedia.org/wiki/Cryptosporidium
Bronne:
J.A.W. Coetzer and R.C. Tustin. 2004. Infectious Diseases of Livestock. Oxford Universitiy Press. ISBN 0 19 576171 5
Bremner, B and Richard, A. Practical uses of decoquinate to control cryptosporidiosis infection in sucked calves by medicating the cow diets pre and post calving in Scotland. Proceedings XXVI World Biuarics Congress Chile: p 312
Geskryf deur: dr. Faffa Malan, Veeartskonsultant ([email protected])
ForAfrikaansspeakinglisteners,thefollowingpodcastisavailableonOFMradio:
http://www.ofm.co.za/article/podcasts/212972/protozoa-vermoedelik-agter-vrektes-van-duisende-lammers-en-kalfies
Metabolicdiseases
Thefollowingdiseaseswerereportedbypracticesintheprovinces:
Metabolicdiseases MP G L NW FS KZN EC WC NCAcidosis x x x Displacedabomasums x x x
Ketosis(Domsiekte) x xMilkfever x x x
Makesurethatyouadaptanimalstofeedcontainingconcentrates.
Discusstheetiology,treatmentandpreventionofthesediseaseswithyourveterinarian.
Reproductivediseases
Reproductivediseases MP G L NW FS KZN EC WC NCDystocia(difficultbirths) x x x x x x x x xEndometritis x Metritis x x x x x x Poorconception x x x x x x x xRetainedafterbirth x x x x x x x xSheathprolaps x x Uterineprolaps x x x x x xVaginalprolaps x x x x xPenisinjury
Thepresentandpastdroughtconditionsplayahugeroleinfertility.Fertilityofanimalsisoneofthemostimportantfactorsdeterminingthesuccessoffarming.Discussallissueswithyourveterinarian.
Environmentalconditions
MP G L NW FS KZN EC WC NCExposuretocold Frozentodeath Heatstress xLightning x x x x x x Drought x x x x
Otherconditions
MP G L NW FS KZN EC WC NCDrugresidues(milk,meat,liver,kidneyetc) Preditors x x x xTheft x x Traumaticpericarditis(wireinforestomachs)
Trauma(fracturesetc) x x
IntheCODEOFCONDUCToftheRPOthefollowingstandardoperatingproceduresaredocumented.Thelocalveterinarianshouldbeyourpartnertohelpyouachievethenecessarystandards.http://www.rpo.co.za/BestPractices/English.aspx
PRECAUTIONARYMEASURESTOSUPPORTBIO-SECURITY.Precautionarymeasuresarerequiredtoprotecttheherdagainstdiseasesacquiredbecauseofexternalcontact.Thefollowingcategoriesareofconcern:1.DIRECTLIVESTOCKPURCHASES(andownanimalsreturning):Thefollowingshouldbeverifiedbeforeimportingnewanimalsintotheherd:Howlonganimalshaveresidedatthepurchaseorpreviouslocation?Havetherebeenanyrecentdiseaseoutbreaksinthelocation?Dobrandmarksclearlyconfirmownership?Wasavaccinationprogramfollowed(needpaperorveterinarianproof).Whatarethelocalprevalentexternalparasitesandtheroutinelyimplementedcontrolprogram?Isaveterinariansupportedcontrolprogramagainsttransmittablediseasesfollowed?DatesandsufficientnumberoftestsforreproductivediseasesofbothmaleandfemaleDatesandtestsforzoonoticdiseasesTheaboveshouldalsobeverifiedwiththepurchaser’sownveterinarian.2.PURCHASESFROMSALESORSPECULATORSPurchaseonlyinareaswhicharenotincloseproximitytoscheduledareasVisuallyinspecttheanimalsbeforepurchasingfor:*brandmarks*parasiteinfestation3.TRANSPORTTOTHEFARMUseonlyreputabletransportersHasthetruckbeencleanedanddisinfected?
TrucktofollowtheshortestuninterruptedrouteTrucktotaketheshortestroutetothehandlingfacilitiesDonotallowthetruckpersonneltogetincontactwiththefarmherd4.ARRIVALONTHEFARMOff-loadthelivestocktolimitstressandtobevisuallyevaluatedforanyunnaturalconditions.Isolatethemfromthefarmherdandsharedfacilitiesforatleast21days(quarantine)Retestfordiseasesofconcernifneeded,beforemixingwiththerestoftheherdProcessnewarrivalswithin24hrsafterarrival(uniqueIDtagbrand,dip,dose,vaccinate)Inspectregularly5.FEEDPURCHASESEnsurebalesofhayaresourcedfromareasthatarenotborderingscheduledareasPurchasefeedfromreputabledealersonlyAvoidbuyingfeedinsecondhandbagsEnsurefeedtrucksarealsodisinfectedandcleaned,especiallyifalsousedtotransportanimalstoabattoirs6.VISITORSDonotallowstrangersortheirvehiclesamongstthelivestockEnsurefencesarewellmaintainedandpreferablyjackalandwarthogproof7.EMPLOYEESDonotallowtheemployeestoeatinfeedstoresSupplyemployeeswithsufficientablutionfacilitiesRegularlyarrangetoletemployeesbemedicatedfortapewormandhavehealthcheck-upsKeeprecordofallemployeelivestockonthepropertyTreatemployeelivestockwithseparatebutdedicatedhealthprogramsEnsureemployeesunderstandthereasonbehindtheimplementedbio-securitymeasurestohelpensurecompliance.GENERALANDREPRODUCTIONMANAGEMENTRecordkeeping:Allanimalsareindividuallyidentifiedandrecorded.Toproveownership:AllanimalsaremarkedwiththeregisteredbrandmarkaccordingtotheAnimalIdentificationAct,No6of2002.Adefinedbreedingseasonisthebasisofeffectivemanagement:Thebreedingseasoncoincideswiththerainyseason,i.e.theperiodwhennutritivevalueofthepastureisatitsbest.Sufficientenergyreservesintheherdasmeasuredbyconditionscoringarevital,especiallyforeffectivebreeding,andwheninadequatetheherdissupplementedinconsultationwithanutritionist:Conditionscoringofbullsandcowsareregularlydone,particularlyattheonsetofthebreedingseasonandsupplementedifnecessary.Bull-cowratiosaremaintained:Aratioof1to25ismaintainedineveryseparateherd.Fertilityofbreedingbulls:Allbreedingbullsaretestedformatingabilityandsemenqualitybeforethebreedingseason.Sexuallytransferablediseases:Sheathwashesorscrapesonbullsareperformedannually.Diseasesthatcancausepoorconception,abortionorweakcalves:Cowsarevaccinatedagainstsuchdiseasesinconsultationwiththeveterinarian.Breedingsuccessmonitoredbyaveterinarian:Rectalpregnancyorscandiagnosisisdonebytheveterinarian8weeksafterthebreedingseason.
Twentypercentofcowsormorenotpregnant:Furthertestsaredonetodeterminecauseoflowpregnancyrate.Cullingofnon-pregnantcows:Non-pregnantcowsareremovedfromtheherdandconsideredanecessarybonustosupportingherdincome.HERDHEALTHANDBIO-SECURITYMaintenanceofherdhealthiskeytoasuccessfulenterprise:Aveterinarianshouldvisitthefarmbi-annuallyatleast.Calfmortalitybefore3monthsofageisanimportantreasonforpoorweaningpercentage:Goodmanagementpracticesareappliedtolimitearlycalfdeaths.Somediseasesandparasites(internalandexternal)aremoreoftenencounteredinspecificareas:Annualvaccinationsandaparasitecontrolprogramshouldbeappliedaccordingtoregionalrequirementsandinliaisonwiththeveterinarian.Farmerssellingweanedcalvestofeedlotsmaywanttohaveamarketadvantagecomparedtoothers:Aspecificvaccinationprogramisappliedbeforeweaningforthatpurpose.HerdsmaybeatriskofbeingexposedtoCAandTB:TheherdistestedannuallyforCAandallheifersarevaccinatedagainstCAbetween4and8monthsofagewithanefficient,approvedremedy.Theherdistestedatleastevery5yearsforTBPrecautionarymeasuresarerequiredtopreventdiseasesbeingimportedintotheherd:Aquarantineprogramtokeepincominganimalsseparateisfollowed.Allincominganimalshaveasuitablecertificateofnegativetestresultsorareofacertifiedclean,closedherd.Stockremediesandmedicinesshouldberegistered,correctlystoredandusedbeforethetranspiredate:Allmedicinesandstockremediesareregistered,storedandappliedaccordingtoprescription.Prescribedmedicineswithaspecificapplicationareunderthecontroloftheveterinaryprofession:Allprescriptionmedicinesareobtainedandappliedunderprescriptionfromaveterinarian.
Practices that had nothing to report Bela-Bela – Dr. Nele Sabbe Greytown – Dr. Mike Caldicott Lephalale – Dr. Brigitte Luck Nigel – Dr. Cindy van der Wethuizen Pietermaritzburg – Dr. Rick Mapham Vanberbijlpark – Dr. Kobus Kok Ostriches WesternCapeOudtshoorn–Ostrimed
Condition CommentsMidgesandnuisanceflies Hot weather with flood irrigation allocation
has seen an explosion, dry hot weather forces insects to search for moisture?
Clostridiumspecies Heat wave days result in lowered food intake, moderate weather following result in increase/over intake of highly fermentable
and digestable nutrients. Overgrowth of Clostridium = rooiderm= enterotoxaemia
Diarrhoea Extreme heat days or over heating followed by ooler days result in a trigger for diarrhoea. Severe tiflocolitis – normal entero flora overgrowth notably by Clostridium group. Peracute to acute condition. If preliminary antibiotics (oxytetracyclines or macrolides) are not effective, mortalitiy rate of 80% is to be expected. 2nd and 3rd generation antibiotics or quinolones have little to no effect.
Cold/Heatexposure Hot weather followed by poor very cold day or evenings. Notably older chicks which are not fully protected suffer most. Show poor intake, negative metabolic rate and long tail of mortalities
Equines MpumalangaMiddelburgRetainedplacenta–1LimpopoBela-BelaLameness-tickassociatedFreeStateBethlehemColic–2Tetanus–1HertzogvilleBiliary–1Diarrhoea–utbreakinhorsestud,3foalsdied.EasternCapeWitelsbosEqineherpesvirus1and4-1NorthernCapePostmasburgTetanus-1Alpaca
PlettenbergBayDystocia-1 Game GautengMagaliesburgOpthalmia–3AllhoovedgamePretoriaBlueticks–3Bontticks–2Brownearticks–2Abortions-2Gousiekte–1NyalalambmovedfromDinokengtoBela-Bela.SuspectalsoNentapoisoning(krimpsiekte)intihsareaaswellastulip.Ithisareathereareverythinpoorlookingimpalaofwhichoccureverynowandthen.Dystocias-2Anyalaewe,diedafewdaysaftercalving(verythin,uteruspussy).Shewalkedafewdayswithanarchedbackandstraining.Lambdiedandafterbirthwascontained,wasremoved.Ewetreatedwithantibioticsandforpainandsherecovered.Lungs–1Opthalmia–3Abscesses-2Limpopo Bela-BelaAbscesses-ElandOpthalmia–NyalaMakhadoClostridialenterotoxaemia–2SableCoccidiosis-2MokopaneBlueticks–1Bontticks–2Browneartick-1Screw-worm-2Abscesses-1ModimolleVerminosisingameontheincreasePolokwaneProteindeficiency–3Energydeficiency–3Abscesses–1Retainedafterbirth–G2VaalwaterBMC(snotsiekte)–2BuffaloLightning–1RhinobullNorthWestKlerksdorp
Blueticks–1Bont-leggedticks-2Red-leggedticks–2Dystocia-3Opthalmia-1MagaliesburgEyeinfections(opthalmia)–LotsofMoraxellainfectionsinwildlifeKwaZulu-Natal PongolaMidges–3GoodrainsinOctoberProteindeficiency–1Energydeficiency–1Free State HertzogvilleWireworm–2SableOpthalmia–2SableEasternCapeUitenhageBMC(snotsiekte)–BuffaloWitelsbosInternalparasites–1ImpalaandwildebeestPneumonia–1BuffaloWesternCapeMontaguLiver–1Blackspringbuck–necrobacillosisofthelivermacroscopicallesiomsandonhistology,heartfailureDrought–Eland3,morethan10diedPredation–BonteboklambLameness-Springbok(suspectticks)NorthernCapeKimberleyBotulism–Gemsbok–2mortalitiessuspectedbotulismVeminosis–Sable–3severeanaemiaandhypoproteinaemia,suspectedwirewormEyeproblems–1keratokonjunctivitisSable–paraphimosisSwine NorthWestLichtenburgE.coli-2
MonthlyreportonLivestockandWildlifeisolationsforNovember2016fromVetdiagnostix–MicrobiologyLaboratory,suppliedbydr.MarijkeHenton([email protected])
AcombinationofCryptosporidiumandE.coli,causingenteritisinyoungruminants,wasoneofthemostcommonconditionsthismonth[bovine3,sheep3].ThesharpincreaseincasesofCryptosporidiumismostlikelyalliedtothedroughtandthedeterioratingqualityofwater.E.coliwasalsoassociatedwithenteritisalone[bovine2,sheep3,goat1]andsepticaemia[bovine5,sheep1andgoat1].OneofthebovineisolateswasESBLpositive[ExtendedSpectrumBetaLactamase]whichmeansthatitisresistanttoallpenicillinsandcephalosporins.E.colienteritiswasalsocommoninpigs[7],andoneofthoseisolateswasalsoESBLpositive.
SepticaemiainacalfwasduetoSalmonellaDublin,andinpigsSalmonellaTyphimuriumandStreptococcussuis,inadditiontotwoE.colicases.Streptococcusporcinuscausedajointinfectioninapig.
TherewasonlyonecaseofabovinerespiratorytractinfectionwhichwasduetoMannheimiahaemolytica.Trueperellapyogenescausedajointinfectioninabovine,anabscessinanother,andoralcavityinfectionsinaflockofsheep.Corynebacteriumpseudotuberculosiscausedabscessationingoats.
NecroticmyositiswasduetoacombinationofClostridiumchauvoeiandC.sordelliiincattleandC.novyiinsheepandasable.
Klebsiellapneumoniaewasassociatedwithrespiratorytractinfectionsin3horsesandapostoperativewoundwheretheisolatewasESBLpositive.Itwasalsothecauseofarespiratorytractinfectioninapetpig.
Streptococcusequisubspeciesequi[strangles]wasisolatedfromtherespiratorytractofahorseinGauteng.Stranglesisnownotifiable,butnotcontrolled.
AfoalhadSleepyFoalDisease[Actinobacillusequuli].
EquinepurulentinfectionswerecausedbyStaphylococcusaureusin3cases,andStaphylococcusepidermidis[amethicillinresistantstrain]inaninfectedtendonsheath.
SkinnodulesoverthehockjointwerecausedbySporothrixschenkii.
AbuffalowithpersistentconjunctivitisyieldedMycoplasma..
MonthlyreportonLivestockandWildlifeisolationsforNovember2016fromIDEXXLaboratoriessuppliedbydr.LizaduPlessis([email protected])
Condition CommentsandSpecieIntestinalroundworms G1Tapeworms G1Cysticercosis B1Heartwatertick B,G2
Browneartick G1Heartwater G1Theileriosis G1Swelledhead G1Pulpykidney O1Enzooticabortion B1Proteindeficiency G1ZincToxicity G1Seleniumdeficiency G1Abortion B2,G1Lungs B,G2Tuliptoxicity O1Inkberrytoxicity/Seneciosis B2Cardiotoxicity B1Hepatotoxicity B1
FeedlotreportreceivedfromDr.ShaunMorrisandDr.EbenduPreezforNovember([email protected])
SheepFeedlots:
Ingeneralthehealthinthefeedlotsisgoodatthisstage.Severalcasesofthefollowingconditionsoccurred:
Pneumonia
Coccidiosis
Blowflyattacks
Nasalbot
Pulpykidney
Bloodgut
Orf
Urolithiasis
Rectalprolapse
EnergyandProteindeficiency
VitaminAdeficiencyassociatedwitheyeinfections
E.colidiarrhea
Resistantroundworminfection–58outofagroupof200sheepfromtheSouthEasternFreeStatehadsevereHaemonchuswormburdenswithafewmortalitiesinspiteofdosingwithaBenzimidazoleandMacrocycliclactone.
CattleFeedlots:
AnimalsarrivingfromtheWesternpartofthecountrywheregrazingisstilldeficient,arriveinpoorconditionandlossesduringtransporthaveoccurred.Theseanimalsmostlyalsosufferfrommicroelementdeficienciesandtheyhaveapoorlydevelopedimmunesystemwhichleadstohighermorbidityandmortalities.Inarecenttrialitwasfoundthatcowssufferingfromstressduringtheearlystageofpregnancyproducecalvesthatalsohaveacompromisedimmunesystemwhichhasapermanenteffectontheseanimals.Thedroughtandheatstressthatwasexperiencedearlierthisyearandbeforemighthaveapermanenteffectonthecalvesthatwerebornthisyear.Thatmightalsohavecontributedtothehighermorbiditiesandmortalitieswehaveexperiencedthisyear.
Otherconditionsthatoccurred:
AcuteInterstitialPneumoniassociatedwiththedustyconditionsandheatstress.
Ticksaremoreabundantandbrown-eartickshavecausedseveralsevereinfections.
Severalcasesofredwater,heartwater,andanaplasmosis.
Fewcasesoflumpyskindisease,blackquarter,warts,ringworm,eyeInfections,footrotandinjuries.
Lossesduetodystociaandabortions.
Acidosisassociatedwithredgut,vitaminB1deficiencyandbloat.
AttheabattoirscasesofParafilaria,andlLiverflukewereseen.Lunglesionswerecommonandwasexpectedasthedustyconditionsinthefeedlotsduringthewinterarealwaysacontributingfactor.
MonthlyreportforNovember2016fromDrRDLast(BVSc;M.Med.Vet(Path);MRCVS)
SpecialistVeterinaryPathologist,Vetdiagnostix-VeterinaryPathologyServices
ContributorsMrButchBosch,MsNtandoMagoso,MrsBeverleyWilliams,MsNicoleGenga,DrRickLast
LIVESTOCKDISEASESURVEILANCE
LIVESTOCKSPECIES DISEASEAGENTNO.CASES LOCATION
Bovine,Calf CryptosporidiosisandE.coli 1 Howick,KZN
Bovine,YearlingBull Kikuyupoisoning 1 Vryheid,KZN
Ovine,AdultEwe Gousiekte 1 Newcastle,KZNGoat,AbortedFetus Coxiellaburnetti(Qfever) 1 Harare,ZimbabweOvine,AdultEwe Copperpoisoning 1 Kokstad,KZNEquine,AdultMare Nasalrhinosporidiosis 1 Wemmershoek,WesternCape
Equine,Foal Actinobacillusequilli-sleepyfoaldisease 1 Thabazimbi,LimpopoOvine,Lambs Cryptosporidiosis 1 Heilbron,FreeStateOvine,Lambs Cryptosporidiosis 1 Bethlehem,FreeStateBovine,Calves Cryptosporidiosis 1 Greytown,KZNBovine,Calves Calfparatyphoid 1 Estcourt,KZNBovine,Calves Cryptosporidiosis 1 Potchefstroom,NorthWest
Equine,AdultMare Cutaneoushabronemiasis 1 Midrand,GautengOvine,Abortedfetus Chlamydiapecorumabortion 1 Brits,Gauteng
MonthlyreportforNovember2016fromQueenstownProvincialVeterinaryLaboratoryassuppliedbyDr.A.D.Fisher([email protected])
Condition Area CommentsandSpecieIntestinalroundworms B,O3Bloodgut O1Brucellosis B2–Maclear(8outof169)
Lusikisiki(1outof50)Coccidiosis O3BMC(snotsiekte) B1(sheepassociated)CofimvabaBVD B1CofimvabaRabies
CofimvabaDutywaElliotNyandeniTsoloTsomo
Canine4,B4,O3casesB3casesCanine1O3casesCanine1caseCanine1case
Prussicaid O1Carbamatepoisoning Baitedmeat
LIVESTOCKDISEASESURVEILANCEWILDLIFESPECIES DISEASEAGENT NO.CASES LOCATION
Sable,Cow Mycoticrumenitisandred-gut 1 Thabazimbi,Limpopo
Sable,HeiferImmunemediatedskindiseasewith
folliculararrest 1 Naboomspruit,LimpopoSable,Cow Transporttetany 1 Thabazimbi,LimpopoSable,Calf Theileriosis 1 Ellisras,Limpopo
B–bovine;O–ovine;C–caprine;P–pigs;G–game
1=onecase;2=2to9cases;3=morethan10cases
MonthlyreportforNovember2016fromDr.LucyLange:PathCareVetlab([email protected])Disease condition Specie Pneumonia/Pasteurella CattleCampylobacter CattleTritrichomonas CattleBMC-Snotsiekte CattleMalnutrition Cattle Intra-uterinebabesiosis HorsesNecroticplacentitis HorsesSarcoid HorsesSquamouscellcarcinomaofsheath
Horses
Malnutrition SheepMeningitis(innerearinfection)
Sheep
FSE SheepSepticemia SheepPasteurellamastitis SheepJohne’s SheepPulpykidney Sheep Bacterialpneumonia BoergoatsMalnutrition BoergoatsEnterotoxaemia Boergoats Game: Necrobacillosis SpringbokLymphoarcoma VervetmonkeyBronchiolarcarcinoma BontebokMusclenecrosis,capturemyopathy
Bontebok
Ulcerativegastritis(BVD) Buffalo
Fewer production animals and game samples received during November
ReportfromDr.EmilyLaneWildlifePathologyResearchProgramme
DISEASE DISTRIBUTION REPORT AS REPORTED BY VETERINARIANS
Table of Contents
Internal Parasites
Roundworms in general, Resistant Round Worms, Wireworm, Brown stomach-worm, Nodular worm, Tape Worms, Parafilaria, Liver fluke, Conical Flukes, Cysticercosis, Other
External Parasites
Blue ticks, Resistant blue Ticks, Heartwater (Bont) ticks, Brown ear-ticks, Bont-legged ticks, Red-legged ticks , Paralysis ticks, Biting lice (red lice), Sucking lice (blue lice), Scab mites, Mange Mites, Nuisance Flies, Blowflies, Screw-worm , Nasal bot larvae , Midges, Mosquitoes, Tampans , Other
Tick-borne Diseases
African red water, Asiatic red water, Anaplasmosis, Heartwater, Sweating Sickness
Insect Transmittable Diseases Lumpy skin disease, Three-day-stiffsickness, Blue tongue
Venereal Diseases Actinobacillus seminis, Trichomonosis, Vibriosis, Pizzle disease
Bacterial Disease (other)
Blackquarter, Botulism, Pulpy Kidney, Lamb dysentry, Swelled head disease, Redgut (cattle), Blood gut (Sheep), Tetanus, Salmonellosis , Brucella abortus, Brucella ovis, Johne`s disease, Leptospirosis, E.coli, Enzootic Abortion, Dermatophilosis (Lumpy Wool), Intrauterine Gangrene, Bovine Dermatophilosis (Senkobo disease), Other
Protozoal diseases (other) Coccidiosis, Cryptosporidium
Fungal diseases Ringworm
Viral Diseases (other)
BMC, Rabies, BVD (Bovine viral diarrhoea), IBR (Infectious bovine rhinotracheitis), Enzootic Bovine Leucosis (EBL), Jaagsiekte, Orf, Warts
Poisonings (Plant) and Fungal
Cardiac glycoside poisoning, Cestrum, Cynanchum poisoning, Facial eczema, Geeldikkop/Dikoor, Gifblaar, Lantana, Nenta poisoning (Krimpsiekte), Nitrate poisoning, Prussic acid poisoning, Seneciosis, Tulip Poisoning, Vermeersiekte (Gaigeria spp.), Diplodiosis, Other
Poisonings Water contamination, Urea Poisoning, Snake Bite, Other
Macro Nutritional Problems
Energy deficiency, Protein deficiency, Phosphate deficiency, Calcium deficiency
Micro Nutritional Problems
Copper deficiency, Zinc deficiency, Selenium deficiency, Magnesium deficiency, Vitamin A deficiency, Vitamin B deficiency
Multi-factorial Disease Conditions
Abortions, Stillbirths, Abscesses, Abscesses in general, Bladder stones, Blindness, Bloat, Blue udder, Diarrhoea, Epididymitis , Eye Cancer, Eye infections, Joint Ill, Lameness/Foot Problems, Lung infection, Mastitis in general, Navel Ill, Trauma, Downer, Other
Metabolic Diseases Acidosis, Displaced abomasum, Ketosis, Milk Fever
Reproductive diseases
Dystocia (Difficult Births), Endometritis, Metritis, Poor conception, Retained afterbirth, Sheath Prolaps, Uterus prolaps, Vaginal (Cervical) prolaps
Climatical Cause Drought, Heat stress, Lightning
Non specific diseases Preditors, Sabotation - Theft, Trauma
Internal Parasites
Roundworms in general ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.6 (7) 2.0 (2) 2.0 (3) 1.0 (3)
2.2 (6) 2.1 (17) 2.5 (4) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 1.0 (1)
2.0 (1) 1.8 (6)
Sheep 1.8 (4) 2.0 (2) 2.0 (2) 1.0 (2)
2.2 (5) 2.3 (8) 2.3 (3) 3.0 (1)
Goat 1.5 (2) 2.0 (1) 2.3 (3) 3.0 (1) Mpumalanga Balfour, Balfour Dierekliniek Beef: 1, Sheep: 1, Goat: 1 Middelburg , Middelburg Dierehospitaal Sheep: 2, Goat: 2 Standerton, Econovet Sheep: 2 Volksrust, Cape Cross Volksrust Dierehospitaal Sheep: 2 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Sheep: 2 Pretoria, Anima Veterinary Consulting Rooms Sheep: 2 Limpopo Modimolle, Kranskop Dierekliniek Sheep: 2 Polokwane, Pietersburg Veterinary Clinic Sheep: 2, Goat: 2 North West Klerksdorp, Klerksdorp Dierehospitaal Beef: 1, Sheep: 1 Lichtenburg, Dr CM Kruger-Rall Sheep: 1 Free State Clocolan, Clocolan Dierekliniek Sheep: 2 Frankfort, Frankfort Dierekliniek Sheep: 2 Kroonstad, Kroonstad Dierehospitaal Sheep: 2 Villiers, Wilgepoort Dierekliniek Vennootskap Sheep: 3 Vrede, Vrede Dierehospitaal Beef: 2, Sheep: 2 Kwazulu-Natal Bergville, Tugela Vet Clinic Beef: 1, Sheep: 1 Camperdown, Camperdown Vet Clinic Beef: 2 Dundee, Endumeni Herd health
Beef: 1, Sheep: 2 Eshowe, Eshowe Veterinary Hospital Sheep: 3 Estcourt, Estcourt Vet Clinic Sheep: 2, Goat: 2 Howick, Howick Veterinary Clinic Beef: 3, Sheep: 3 Kokstad, E.G.Veterinary Services Sheep: 2 Mooi River, Mooirivier Vet Clinic Beef: 2, Sheep: 2 Mtubatuba, Mtubatuba Animal Clinic Beef: 2, Goat: 2 Pietermaritzburg, Richmond Veterinay Clinic Sheep: 3, Goat: 3 Eastern Cape Aliwal North, Hertzogbrug Dierekliniek Sheep: 2 Graaff-Reinet, Graaff Reinet Veterinary Clinic Sheep: 3, Goat: 3 Queenstown, Queenstown Veterinary clinic Sheep: 2 Western Cape George, George Animal Hospital Sheep: 3
Resistant Round Worms ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.5 (2) 1.5 (2) 2.0 (1) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 1.5 (2) 1.5 (2) 2.0 (1) 1.0 (1) Mpumalanga Middelburg , Middelburg Dierehospitaal Sheep: 1 Nelspruit, Nelspruit Animal Hospital Sheep: 2 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Sheep: 1 Pretoria, Anima Veterinary Consulting Rooms Sheep: 2 Eastern Cape Graaff-Reinet, Graaff Reinet Veterinary Clinic Sheep: 2 Western Cape Caledon, Overberg Veterinary Hospital Sheep: 1
Wireworm ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 3.0 (4) 1.8 (9) 2.4 (7) 2.0 (1) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 3.0 (1)
Sheep 2.0 (1) 3.0 (2) 1.8 (9) 2.6 (5) 2.0 (1) 3.0 (1)
Goat 3.0 (1) 2.0 (2) Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Sheep: 2 Limpopo Bela-Bela, Warmbad Dierekliniek Sheep: 3 Makhado, Blouberg Dierekliniek Beef: 3, Sheep: 3, Goat: 3 Free State Bethlehem, Bethlehem Animal Hospital Sheep: 1 Clocolan, Clocolan Dierekliniek Sheep: 2 Frankfort, Frankfort Dierekliniek Sheep: 2 Gariepdam, Gariep Dierekliniek Sheep: 3 Merino lambs in Philipollis area Hertzogville, Hertzogville Dierekliniek Sheep: 1 Memel, Memel Veterinary Clinic Sheep: 1 Reitz, Riemland Dierehospitaal Sheep: 2 Villiers, Wilgepoort Dierekliniek Vennootskap Sheep: 3 Wesselsbron, Wesselsbron Dierekliniek Sheep: 1 Kwazulu-Natal Camperdown, Camperdown Vet Clinic Sheep: 3, Goat: 2 Estcourt, Estcourt Vet Clinic Sheep: 2, Goat: 2 Howick, Howick Veterinary Clinic Sheep: 3 Kokstad, E.G.Veterinary Services Sheep: 2 Pietermaritzburg, Richmond Veterinay Clinic Sheep: 3 Eastern Cape Cradock, Cradock Veterinary Clinic Sheep: 2 Western Cape George, George Animal Hospital Sheep: 3
Brown stomach-worm ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 3.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 3.0 (1) Sheep 2.0 (1) Kwazulu-Natal Howick, Howick Veterinary Clinic Beef: 3 Eastern Cape Cradock, Cradock Veterinary Clinic Sheep: 2
Nodular worm ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 2.0 (2) Northern Cape Kuruman, Kuruman Dierekliniek Sheep: 2 Kuruman, Lea Shuda CSS Vet Sheep: 2
Tape Worms ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 1.0 (1)
1.6 (7) 1.6 (5) 2.0 (1) 2.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1)
1.0 (1) 1.5 (2)
Sheep 2.0 (1) 1.7 (6) 1.7 (3) 2.0 (1)
Goat 2.0 (1) 2.0 (1) Mpumalanga Standerton, Econovet Sheep: 2 North West Ventersdorp, Buffelsvlei Dierekliniek Beef: 1 Free State
Clocolan, Clocolan Dierekliniek Sheep: 2 Frankfort, Frankfort Dierekliniek Sheep: 2 Ladybrand, Ladybrand / Excelsior Dierekliniek Sheep: 1 Reitz, Riemland Dierehospitaal Sheep: 2 Villiers, Wilgepoort Dierekliniek Vennootskap Sheep: 2 Vrede, Vrede Dierehospitaal Beef: 1, Sheep: 1 Kwazulu-Natal Camperdown, Camperdown Vet Clinic Sheep: 1 Dundee, Endumeni Herd health Beef: 1, Sheep: 2 Kokstad, E.G.Veterinary Services Beef: 2, Sheep: 2 Eastern Cape Graaff-Reinet, Graaff Reinet Veterinary Clinic Goat: 2 Northern Cape Kuruman, Lea Shuda CSS Vet Sheep: 2, Goat: 2
Parafilaria ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.5 (2) 1.0 (1) 1.7 (3)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.5 (2) 1.0 (1) 1.7 (3)
Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 2 Polokwane, Pietersburg Veterinary Clinic Beef: 3 North West Ventersdorp, Buffelsvlei Dierekliniek Beef: 1 Kwazulu-Natal Estcourt, Estcourt Vet Clinic Beef: 2 Mtubatuba, Mtubatuba Animal Clinic Beef: 2 Pongola, Pongola Animal Clinic Beef: 1
Liver fluke ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (2) 1.4 (5) 2.3 (3) 2.0 (1) 2.0 (3)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 1.5 (4) 2.0 (2)
Dairy 3.0 (1) 2.0 (1)
Sheep 1.0 (1) 1.0 (1) 2.0 (1) 2.0 (2)
Mpumalanga Balfour, Balfour Dierekliniek Beef: 1 Middelburg , Middelburg Dierehospitaal Sheep: 1 Free State Frankfort, Frankfort Dierekliniek Beef: 2 Hoopstad, Hoopstad Dierekliniek Beef: 1 Memel, Memel Veterinary Clinic Beef: 1, Sheep: 1 Vrede, Vrede Dierehospitaal Beef: 2 Kwazulu-Natal Bergville, Tugela Vet Clinic Beef: 1 Howick, Howick Veterinary Clinic Beef: 3, Dairy: 3 Eastern Cape Cradock, Cradock Veterinary Clinic Sheep: 2 Western Cape Caledon, Overberg Veterinary Hospital Sheep: 2 George, George Animal Hospital Dairy: 2, Sheep: 2
Conical Flukes ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 2.3 (4) 1.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 2.3 (4) 1.0 (1) 2.0 (1)
Mpumalanga Balfour, Balfour Dierekliniek Beef: 1 Free State Clocolan, Clocolan Dierekliniek
Beef: 2 Frankfort, Frankfort Dierekliniek Beef: 3 Vrede, Vrede Dierehospitaal Beef: 2 Winburg, Winburg Dierekliniek Beef: 2 Kwazulu-Natal Mtubatuba, Mtubatuba Animal Clinic Beef: 1 Eastern Cape Graaff-Reinet, Graaff Reinet Veterinary Clinic Beef: 2
Cysticercosis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 3.0 (1) 1.0 (1) 1.0 (1) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 3.0 (1) 1.0 (1) 1.0 (1)
Goat 1.0 (1) Mpumalanga Nelspruit, Nelspruit Animal Hospital Beef: 3 Free State Parys, Parys Dierehospitaal Beef: 1 Kwazulu-Natal Pongola, Pongola Animal Clinic Goat: 1 Western Cape George, George Animal Hospital Beef: 1
Other ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) Sheep 1.0 (1) Western Cape Darling, Darling Dierekliniek Beef: 1 Stefanofilaria Sheep: 1
Stefanofilaria
External Parasites
Blue ticks ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (7) 2.0 (2) 2.0 (5)
2.3 (15) 2.6 (10) 2.0 (4) 2.5 (4) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (6) 2.0 (2) 2.3 (4)
2.3 (11) 2.6 (8) 2.0 (2) 2.5 (2) 3.0 (1)
Dairy 2.0 (2) 2.5 (2) 2.0 (1) 2.5 (2)
Sheep 2.0 (1) 1.0 (1)
2.5 (2) 2.0 (1)
Mpumalanga Balfour, Balfour Dierekliniek Beef: 2, Sheep: 2 Bethal, Bethal Dierekliniek Beef: 2 Grootvlei, Grootvlei Dierekliniek Beef: 2 Middelburg , Middelburg Dierehospitaal Beef: 1 Nelspruit, Nelspruit Animal Hospital Beef: 3 Standerton, Econovet Beef: 2 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 1 Polokwane, Pietersburg Veterinary Clinic Beef: 3 North West Klerksdorp, Klerksdorp Dierehospitaal Beef: 1, Sheep: 1 Stella, Stella Dierekliniek Beef: 3 Ventersdorp, Buffelsvlei Dierekliniek Beef: 2 Vryburg, Vryburg Dierehospitaal Beef: 3 Free State Clocolan, Clocolan Dierekliniek Beef: 3 Dewetsdorp, Platkop Dierekliniek Beef: 2 Ficksburg, Oosvrystaat Diere Produkte Beef: 2, Dairy: 2 Frankfort, Frankfort Dierekliniek Beef: 3 Hoopstad, Hoopstad Dierekliniek
Beef: 3, Sheep: 3 Kroonstad, Kroonstad Dierehospitaal Beef: 2, Dairy: 2, Sheep: 2 Memel, Memel Veterinary Clinic Beef: 2 Reitz, Riemland Dierehospitaal Beef: 1 Villiers, Wilgepoort Dierekliniek Vennootskap Beef: 2 Vrede, Vrede Dierehospitaal Beef: 3 Winburg, Winburg Dierekliniek Beef: 2 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 3 Dundee, Endumeni Herd health Beef: 3 Howick, Howick Veterinary Clinic Beef: 3, Dairy: 3 Kokstad, E.G.Veterinary Services Beef: 3, Dairy: 2 Mooi River, Mooirivier Vet Clinic Beef: 2 Mtubatuba, Mtubatuba Animal Clinic Beef: 2 Pietermaritzburg, Richmond Veterinay Clinic Beef: 3 Underberg, Underberg Veterinary Surgery Beef: 2 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Beef: 2, Dairy: 2 Aliwal North, Hertzogbrug Dierekliniek Beef: 2, Sheep: 2 Western Cape George, George Animal Hospital Beef: 3, Dairy: 3 Heidelberg (WC), Heidelberg Dierekliniek Dairy: 2 Oudtshoorn, Oudtshoorn Dierekliniek Beef: 2 Northern Cape Kuruman, Kuruman Dierekliniek Beef: 3
Resistant blue Ticks ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 3.0 (1) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 3.0 (1) 3.0 (1)
Mpumalanga Nelspruit, Nelspruit Animal Hospital Beef: 2 Free State Parys, Parys Dierehospitaal Beef: 3 Kwazulu-Natal Pietermaritzburg, Richmond Veterinay Clinic Beef: 3
Heartwater (Bont) ticks ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.8 (4) 2.0 (2) 2.7 (6) 2.5 (4) 2.3 (7) 2.0 (4)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.5 (2) 2.0 (1) 2.7 (3) 2.0 (2) 2.4 (5) 2.0 (2)
Dairy 2.0 (1)
Sheep 3.0 (1) 2.0 (1) 2.5 (2) 3.0 (1) 2.0 (1)
Goat 3.0 (1) 3.0 (1) 3.0 (1) 2.0 (1) 2.0 (1)
Mpumalanga Middelburg , Middelburg Dierehospitaal Beef: 2 Nelspruit, Nelspruit Animal Hospital Beef: 3, Sheep: 3, Goat: 3 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 2 Pretoria, Anima Veterinary Consulting Rooms Sheep: 2 Limpopo Modimolle, Kranskop Dierekliniek Beef: 3 Mokopane, Potgietersrus Dierekliniek Beef: 2, Sheep: 2 Polokwane, Pietersburg Veterinary Clinic Beef: 3, Sheep: 3, Goat: 3 North West Ventersdorp, Buffelsvlei Dierekliniek Beef: 1 Vryburg, Vryburg Dierehospitaal Beef: 3, Sheep: 3, Goat: 3 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Dundee, Endumeni Herd health Beef: 3, Sheep: 2, Goat: 2 Mooi River, Mooirivier Vet Clinic Beef: 2 Mtubatuba, Mtubatuba Animal Clinic
Beef: 3 Pietermaritzburg, Richmond Veterinay Clinic Beef: 2 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Beef: 2, Dairy: 2 Witelsbos, Witelsbos Veterinary Consulting Rooms Beef: 2, Goat: 2
Brown ear-ticks ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.3 (4) 2.0 (2) 2.3 (3) 2.0 (2) 1.6 (8) 3.0 (2) 3.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.3 (3) 2.0 (2) 2.0 (2) 2.0 (2) 1.6 (5) 3.0 (1) 3.0 (1)
Dairy 3.0 (1) Sheep 1.0 (1) 3.0 (1) 2.0 (1) 3.0 (1) Goat 1.5 (2) Mpumalanga Balfour, Balfour Dierekliniek Beef: 1, Sheep: 1 Grootvlei, Grootvlei Dierekliniek Beef: 2 Middelburg , Middelburg Dierehospitaal Beef: 1 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 2 Pretoria, Anima Veterinary Consulting Rooms Beef: 2 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 1 Polokwane, Pietersburg Veterinary Clinic Beef: 3, Sheep: 3 Free State Villiers, Wilgepoort Dierekliniek Vennootskap Beef: 2 Vrede, Vrede Dierehospitaal Beef: 2 Kwazulu-Natal Bergville, Tugela Vet Clinic Beef: 1, Goat: 1 Dundee, Endumeni Herd health Beef: 1 Mooi River, Mooirivier Vet Clinic Beef: 2 Mtubatuba, Mtubatuba Animal Clinic Beef: 2 Pongola, Pongola Animal Clinic Beef: 2, Sheep: 2, Goat: 2
Eastern Cape Aliwal North, Hertzogbrug Dierekliniek Beef: 3, Sheep: 3 Western Cape George, George Animal Hospital Beef: 3, Dairy: 3
Bont-legged ticks ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.8 (4) 3.0 (2) 2.4 (7)
2.7 (22) 2.0 (1) 1.7 (3) 2.3 (3)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.8 (4) 3.0 (1) 2.5 (6)
2.8 (14) 2.0 (1) 1.5 (2) 2.0 (1)
Dairy 2.5 (2)
Sheep 3.0 (1) 2.0 (1)
2.5 (6) 2.0 (1) 2.5 (2)
Mpumalanga Balfour, Balfour Dierekliniek Beef: 2 Bethal, Bethal Dierekliniek Beef: 2 Grootvlei, Grootvlei Dierekliniek Beef: 2 Middelburg , Middelburg Dierehospitaal Beef: 1 Limpopo Polokwane, Pietersburg Veterinary Clinic Beef: 3, Sheep: 3 North West Christiana, Christiana Dierehospitaal Beef: 3 Klerksdorp, Klerksdorp Dierehospitaal Beef: 2, Sheep: 2 Leeudoringstad, Leeudoringstad Dierekliniek Beef: 2 Lichtenburg, Dr CM Kruger-Rall Beef: 2 Stella, Stella Dierekliniek Beef: 3 Vryburg, Vryburg Dierehospitaal Beef: 3 Free State Bethlehem, Freestate Bethlehem SV Beef: 2 Bultfontein, Greylingsrust Dierespreekkamer Beef: 2 Clocolan, Clocolan Dierekliniek Beef: 3 Dewetsdorp, Platkop Dierekliniek Beef: 3, Sheep: 3
Ficksburg, Oosvrystaat Diere Produkte Beef: 2, Dairy: 2, Sheep: 2 Frankfort, Frankfort Dierekliniek Beef: 3 Hoopstad, Hoopstad Dierekliniek Beef: 3, Sheep: 3 Kroonstad, Kroonstad Dierehospitaal Beef: 3, Dairy: 3, Sheep: 3 Ladybrand, Ladybrand / Excelsior Dierekliniek Sheep: 1 with gangrene Memel, Memel Veterinary Clinic Beef: 3 Parys, Parys Dierehospitaal Beef: 3 Viljoenskroon, Viljoenskroon Dierekliniek Beef: 3 Villiers, Wilgepoort Dierekliniek Vennootskap Beef: 3 Vrede, Vrede Dierehospitaal Beef: 3 Winburg, Winburg Dierekliniek Beef: 3, Sheep: 3 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Western Cape Oudtshoorn, Ostrimed Beef: 2, Sheep: 2 Oudtshoorn, Oudtshoorn Dierekliniek Beef: 1 Northern Cape Calvinia, Calvinia Veeartskliniek Sheep: 3 De Aar, De Aar Veterinary Clinic Sheep: 2 Kuruman, Kuruman Dierekliniek Beef: 2
Red-legged ticks ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.2 (5) 3.0 (1) 2.3 (3)
2.8 (12) 2.0 (8) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.3 (3) 3.0 (1) 2.5 (2)
3.0 (7) 2.0 (4)
Dairy 3.0 (1) 2.0 (1)
Sheep 1.0 (1) 2.0 (1)
2.5 (4) 2.0 (2) 2.0 (1)
Goat 1.0 (1) 2.0 (1) Mpumalanga
Balfour, Balfour Dierekliniek Beef: 1, Sheep: 1, Goat: 1 Grootvlei, Grootvlei Dierekliniek Beef: 2 Middelburg , Middelburg Dierehospitaal Beef: 1 Limpopo Modimolle, Kranskop Dierekliniek Beef: 3 North West Christiana, Christiana Dierehospitaal Beef: 3 Klerksdorp, Klerksdorp Dierehospitaal Beef: 2, Sheep: 2 Free State Bethlehem, Freestate Bethlehem SV Sheep: 2 Clocolan, Clocolan Dierekliniek Beef: 3 Hoopstad, Hoopstad Dierekliniek Beef: 3, Sheep: 3 Kroonstad, Kroonstad Dierehospitaal Beef: 3, Dairy: 3, Sheep: 3 Memel, Memel Veterinary Clinic Beef: 3, Sheep: 2 Parys, Parys Dierehospitaal Beef: 3 Viljoenskroon, Viljoenskroon Dierekliniek Beef: 3 Vrede, Vrede Dierehospitaal Beef: 3 Kwazulu-Natal Kokstad, E.G.Veterinary Services Sheep: 2 Mooi River, Mooirivier Vet Clinic Beef: 2, Dairy: 2 Pietermaritzburg, Richmond Veterinay Clinic Beef: 2 Pongola, Pongola Animal Clinic Beef: 2, Sheep: 2, Goat: 2 Underberg, Underberg Veterinary Surgery Beef: 2 Northern Cape De Aar, De Aar Veterinary Clinic Sheep: 2
Paralysis ticks ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (2) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 2.0 (2) 1.0 (1)
Free State Frankfort, Frankfort Dierekliniek Sheep: 2 Villiers, Wilgepoort Dierekliniek Vennootskap Sheep: 2 Kwazulu-Natal Bergville, Tugela Vet Clinic Sheep: 1
Biting lice (red lice) ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.5 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 2.5 (2)
Free State Frankfort, Frankfort Dierekliniek Sheep: 2 Winburg, Winburg Dierekliniek Sheep: 3
Sucking lice (blue lice) ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 2.3 (3)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 2.5 (2)
Goat 2.0 (1) Free State Wesselsbron, Wesselsbron Dierekliniek Beef: 1 Northern Cape Kuruman, Kuruman Dierekliniek Beef: 3 Kuruman, Lea Shuda CSS Vet Beef: 2, Goat: 2
Scab mites ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 3.0 (1)
(2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 1.0 (2) 3.0 (1)
Free State Bethlehem, Freestate Bethlehem SV Sheep: 1 Frankfort, Frankfort Dierekliniek Sheep: 1 Northern Cape Calvinia, Calvinia Veeartskliniek Sheep: 3
Mange Mites ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 1.0 (1) Mpumalanga Balfour, Balfour Dierekliniek Sheep: 1
Nuisance Flies ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.5 (6) 2.9 (7) 2.5 (11) 2.3 (3) 2.5 (4)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.7 (3) 2.8 (4) 2.5 (6) 2.0 (1) 2.5 (2)
Dairy 3.0 (1) 2.5 (2) 2.5 (2) 2.5 (2)
Sheep 2.0 (1) 3.0 (2) 2.5 (2)
Goat 2.5 (2) 2.0 (1) Mpumalanga Balfour, Balfour Dierekliniek Beef: 2, Sheep: 2, Goat: 2 Nelspruit, Nelspruit Animal Hospital Beef: 3, Goat: 3 Standerton, Econovet Beef: 3 Free State
Hoopstad, Hoopstad Dierekliniek Beef: 3, Sheep: 3 Kroonstad, Kroonstad Dierehospitaal Dairy: 3 Ladybrand, Ladybrand / Excelsior Dierekliniek Beef: 2 Eye infection outbreak Memel, Memel Veterinary Clinic Beef: 3 Winburg, Winburg Dierekliniek Beef: 3, Sheep: 3 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 3 Dundee, Endumeni Herd health Beef: 2, Dairy: 2 Howick, Howick Veterinary Clinic Beef: 3, Dairy: 3, Sheep: 3 Mtubatuba, Mtubatuba Animal Clinic Beef: 2, Goat: 2 Pongola, Pongola Animal Clinic Beef: 3 Good rains in October Underberg, Underberg Veterinary Surgery Beef: 2, Sheep: 2 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Beef: 2, Dairy: 2 Jeffreys Bay, Cape Cross Veterinary Hospital Dairy: 3 Western Cape Malmesbury, Dr Otto Kriek Dairy: 3 Oudtshoorn, Ostrimed Beef: 3 Oudtshoorn, Oudtshoorn Dierekliniek Beef: 2 Stellenbosch, Stellenbosch Animal Hospital Dairy: 2
Blowflies ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 1.0 (1) 1.0 (1)
2.5 (2) 1.5 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1)
Sheep 1.0 (1) 1.0 (1)
2.5 (2) 1.5 (2)
Mpumalanga Balfour, Balfour Dierekliniek Sheep: 1 Limpopo Mokopane, Potgietersrus Dierekliniek
Beef: 1 North West Lichtenburg, Dr CM Kruger-Rall Sheep: 1 Free State Reitz, Riemland Dierehospitaal Sheep: 2 Winburg, Winburg Dierekliniek Sheep: 3 Western Cape Heidelberg (WC), Heidelberg Dierekliniek Sheep: 2 Oudtshoorn, Oudtshoorn Dierekliniek Sheep: 1
Screw-worm ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 3.0 (1) 2.0 (1) 2.0 (1) 2.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 3.0 (1) 2.0 (1) 2.0 (1) Dairy 2.0 (1)
Sheep 2.0 (1)
Mpumalanga Nelspruit, Nelspruit Animal Hospital Beef: 3 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 2 Free State Reitz, Riemland Dierehospitaal Sheep: 2 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Beef: 2, Dairy: 2
Nasal bot larvae ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.3 (8) 2.0 (4)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 2.3 (8) 2.0 (4)
Free State Ficksburg, Oosvrystaat Diere Produkte
Sheep: 1 Frankfort, Frankfort Dierekliniek Sheep: 2 Hoopstad, Hoopstad Dierekliniek Sheep: 3 Kroonstad, Kroonstad Dierehospitaal Sheep: 2 Ladybrand, Ladybrand / Excelsior Dierekliniek Sheep: 2 Reitz, Riemland Dierehospitaal Sheep: 3 Smithfield, Freestate Smithfield SV Sheep: 2 Vrede, Vrede Dierehospitaal Sheep: 3 Kwazulu-Natal Camperdown, Camperdown Vet Clinic Sheep: 2 Dundee, Endumeni Herd health Sheep: 2 Eshowe, Eshowe Veterinary Hospital Sheep: 3 Estcourt, Estcourt Vet Clinic Sheep: 1
Midges ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.7 (3) 2.3 (3)
2.3 (4) 3.0 (3) 3.0 (2) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.5 (2) 2.0 (2)
2.5 (2) 3.0 (1) 3.0 (1)
Sheep 2.0 (1) 3.0 (1)
2.0 (2) 3.0 (1) 3.0 (1) 3.0 (1)
Goat 3.0 (1) Mpumalanga Balfour, Balfour Dierekliniek Beef: 1 Nelspruit, Nelspruit Animal Hospital Beef: 2, Sheep: 2 North West Christiana, Christiana Dierehospitaal Beef: 3, Sheep: 3 Vryburg, Vryburg Dierehospitaal Beef: 1 Starting to see midges Free State Memel, Memel Veterinary Clinic Beef: 2, Sheep: 2 Parys, Parys Dierehospitaal Beef: 3 Winburg, Winburg Dierekliniek
Sheep: 2 Kwazulu-Natal Pongola, Pongola Animal Clinic Beef: 3 Good rains in October Sheep: 3, Goat: 3 Western Cape Oudtshoorn, Ostrimed Beef: 3, Sheep: 3 Northern Cape De Aar, De Aar Veterinary Clinic Sheep: 3 Midges and mosquitoes
Mosquitoes ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.5 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.5 (2) Mpumalanga Grootvlei, Grootvlei Dierekliniek Beef: 2 Nelspruit, Nelspruit Animal Hospital Beef: 3
Tampans ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) Northern Cape Kuruman, Kuruman Dierekliniek Beef: 2
Other ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 1.0 (1) Kwazulu-Natal Pongola, Pongola Animal Clinic
Sheep: 1 Gedoelstia, uitpeuloogsiekte
Tick-borne Diseases
African red water ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.2 (5) 1.0 (1) 2.0 (2)
1.9 (7) 2.3 (11) 1.8 (4)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.2 (5) 1.0 (1) 2.0 (2)
1.9 (7) 2.2 (9) 1.5 (2)
Dairy 2.5 (2) 2.0 (2) Mpumalanga Bethal, Bethal Dierekliniek Beef: 2 Middelburg , Middelburg Dierehospitaal Beef: 3 Nelspruit, Nelspruit Animal Hospital Beef: 2 Standerton, Econovet Beef: 2 Volksrust, Cape Cross Volksrust Dierehospitaal Beef: 2 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 1 North West Klerksdorp, Klerksdorp Dierehospitaal Beef: 2 Vryburg, Vryburg Dierehospitaal Beef: 2 Free State Bethlehem, Bethlehem Animal Hospital Beef: 1 Frankfort, Frankfort Dierekliniek Beef: 3 Harrismith, Harrismith Dierehospitaal Beef: 2 Reitz, Riemland Dierehospitaal Beef: 2 Viljoenskroon, Viljoenskroon Dierekliniek Beef: 1 Villiers, Wilgepoort Dierekliniek Vennootskap Beef: 2 Vrede, Vrede Dierehospitaal Beef: 2 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Bergville, Tugela Vet Clinic Beef: 1 Dundee, Endumeni Herd health
Dairy: 2 Estcourt, Estcourt Vet Clinic Beef: 2 Howick, Howick Veterinary Clinic Beef: 3, Dairy: 3 Kokstad, E.G.Veterinary Services Beef: 3 Mtubatuba, Mtubatuba Animal Clinic Beef: 2 Newcastle, Ncanduvet Newcastle Beef: 3 Pietermaritzburg, Richmond Veterinay Clinic Beef: 3 Underberg, Underberg Veterinary Surgery Beef: 1 Western Cape Caledon, Overberg Veterinary Hospital Beef: 1 George, George Animal Hospital Beef: 2, Dairy: 2 Heidelberg (WC), Heidelberg Dierekliniek Dairy: 2
Asiatic red water ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.2 (5) 2.0 (1) 2.0 (1) 2.0 (1)
2.0 (3) 2.0 (9) 2.0 (1) 1.8 (4)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.2 (5) 2.0 (1) 2.0 (1) 2.0 (1)
2.0 (3) 2.0 (8) 1.5 (2)
Dairy 2.0 (1) 2.0 (1) 2.0 (2) Mpumalanga Balfour, Balfour Dierekliniek Beef: 1 Bethal, Bethal Dierekliniek Beef: 2 Middelburg , Middelburg Dierehospitaal Beef: 3 Nelspruit, Nelspruit Animal Hospital Beef: 3 Volksrust, Cape Cross Volksrust Dierehospitaal Beef: 2 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 2 Limpopo Makhado, Blouberg Dierekliniek Beef: 2 Five cases North West Vryburg, Vryburg Dierehospitaal Beef: 2 Free State
Frankfort, Frankfort Dierekliniek Beef: 3 Memel, Memel Veterinary Clinic Beef: 2 Vrede, Vrede Dierehospitaal Beef: 1 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Bergville, Tugela Vet Clinic Beef: 2 Dundee, Endumeni Herd health Beef: 3, Dairy: 2 Eshowe, Eshowe Veterinary Hospital Beef: 3 Kokstad, E.G.Veterinary Services Beef: 2 Mtubatuba, Mtubatuba Animal Clinic Beef: 1 Pietermaritzburg, Richmond Veterinay Clinic Beef: 2 Underberg, Underberg Veterinary Surgery Beef: 1 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Dairy: 2 Western Cape George, George Animal Hospital Beef: 2, Dairy: 2 Oudtshoorn, Ostrimed Beef: 1 Swellendam, Swellendam Dierehospitaal Dairy: 2
Anaplasmosis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.5 (4) 3.0 (1)
1.9 (7) 1.9 (7) 1.0 (1) 2.0 (5) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.5 (4) 3.0 (1)
1.9 (7) 1.7 (6) 1.0 (1) 2.0 (2) 1.0 (1)
Dairy 3.0 (1) 2.0 (3) Mpumalanga Balfour, Balfour Dierekliniek Beef: 1 Grootvlei, Grootvlei Dierekliniek Beef: 2 Middelburg , Middelburg Dierehospitaal Beef: 1 Nelspruit, Nelspruit Animal Hospital Beef: 2 Introduced cattle to area North West
Christiana, Christiana Dierehospitaal Beef: 3 Free State Bethlehem, Bethlehem Animal Hospital Beef: 2 Bethlehem, Freestate Bethlehem SV Beef: 2 Bultfontein, Greylingsrust Dierespreekkamer Beef: 1 Clocolan, Clocolan Dierekliniek Beef: 3 Hoopstad, Hoopstad Dierekliniek Beef: 3 Reitz, Riemland Dierehospitaal Beef: 1 Wesselsbron, Wesselsbron Dierekliniek Beef: 1 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Bergville, Tugela Vet Clinic Beef: 2 Howick, Howick Veterinary Clinic Beef: 2, Dairy: 3 Kokstad, E.G.Veterinary Services Beef: 2 Pongola, Pongola Animal Clinic Beef: 1 Underberg, Underberg Veterinary Surgery Beef: 1 Eastern Cape Queenstown, Queenstown Veterinary clinic Beef: 1 Western Cape Heidelberg (WC), Heidelberg Dierekliniek Dairy: 2 Malmesbury, Invitrotech Dairy: 3 Eleven cases out of 4 000 dairy cows Stellenbosch, Stellenbosch Animal Hospital Beef: 2, Dairy: 1 Wellington, Wellington Dierehospitaal Beef: 2 Northern Cape Kimberley, Kimberley Dierekliniek Beef: 1
Heartwater ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (3) 2.0 (2) 2.3 (6) 2.0 (3) 2.0 (21) 2.0 (4)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (3) 2.0 (1) 2.0 (4) 2.0 2.1 (9) 3.0 (1)
(1) Dairy 2.0 (1) 1.0 (1)
Sheep 3.0 (1) 2.0 (1) 1.8 (5)
Goat 2.0 (1) 3.0 (1) 2.0 (1) 1.8 (6) 2.0 (2)
Mpumalanga Bushbuckridge, Dr Martin Jansen CSS Vet Beef: 1 Middelburg , Middelburg Dierehospitaal Beef: 3 Nelspruit, Nelspruit Animal Hospital Beef: 2 Cases found in vaccinated animals: were vaccinated at weaning, but tick exposure subsequently inadequate Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 2 Pretoria, Dr Rosaly Steyn (LNR) CSS vet Goat: 2 Limpopo Makhado, Blouberg Dierekliniek Beef: 2 Four cases Mokopane, Potgietersrus Dierekliniek Beef: 2 Polokwane, Pietersburg Veterinary Clinic Beef: 3, Sheep: 3, Goat: 3 Vaalwater, Vaalwater Dierespreekkamer Beef: 1 North West Vryburg, Vryburg Dierehospitaal Beef: 2, Sheep: 2, Goat: 2 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Bergville, Tugela Vet Clinic Beef: 1 Camperdown, Camperdown Vet Clinic Goat: 1 Dundee, Endumeni Herd health Beef: 2, Sheep: 2, Goat: 2 Eshowe, Eshowe Veterinary Hospital Beef: 3 Per acute heartwater in cattle brought into the area Estcourt, Estcourt Vet Clinic Beef: 2, Dairy: 2, Sheep: 2, Goat: 2 Mooi River, Mooirivier Vet Clinic Beef: 3 Mtubatuba, Mtubatuba Animal Clinic Beef: 2, Goat: 2 Newcastle, Ncanduvet Newcastle Sheep: 1 Pietermaritzburg, Richmond Veterinay Clinic Beef: 2, Sheep: 2, Goat: 2 Pongola, Pongola Animal Clinic Beef: 2, Sheep: 2, Goat: 2 Eastern Cape
Alexandria, Alexandria Platteland Spreekkamer Dairy: 1 Bathurst, Dr Jane Pistorius Goat: 2 Five cases Stutterheim, Stutterheim Veterinary Clinic Beef: 3 Dexter cows reacted severly to heart water blooding! Two out of 21 died despite blocking and further treatment. Goat: 2 Three young goats died of heartwater
Sweating Sickness ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1)
1.5 (2) 1.0 (1) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1)
1.5 (2) 1.0 (1) 1.0 (1)
North West Lichtenburg, Dr CM Kruger-Rall Beef: 1 Free State Kroonstad, Kroonstad Dierehospitaal Beef: 1 Winburg, Winburg Dierekliniek Beef: 2 Western Cape Stellenbosch, Stellenbosch Animal Hospital Beef: 1 Northern Cape Kathu, Kathu Dierekliniek Beef: 1
Insect Transmittable Diseases
Lumpy skin disease ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 1.0 (3) 2.0 (1) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 1.0 (3) 2.0 (1) 3.0 (1)
Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 2 Free State
Bethlehem, Freestate Bethlehem SV Beef: 1 Kroonstad, Kroonstad Dierehospitaal Beef: 1 Viljoenskroon, Viljoenskroon Dierekliniek Beef: 1 Kwazulu-Natal Mtubatuba, Mtubatuba Animal Clinic Beef: 2 Northern Cape Upington, Upington Veterinary Clinic Beef: 3 Outbreaks along the river
Three-day-stiffsickness ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 2.0 (1) 2.0 (1)
2.0 (2) 2.0 (3) 1.0 (1) 2.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 2.0 (1) 2.0 (1)
2.0 (2) 2.0 (3) 2.0 (1)
Dairy 1.0 (1) 2.0 (1) Mpumalanga Grootvlei, Grootvlei Dierekliniek Beef: 1 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 2 North West Christiana, Christiana Dierehospitaal Beef: 2 Free State Reitz, Riemland Dierehospitaal Beef: 2 Winburg, Winburg Dierekliniek Beef: 2 Kwazulu-Natal Kokstad, E.G.Veterinary Services Beef: 2 Mtubatuba, Mtubatuba Animal Clinic Beef: 2 Pongola, Pongola Animal Clinic Beef: 2 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Dairy: 1 Western Cape Heidelberg (WC), Heidelberg Dierekliniek Dairy: 2 Plettenberg Bay, Plettenberg Bay A Reitz Beef: 2 Five cases
Blue tongue ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 2.0 (2) 1.0 (1) 3.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Dairy 3.0 (1)
Sheep 2.0 (1) 2.0 (2) 1.0 (1) 2.0 (1)
Gauteng Pretoria, Anima Veterinary Consulting Rooms Sheep: 2 Free State Reitz, Riemland Dierehospitaal Sheep: 1 Wesselsbron, Wesselsbron Dierekliniek Sheep: 3 Kwazulu-Natal Camperdown, Camperdown Vet Clinic Sheep: 1 Suspected case, unconfirmed Eastern Cape Jeffreys Bay, Cape Cross Veterinary Hospital Dairy: 3 Western Cape Vredenburg, Vredenburg Dierehospitaal Sheep: 2 Six cases of blue tongue on one farm along the Berg river in the Sandveld. Very early in the season although it is very dry.
Venereal Diseases
Actinobacillus seminis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 2.0 (1) Northern Cape Calvinia, Calvinia Veeartskliniek Sheep: 2
Trichomonosis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (6) 1.5 (4) 2.0 (5)
2.6 (8) 1.8 (4) 2.0 (2) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (6) 1.5 (4) 2.0 (5)
2.6 (8) 1.8 (4) 2.0 (2) 2.0 (1)
Mpumalanga Balfour, Balfour Dierekliniek Beef: 2 Two out of 6 bulls tested positive Bethal, Bethal Dierekliniek Beef: 1 Grootvlei, Grootvlei Dierekliniek Beef: 2 Middelburg , Middelburg Dierehospitaal Beef: 2 Standerton, Econovet Beef: 3 Farm already positive Volksrust, Cape Cross Volksrust Dierehospitaal Beef: 2 Limpopo Bela-Bela, Warmbad Dierekliniek Beef: 2 Four bulls Makhado, Blouberg Dierekliniek Beef: 2 3 cases Mokopane, Potgietersrus Dierekliniek Beef: 1 Polokwane, Pietersburg Veterinary Clinic Beef: 1 North West Klerksdorp, Klerksdorp Dierehospitaal Beef: 3 Leeudoringstad, Leeudoringstad Dierekliniek Beef: 1 Lichtenburg, Dr CM Kruger-Rall Beef: 2 Stella, Stella Dierekliniek Beef: 3 Existing farm Ventersdorp, Buffelsvlei Dierekliniek Beef: 1 Free State Clocolan, Clocolan Dierekliniek Beef: 3 Frankfort, Frankfort Dierekliniek Beef: 2 Hoopstad, Hoopstad Dierekliniek Beef: 3 Kroonstad, Kroonstad Dierehospitaal Beef: 3 Reitz, Riemland Dierehospitaal Beef: 3 Viljoenskroon, Viljoenskroon Dierekliniek Beef: 1
New farm Villiers, Wilgepoort Dierekliniek Vennootskap Beef: 3 Winburg, Winburg Dierekliniek Beef: 3 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Dundee, Endumeni Herd health Beef: 2 Kokstad, E.G.Veterinary Services Beef: 2 Pietermaritzburg, Richmond Veterinay Clinic Beef: 1 One herd. Expect an increase - deterioration of regional/national biosecurity Eastern Cape Aliwal North, Hertzogbrug Dierekliniek Beef: 2 Queenstown, Queenstown Veterinary clinic Beef: 2 Northern Cape Kuruman, Lea Shuda CSS Vet Beef: 2
Vibriosis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 2.0 (2) 2.5 (4) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 2.0 (2) 2.5 (4) 1.0 (1)
Mpumalanga Middelburg , Middelburg Dierehospitaal Beef: 2 Limpopo Bela-Bela, Warmbad Dierekliniek Beef: 2 Four bulls Makhado, Blouberg Dierekliniek Beef: 2 6 cases Free State Clocolan, Clocolan Dierekliniek Beef: 3 Kroonstad, Kroonstad Dierehospitaal Beef: 2 Reitz, Riemland Dierehospitaal Beef: 2 Viljoenskroon, Viljoenskroon Dierekliniek Beef: 3 Eastern Cape Queenstown, Queenstown Veterinary clinic Beef: 1
Pizzle disease ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.5 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 2.5 (2) Northern Cape Calvinia, Calvinia Veeartskliniek Sheep: 3 Philipstown, Rowelsfontein veearts Spreekkamer Sheep: 2
Bacterial Disease (other)
Blackquarter ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (3) 1.0 (2) 1.5 (2)
2.0 (10) 1.6 (5) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (3) 1.0 (2) 1.5 (2)
2.0 (10) 1.6 (5)
Dairy 2.0 (1) Mpumalanga Balfour, Balfour Dierekliniek Beef: 2 Grootvlei, Grootvlei Dierekliniek Beef: 1 Middelburg , Middelburg Dierehospitaal Beef: 3 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 1 Clostridium septicum Polokwane, Pietersburg Veterinary Clinic Beef: 1 North West Leeudoringstad, Leeudoringstad Dierekliniek Beef: 2 Few animals died including large cow Ventersdorp, Buffelsvlei Dierekliniek Beef: 1 Free State Bethlehem, Bethlehem Animal Hospital Beef: 3 Clocolan, Clocolan Dierekliniek Beef: 2
Frankfort, Frankfort Dierekliniek Beef: 2 Gariepdam, Gariep Dierekliniek Beef: 3 Blackquarter in 15 Nguni calves in the Philipollis district that were not vaccinated Hoopstad, Hoopstad Dierekliniek Beef: 1 Kroonstad, Kroonstad Dierehospitaal Beef: 2 Memel, Memel Veterinary Clinic Beef: 2 Reitz, Riemland Dierehospitaal Beef: 2 Smithfield, Freestate Smithfield SV Beef: 1 One outbreak, 4 cases - Clostridium novyi, C. septicum, C. sordelli Villiers, Wilgepoort Dierekliniek Vennootskap Beef: 2 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Estcourt, Estcourt Vet Clinic Beef: 1 Kokstad, E.G.Veterinary Services Beef: 2 Mtubatuba, Mtubatuba Animal Clinic Beef: 1 Underberg, Underberg Veterinary Surgery Beef: 2 Western Cape George, George Animal Hospital Dairy: 2
Botulism ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 1.0 (1)
2.0 (1) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 1.0 (1)
2.0 (1) 1.0 (1)
Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 1 North West Christiana, Christiana Dierehospitaal Beef: 1 Free State Kroonstad, Kroonstad Dierehospitaal Beef: 2 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 1
Pulpy Kidney ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.3 (3) 2.0 (1) 1.0 (2)
2.2 (5) 3.0 (1) 1.7 (3) 2.3 (3)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 1.3 (3) 2.0 (1) 1.0 (2)
2.2 (5) 3.0 (1) 2.0 (2) 2.3 (3)
Goat 1.0 (1) Mpumalanga Balfour, Balfour Dierekliniek Sheep: 1 Middelburg , Middelburg Dierehospitaal Sheep: 1 Volksrust, Cape Cross Volksrust Dierehospitaal Sheep: 2 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Sheep: 2 North West Christiana, Christiana Dierehospitaal Sheep: 1 Klerksdorp, Klerksdorp Dierehospitaal Sheep: 1 Free State Frankfort, Frankfort Dierekliniek Sheep: 2 Hoopstad, Hoopstad Dierekliniek Sheep: 3 Parys, Parys Dierehospitaal Sheep: 2 Reitz, Riemland Dierehospitaal Sheep: 2 Villiers, Wilgepoort Dierekliniek Vennootskap Sheep: 2 Eastern Cape Middelburg (EC), Steynsburg Dierehospitaal Sheep: 3 Western Cape Beaufort West, Beaufort West State Vet Sheep: 3 Animals not vaccinated correctly, also cases of FSE Caledon, Overberg Veterinary Hospital Goat: 1 Oudtshoorn, Oudtshoorn Dierekliniek Sheep: 1 Northern Cape Calvinia, Calvinia Veeartskliniek Sheep: 3 De Aar, De Aar Veterinary Clinic Sheep: 2 Philipstown, Rowelsfontein veearts Spreekkamer Sheep: 2
Lamb dysentry ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 3.0 (1)
Free State Hoopstad, Hoopstad Dierekliniek Sheep: 3
Swelled head disease ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 1.5 (2) 1.0 (1) 1.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 2.0 (1) 1.0 (1) 1.0 (1) Sheep 1.0 (1) 1.0 (1) Mpumalanga Volksrust, Cape Cross Volksrust Dierehospitaal Beef: 2 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 2, Sheep: 1 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 1 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 1 Kokstad, E.G.Veterinary Services Sheep: 1
Red gut (cattle) ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (2) 2.0 (1)
2.0 (4) 2.0 (2) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (2) 2.0 (1)
2.0 (4) 2.0 (2)
Dairy 2.0 (1) Mpumalanga Balfour, Balfour Dierekliniek Beef: 1 Grootvlei, Grootvlei Dierekliniek Beef: 1 North West Stella, Stella Dierekliniek Beef: 2 Free State Bethlehem, Bethlehem Animal Hospital Beef: 3 Clocolan, Clocolan Dierekliniek Beef: 1 Reitz, Riemland Dierehospitaal Beef: 2 Villiers, Wilgepoort Dierekliniek Vennootskap Beef: 2 Kwazulu-Natal Dundee, Endumeni Herd health Beef: 1 Underberg, Underberg Veterinary Surgery Beef: 3 Cattle not vaccinated with multi-clostridial vaccine Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Dairy: 2
Blood gut (Sheep) ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 1.0 (1)
2.0 (1) 1.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 1.0 (1) 1.0 (1)
2.0 (1) 1.0 (1) 2.0 (1)
Mpumalanga Middelburg , Middelburg Dierehospitaal Sheep: 1 North West Ventersdorp, Buffelsvlei Dierekliniek Sheep: 1 Free State Villiers, Wilgepoort Dierekliniek Vennootskap Sheep: 2 Western Cape Beaufort West, Beaufort West State Vet Sheep: 1 Northern Cape Kuruman, Kuruman Dierekliniek Sheep: 2
Tetanus ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 2.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 2.0 (1)
Goat 2.0 (1)
Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 1 Calves were badly dehorned and developed tetanus in branding wounds. Free State Bethlehem, Freestate Bethlehem SV Goat: 2 Northern Cape Kuruman, Kuruman Dierekliniek Beef: 2
Salmonellosis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 1.5 (2) 1.5 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.5 (2) 1.5 (2)
Dairy 2.0 (1) Mpumalanga Bethal, Bethal Dierekliniek Dairy: 2 Free State Clocolan, Clocolan Dierekliniek Beef: 1 Viljoenskroon, Viljoenskroon Dierekliniek Beef: 2 Kwazulu-Natal Kokstad, E.G.Veterinary Services Beef: 2 Newcastle, Ncanduvet Newcastle Beef: 1
Brucella abortus ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 3.0 (1) 2.3 (3) 2.5 (4)
2.1 (9) 2.0 (2) 1.5 (2) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 3.0 (1) 2.3 (3) 2.5 (4)
2.0 (8) 2.0 (2) 1.0 (1) 3.0 (1)
Dairy 3.0 (1)
Sheep 2.0 (1) Mpumalanga Standerton, Econovet Beef: 3 New farm Limpopo Makhado, Blouberg Dierekliniek Beef: 3 18 cases Mokopane, Potgietersrus Dierekliniek Beef: 1 Polokwane, Pietersburg Veterinary Clinic Beef: 3 North West Christiana, Christiana Dierehospitaal Beef: 1 Leeudoringstad, Leeudoringstad Dierekliniek Beef: 3 Thirteen out of 25 animals bought in. Lichtenburg, Dr CM Kruger-Rall Beef: 3 Stella, Stella Dierekliniek Beef: 3 New farm, bought in animals Free State Bethlehem, Freestate Bethlehem SV Dairy: 3 Still a big problem in the area. Not all farmers are testing their animals. If there are positive animals in the herd, control measures are not applied. Clocolan, Clocolan Dierekliniek Beef: 2 Dewetsdorp, Platkop Dierekliniek Beef: 2 Infected herd, 3 new cases Hertzogville, Hertzogville Dierekliniek Beef: 1 Positive herd Hoopstad, Hoopstad Dierekliniek Beef: 3 Smithfield, Freestate Smithfield SV Beef: 1 One outbreak, 2 cases - slaughtered Villiers, Wilgepoort Dierekliniek Vennootskap Beef: 3 Wesselsbron, Wesselsbron Dierekliniek Beef: 2 Winburg, Winburg Dierekliniek Beef: 2
Kwazulu-Natal Dundee, Endumeni Herd health Beef: 2 Kokstad, E.G.Veterinary Services Beef: 2 Eastern Cape Graaff-Reinet, Graaff Reinet Veterinary Clinic Beef: 1 Queenstown, Queenstown Veterinary clinic Sheep: 2 Northern Cape Kuruman, Lea Shuda CSS Vet Beef: 3
Brucella ovis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.7 (3) 2.0 (1) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 2.7 (3) 2.0 (1) 3.0 (1)
Free State Frankfort, Frankfort Dierekliniek Sheep: 3 Gariepdam, Gariep Dierekliniek Sheep: 2 Rams in the Burgersdorp area Villiers, Wilgepoort Dierekliniek Vennootskap Sheep: 3 Western Cape Swellendam, Swellendam Dierehospitaal Sheep: 2 Northern Cape Calvinia, Calvinia Veeartskliniek Sheep: 3
Johne`s disease ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 1.0 (1) Western Cape Caledon, Overberg Veterinary Hospital Sheep: 1
Leptospirosis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1)
Free State Ladybrand, Ladybrand / Excelsior Dierekliniek Beef: 2 Picked up at AI station
E.coli ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.5 (2) 1.0 (1) 3.0 (1) 2.2 (6)
2.7 (13) 2.0 (5) 2.3 (3) 1.5 (2) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.5 (2) 1.0 (1) 3.0 (1) 2.3 (3)
2.7 (7) 1.3 (3) 1.0 (1)
Dairy 3.0 (1) 3.0 (2) 2.0 (1)
Sheep 2.0 (3)
2.6 (5) 2.3 (3)
Goat 2.0 (1) Mpumalanga Balfour, Balfour Dierekliniek Beef: 2 Middelburg , Middelburg Dierehospitaal Beef: 1 Gauteng Pretoria, Anima Veterinary Consulting Rooms Beef: 1 Limpopo Makhado, Blouberg Dierekliniek Beef: 3 Twelve cases North West Christiana, Christiana Dierehospitaal Sheep: 1 Klerksdorp, Klerksdorp Dierehospitaal Beef: 1 Leeudoringstad, Leeudoringstad Dierekliniek Beef: 3 Calves Sheep: 2 Lambs
Ventersdorp, Buffelsvlei Dierekliniek Beef: 3, Sheep: 3 Free State Bethlehem, Bethlehem Animal Hospital Beef: 2 Calves Sheep: 2 Lambs Clocolan, Clocolan Dierekliniek Beef: 3, Dairy: 3, Sheep: 3 Hoopstad, Hoopstad Dierekliniek Sheep: 3 Kroonstad, Kroonstad Dierehospitaal Beef: 3, Sheep: 3 Ladybrand, Ladybrand / Excelsior Dierekliniek Beef: 3 calves age 1-2 weeks Parys, Parys Dierehospitaal Sheep: 2 Viljoenskroon, Viljoenskroon Dierekliniek Beef: 3 Vrede, Vrede Dierehospitaal Beef: 2 Winburg, Winburg Dierekliniek Beef: 3 Kwazulu-Natal Bergville, Tugela Vet Clinic Beef: 1 Estcourt, Estcourt Vet Clinic Dairy: 3 Howick, Howick Veterinary Clinic Dairy: 3 Kokstad, E.G.Veterinary Services Beef: 1 Underberg, Underberg Veterinary Surgery Beef: 2 Eastern Cape Aliwal North, Hertzogbrug Dierekliniek Sheep: 2 Cradock, Cradock Veterinary Clinic Sheep: 2 Middelburg (EC), Steynsburg Dierehospitaal Sheep: 3 Neonatal E. coli infections: large number of deaths, widespread in at least 5 flocks. The outbreaks are uncommon in sheep on veld. Historically occurring under intensive conditions. Western Cape Caledon, Overberg Veterinary Hospital Beef: 1 Swellendam, Swellendam Dierehospitaal Dairy: 2 Northern Cape Kathu, Kathu Dierekliniek Goat: 2
Enzootic Abortion ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 2.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 2.0 (1) 2.0 (2) Western Cape Beaufort West, Beaufort West State Vet Sheep: 2 Northern Cape Kuruman, Lea Shuda CSS Vet Sheep: 2 Philipstown, Rowelsfontein veearts Spreekkamer Sheep: 2
Dermatophilosis (Lumpy Wool) ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 3.0 (1) Kwazulu-Natal Kokstad, E.G.Veterinary Services Sheep: 3
Intrauterine Gangrene ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 1.0 (1) Northern Cape Kuruman, Kuruman Dierekliniek Sheep: 1
Bovine Dermatophilosis (Senkobo disease) ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 3.0 (1) Mpumalanga Nelspruit, Nelspruit Animal Hospital Beef: 2
Kwazulu-Natal Howick, Howick Veterinary Clinic Beef: 3
Other ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 1.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 1.0 (1) Goat 1.0 (1) Western Cape Plettenberg Bay, Plettenberg Bay A Reitz Beef: 2 Two calves with suspected Corynebacterium diptheriae - not confirmed Northern Cape Kimberley, Kimberley Dierekliniek Beef: 1 Clostridial infection Goat: 1 Suspected clostridial disease
Protozoal diseases (other)
Coccidiosis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.5 (2) 3.0 (1) 1.5 (2)
2.0 (6) 2.0 (6) 2.3 (4) 1.0 (2) 2.5 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 3.0 (1) 1.0 (1) 1.5 (2) 1.0 (1) 2.0 (1)
Dairy 2.0 (1) 2.5 (2) 3.0 (1)
Sheep 1.0 (1) 2.0 (1)
2.3 (4) 2.0 (1) 1.0 (1)
Goat 2.0 (1) 1.0 (1) 2.0 (1) 2.5 (2) 1.0 (1) 3.0 (1)
Mpumalanga Nelspruit, Nelspruit Animal Hospital Goat: 2 Standerton, Econovet Sheep: 1 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 3 North West
Christiana, Christiana Dierehospitaal Beef: 1 Lichtenburg, Dr CM Kruger-Rall Sheep: 2 Free State Bethlehem, Bethlehem Animal Hospital Sheep: 2 Frankfort, Frankfort Dierekliniek Sheep: 3 Ladybrand, Ladybrand / Excelsior Dierekliniek Sheep: 1 Reitz, Riemland Dierehospitaal Dairy: 2 Villiers, Wilgepoort Dierekliniek Vennootskap Sheep: 3 Wesselsbron, Wesselsbron Dierekliniek Goat: 1 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Dundee, Endumeni Herd health Sheep: 2 Estcourt, Estcourt Vet Clinic Dairy: 2 Howick, Howick Veterinary Clinic Dairy: 3 Mtubatuba, Mtubatuba Animal Clinic Beef: 1, Goat: 2 Eastern Cape Bathurst, Dr Jane Pistorius Goat: 3 Graaff-Reinet, Graaff Reinet Veterinary Clinic Goat: 2 Jeffreys Bay, Cape Cross Veterinary Hospital Dairy: 3 Witelsbos, Witelsbos Veterinary Consulting Rooms Beef: 1 Western Cape Beaufort West, Beaufort West State Vet Sheep: 1 Oudtshoorn, Oudtshoorn Dierekliniek Goat: 1 Northern Cape Kathu, Kathu Dierekliniek Goat: 3 Kuruman, Kuruman Dierekliniek Beef: 2
Cryptosporidium ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.3 (3) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 3.0 (1)
Dairy 1.0 (1)
Sheep 3.0 (1) 1.0 (1)
Free State Clocolan, Clocolan Dierekliniek Beef: 3, Dairy: 1, Sheep: 3 Kwazulu-Natal Bergville, Tugela Vet Clinic Sheep: 1
Fungal diseases
Ringworm ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 1.0 (1) 2.0 (1)
3.0 (1) 2.0 (4) 1.0 (3) 2.5 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 2.0 (1)
3.0 (1) 2.0 (4) 1.0 (3)
Sheep 2.0 (1) 3.0 (1) Goat 2.0 (1) Gauteng Pretoria, Anima Veterinary Consulting Rooms Sheep: 2 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 1 North West Christiana, Christiana Dierehospitaal Beef: 2 Free State Frankfort, Frankfort Dierekliniek Beef: 3 Kwazulu-Natal Estcourt, Estcourt Vet Clinic Beef: 1 Mtubatuba, Mtubatuba Animal Clinic Beef: 1 Pietermaritzburg, Richmond Veterinay Clinic Beef: 3 Underberg, Underberg Veterinary Surgery Beef: 3 Western Cape Caledon, Caledon Dierekliniek Beef: 1 Oudtshoorn, Oudtshoorn Dierekliniek Beef: 1
Stellenbosch, Stellenbosch Animal Hospital Beef: 1 Northern Cape Kuruman, Kuruman Dierekliniek Sheep: 3, Goat: 2
Viral Diseases (other)
BMC (snotsiekte) ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.5 (2) 2.0 (1) 1.5 (2)
1.0 (2) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.5 (2) 2.0 (1) 1.5 (2)
1.0 (2) 2.0 (1)
Mpumalanga Balfour, Balfour Dierekliniek Beef: 1 Middelburg , Middelburg Dierehospitaal Beef: 2 Limpopo Makhado, Blouberg Dierekliniek Beef: 2 Five cases North West Klerksdorp, Klerksdorp Dierehospitaal Beef: 2 Rustenburg, Bergbos Dierekliniek Beef: 1 Free State Hoopstad, Hoopstad Dierekliniek Beef: 1 Reitz, Riemland Dierehospitaal Beef: 1 Western Cape Stellenbosch, Stellenbosch Animal Hospital Beef: 2 Both PCR positive [wildebeest associated] on one farm. Brought in wildebeest two months ago.
Rabies ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (2)
1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (2)
1.0 (1)
North West Lichtenburg, Dr CM Kruger-Rall Beef: 1 Stella, Stella Dierekliniek Beef: 1 Rabies on the increase. State only vaccinate dogs and cats. Previously cattle were also vaccinated. Free State Smithfield, Freestate Smithfield SV Beef: 1
BVD (Bovine viral diarrhoea) ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1)
North West Klerksdorp, Klerksdorp Dierehospitaal Beef: 1
IBR (Infectious bovine rhinotracheitis) ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.3 (3) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.3 (3) Dairy 1.0 (1) Kwazulu-Natal Dundee, Endumeni Herd health Beef: 2 Kokstad, E.G.Veterinary Services Beef: 2 Pietermaritzburg, Richmond Veterinay Clinic Beef: 3 Western Cape Heidelberg (WC), Heidelberg Dierekliniek Dairy: 1
Enzootic Bovine Leucosis (EBL) ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 1.5 (2) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 1.5 (2)
Dairy 3.0 (1) North West Lichtenburg, Dr CM Kruger-Rall Beef: 1 Kwazulu-Natal Pongola, Pongola Animal Clinic Beef: 1 Underberg, Underberg Veterinary Surgery Beef: 2 Eastern Cape Jeffreys Bay, Cape Cross Veterinary Hospital Dairy: 3
Jaagsiekte ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 1.0 (1)
Free State Smithfield, Freestate Smithfield SV Sheep: 1 One outbreak, three cases
Orf ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (2) 1.0 (1) 1.0 (2)
3.0 (1) 2.2 (6) 2.0 (1) 3.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 2.0 (1) 1.0 (2) 2.0 (2) 3.0 (1) 2.0 (1)
Goat 2.0 (1) 1.0 (1) 3.0 (1) 2.3 (4) 2.0 (1)
Gauteng Pretoria, Anima Veterinary Consulting Rooms Sheep: 2, Goat: 2 Limpopo Polokwane, Pietersburg Veterinary Clinic Goat: 1
North West Christiana, Christiana Dierehospitaal Sheep: 1 Ventersdorp, Buffelsvlei Dierekliniek Sheep: 1 Free State Parys, Parys Dierehospitaal Goat: 3 Kwazulu-Natal Eshowe, Eshowe Veterinary Hospital Sheep: 3, Goat: 3 Estcourt, Estcourt Vet Clinic Goat: 2 Mtubatuba, Mtubatuba Animal Clinic Goat: 2 Pongola, Pongola Animal Clinic Goat: 2 Underberg, Underberg Veterinary Surgery Sheep: 1 Eastern Cape Graaff-Reinet, Graaff Reinet Veterinary Clinic Goat: 2 Western Cape George, George Animal Hospital Sheep: 3 Northern Cape Kuruman, Kuruman Dierekliniek Sheep: 2
Warts ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (4) 1.0 (1) 1.0 (1) 2.0 (1)
1.3 (3) 2.0 (4) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (4) 1.0 (1) 1.0 (1) 2.0 (1)
1.3 (3) 2.0 (4) 2.0 (1)
Mpumalanga Balfour, Balfour Dierekliniek Beef: 1 Grootvlei, Grootvlei Dierekliniek Beef: 1 Nelspruit, Nelspruit Animal Hospital Beef: 1 Volksrust, Cape Cross Volksrust Dierehospitaal Beef: 1 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 1 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 1 North West Christiana, Christiana Dierehospitaal
Beef: 2 Free State Clocolan, Clocolan Dierekliniek Beef: 2 Ficksburg, Oosvrystaat Diere Produkte Beef: 1 Hoopstad, Hoopstad Dierekliniek Beef: 1 Kwazulu-Natal Dundee, Endumeni Herd health Beef: 2 Estcourt, Estcourt Vet Clinic Beef: 2 Howick, Howick Veterinary Clinic Beef: 2 Mtubatuba, Mtubatuba Animal Clinic Beef: 2 Western Cape George, George Animal Hospital Beef: 2
Poisonings (Plant) and Fungal
Cardiac glycoside poisoning ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 3.0 (2) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 3.0 (2) 3.0 (1)
North West Lichtenburg, Dr CM Kruger-Rall Sheep: 3 Slangkop Stella, Stella Dierekliniek Sheep: 3 Slangkop poisoning Western Cape Beaufort West, Beaufort West State Vet Sheep: 3 Severe drought makes development of this condition favorable all over the Karoo
Cestrum ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 2.0 (1)
Mpumalanga Balfour, Balfour Dierekliniek Beef: 1 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 2
Cynanchum poisoning ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) Western Cape Caledon, Overberg Veterinary Hospital Beef: 1
Facial eczema ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1)
Free State Wesselsbron, Wesselsbron Dierekliniek Beef: 1
Geeldikkop/Dikoor ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 2.0 (1)
Free State Villiers, Wilgepoort Dierekliniek Vennootskap Sheep: 2
Gifblaar ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek
Beef: 2
Lantana ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 1.3 (3)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 1.5 (2) Dairy 1.0 (1) Mpumalanga Nelspruit, Nelspruit Animal Hospital Beef: 2 Animals from Belfast Highveld Kwazulu-Natal Dundee, Endumeni Herd health Beef: 2 Estcourt, Estcourt Vet Clinic Beef: 1, Dairy: 1
Nenta poisoning (Krimpsiekte) ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (3)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) Sheep 1.0 (1) Goat 1.0 (1) Western Cape Oudtshoorn, Ostrimed Beef: 1 Dry veld conditions Sheep: 1, Goat: 1
Nitrate poisoning ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) Limpopo Bela-Bela, Warmbad Dierekliniek Beef: 1 Bull
Prussic acid poisoning ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 2.0 (1) 1.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 1.0 (1) Sheep 1.0 (1) 1.0 (1) Mpumalanga Bethal, Bethal Dierekliniek Sheep: 1 Limpopo Bela-Bela, Warmbad Dierekliniek Beef: 2 Seven cows Eastern Cape Middelburg (EC), Steynsburg Dierehospitaal Beef: 1 Queenstown, Queenstown Veterinary clinic Sheep: 1
Seneciosis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 2.3 (3)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 2.5 (2)
Sheep 2.0 (1) Free State Memel, Memel Veterinary Clinic Beef: 2 Kwazulu-Natal
Estcourt, Estcourt Vet Clinic Beef: 3 Kokstad, E.G.Veterinary Services Beef: 2, Sheep: 2
Tulip Poisoning ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (3) 2.0 (1) 1.5 (2) 1.3 (3)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (3) 2.0 (1) 1.5 (2) 1.3 (3)
Mpumalanga Balfour, Balfour Dierekliniek Beef: 1 Bethal, Bethal Dierekliniek Beef: 2 Standerton, Econovet Beef: 3 Free State Vrede, Vrede Dierehospitaal Beef: 2 Kwazulu-Natal Dundee, Endumeni Herd health Beef: 1 Mooi River, Mooirivier Vet Clinic Beef: 2 Eastern Cape Graaff-Reinet, Graaff Reinet Veterinary Clinic Beef: 2 Middelburg (EC), Steynsburg Dierehospitaal Beef: 1 Uitenhage, Uitenhage Dierehospitaal Beef: 1
Vermeersiekte (Gaigeria spp.) ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 2.0 (2) Northern Cape Kuruman, Lea Shuda CSS Vet Sheep: 2 Philipstown, Rowelsfontein veearts Spreekkamer Sheep: 2
Diplodiosis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 1.0 (1)
Free State Hoopstad, Hoopstad Dierekliniek Sheep: 1
Other ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 2.0 (1) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1)
Sheep 1.0 (1) 3.0 (1)
Free State Ladybrand, Ladybrand / Excelsior Dierekliniek Sheep: 1 ruptured gut from fruit obstruction Eastern Cape Cradock, Cradock Veterinary Clinic Beef: 2 Ganskweek poisoning in the Karoo - first time seen Western Cape Beaufort West, Beaufort West State Vet Sheep: 3 Scholtz bos poisoning
Poisonings
Water contamination ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (2) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) Sheep 1.0 (1) 3.0 (1) Mpumalanga
Balfour, Balfour Dierekliniek Beef: 1 Ermelo, Môregloed Veterinêre Spreekkamer Sheep: 1 Northern Cape Upington, Upington Veterinary Clinic Sheep: 3 Water quality poor due to drought
Urea Poisoning ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (2) 1.5 (2) 2.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (2) 1.5 (2)
Sheep 2.0 (2) Free State Clocolan, Clocolan Dierekliniek Beef: 2 Memel, Memel Veterinary Clinic Beef: 2 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Bergville, Tugela Vet Clinic Beef: 1 Eastern Cape Graaff-Reinet, Graaff Reinet Veterinary Clinic Sheep: 2 Middelburg (EC), Steynsburg Dierehospitaal Sheep: 2
Snake Bite ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 1.0 (3) 1.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 1.0 (3) 1.0 (1)
Sheep 1.0 (1) Mpumalanga Bushbuckridge, Dr Martin Jansen CSS Vet Beef: 1 Free State Bultfontein, Greylingsrust Dierespreekkamer
Beef: 1 Clocolan, Clocolan Dierekliniek Beef: 1 Vrede, Vrede Dierehospitaal Beef: 1 Kwazulu-Natal Dundee, Endumeni Herd health Beef: 1 Kokstad, E.G.Veterinary Services Sheep: 1
Other ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 3.0 (1) Mpumalanga Nelspruit, Nelspruit Animal Hospital Beef: 3 Broiler farm lost 55 000 10-day old chicks due to increased salinity of drinking water (Na and Cl levels 5 fold increased): surface dams ran low in water levels and sludge was pumped to reservoir tanks. Dilution with fresh water was inadequate due to low river levels.
Macro Nutritional Problems
Energy deficiency ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 3.0 (3) 3.0 (2)
2.4 (5) 1.9 (8) 2.6 (5) 2.9 (11)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 3.0 (2) 3.0 (2)
2.3 (3) 2.3 (4) 2.5 (2) 3.0 (3)
Dairy 2.0 (1) 2.0 (1)
Sheep 2.5 (2) 1.0 (1) 3.0 (1) 2.8 (5)
Goat 3.0 (1) 1.5 (2) 3.0 (1) 3.0 (3) Mpumalanga Bushbuckridge, Dr Martin Jansen CSS Vet Beef: 2 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 3 Polokwane, Pietersburg Veterinary Clinic Beef: 3, Goat: 3 North West Christiana, Christiana Dierehospitaal
Beef: 3 Stella, Stella Dierekliniek Beef: 3 Free State Smithfield, Freestate Smithfield SV Beef: 3, Sheep: 3 Wesselsbron, Wesselsbron Dierekliniek Beef: 2 Winburg, Winburg Dierekliniek Beef: 2, Sheep: 2 Kwazulu-Natal Dundee, Endumeni Herd health Beef: 3, Dairy: 2 Howick, Howick Veterinary Clinic Beef: 3 Pongola, Pongola Animal Clinic Beef: 1, Sheep: 1, Goat: 1 Underberg, Underberg Veterinary Surgery Beef: 2, Goat: 2 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Beef: 2 Grazing as dry as a bone Dairy: 2 Middelburg (EC), Steynsburg Dierehospitaal Beef: 3, Sheep: 3, Goat: 3 Northern Cape De Aar, De Aar Veterinary Clinic Sheep: 3 Cachexia (watery carcasses at abattoir), drought Kathu, Kathu Dierekliniek Sheep: 2 Kuruman, Kuruman Dierekliniek Beef: 3, Sheep: 3, Goat: 3 Postmasburg, Postmasburg Dierekliniek Beef: 3 Severe drought, animals unable to stand, animals dying. Sheep: 3, Goat: 3 Upington, Upington Veterinary Clinic Beef: 3, Sheep: 3, Goat: 3
Protein deficiency ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 2.5 (2) 3.0 (4)
2.7 (3) 1.8 (6) 3.0 (3) 3.0 (10)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 2.5 (2) 3.0 (3)
2.5 (2) 2.3 (3) 3.0 (1) 3.0 (3)
Dairy 2.0 (1)
Sheep 3.0 (1)
3.0 (1) 1.0 (1) 3.0 (1) 3.0 (4)
Goat 1.0 (1) 3.0 (1) 3.0 (3)
Mpumalanga Bushbuckridge, Dr Martin Jansen CSS Vet Beef: 2 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 2 Polokwane, Pietersburg Veterinary Clinic Beef: 3 North West Christiana, Christiana Dierehospitaal Beef: 3 Lichtenburg, Dr CM Kruger-Rall Beef: 3, Sheep: 3 Stella, Stella Dierekliniek Beef: 3 Free State Smithfield, Freestate Smithfield SV Beef: 3, Sheep: 3 Wesselsbron, Wesselsbron Dierekliniek Beef: 2 Kwazulu-Natal Dundee, Endumeni Herd health Beef: 3, Dairy: 2 Howick, Howick Veterinary Clinic Beef: 3 Pongola, Pongola Animal Clinic Beef: 1, Sheep: 1, Goat: 1 Eastern Cape Middelburg (EC), Steynsburg Dierehospitaal Beef: 3, Sheep: 3, Goat: 3 Northern Cape De Aar, De Aar Veterinary Clinic Sheep: 3 Cachexia (watery carcasses at abattoir), drought Kuruman, Kuruman Dierekliniek Beef: 3, Sheep: 3, Goat: 3 Postmasburg, Postmasburg Dierekliniek Beef: 3 Severe drought, animals unable to stand, animals dying. Sheep: 3, Goat: 3 Upington, Upington Veterinary Clinic Beef: 3, Sheep: 3, Goat: 3
Phosphate deficiency ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 3.0 (1) 2.0 (1) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 3.0 (1) 3.0 (1)
Dairy 2.0 (1) North West Christiana, Christiana Dierehospitaal
Beef: 3 Eastern Cape Humansdorp, Humansdorp Veterinary Clinic Dairy: 2 Calcium:Phosphate imbalance Northern Cape Kuruman, Lea Shuda CSS Vet Beef: 3
Calcium deficiency ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 3.0 (1) 1.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Dairy 2.0 (1) 3.0 (1) 1.0 (1)
Sheep 2.0 (1) Free State Ficksburg, Oosvrystaat Diere Produkte Dairy: 2 Kwazulu-Natal Howick, Howick Veterinary Clinic Dairy: 3 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Dairy: 1 Northern Cape Philipstown, Rowelsfontein veearts Spreekkamer Sheep: 2
Micro Nutritional Problems
Copper deficiency ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 1.0 (1) 1.0 (1) 1.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) Sheep 1.0 (1) 2.0 (1) Goat 1.0 (1) 1.0 (1) Mpumalanga Middelburg , Middelburg Dierehospitaal Goat: 1 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 1 Eastern Cape
Uitenhage, Uitenhage Dierehospitaal Goat: 1 Western Cape Stellenbosch, Stellenbosch Animal Hospital Sheep: 1 Northern Cape De Aar, De Aar Veterinary Clinic Sheep: 2 Geelsiekte seen at abattoir
Zinc deficiency ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) Sheep 1.0 (1) Eastern Cape Humansdorp, Humansdorp Veterinary Clinic Beef: 2 Western Cape Stellenbosch, Stellenbosch Animal Hospital Sheep: 1
Selenium deficiency ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 3.0 (4) 2.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 3.0 (1) 2.0 (1) Dairy 3.0 (1)
Sheep 2.0 (1) 3.0 (1) 2.0 (1)
Goat 3.0 (1) North West Christiana, Christiana Dierehospitaal Sheep: 2 Kwazulu-Natal Estcourt, Estcourt Vet Clinic Beef: 3, Dairy: 3, Sheep: 3, Goat: 3 Eastern Cape Humansdorp, Humansdorp Veterinary Clinic Beef: 2 Western Cape Caledon, Caledon Dierekliniek Sheep: 2
Magnesium deficiency ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1)
Free State Ladybrand, Ladybrand / Excelsior Dierekliniek Beef: 1
Vitamin A deficiency ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (2) 2.0 (1) 2.0 (2)
3.0 (2) 3.0 (3) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 2.0 (1) 2.0 (2)
3.0 (1) 3.0 (1) 3.0 (1)
Sheep 2.0 (1) 3.0 (1) 3.0 (1)
Goat 3.0 (1) Mpumalanga Volksrust, Cape Cross Volksrust Dierehospitaal Beef: 2, Sheep: 2 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 2 North West Christiana, Christiana Dierehospitaal Beef: 3 Lichtenburg, Dr CM Kruger-Rall Beef: 1 Free State Hoopstad, Hoopstad Dierekliniek Beef: 3, Sheep: 3 Eastern Cape Middelburg (EC), Steynsburg Dierehospitaal Beef: 3, Sheep: 3, Goat: 3 Northern Cape Kuruman, Kuruman Dierekliniek Beef: 3
Vitamin B deficiency ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 2.0 (1)
Goat 1.0 (1) Free State Reitz, Riemland Dierehospitaal Sheep: 2 Kwazulu-Natal Camperdown, Camperdown Vet Clinic Goat: 1
Multi-factorial Disease Conditions
Abortions ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 2.0 (2) 2.0 (1) 2.0 (2)
2.5 (4) 1.9 (11) 1.0 (2) 2.3 (3) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 2.0 (1) 2.0 (1) 2.0 (2)
2.5 (2) 1.9 (7) 1.0 (1) 3.0 (1)
Dairy 2.0 (3) 1.0 (1) 2.3 (3)
Sheep 2.0 (1) 2.5 (2) 2.0 (1)
Mpumalanga Balfour, Balfour Dierekliniek Beef: 2 Gauteng Pretoria, Anima Veterinary Consulting Rooms Beef: 2, Sheep: 2 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 2 North West Christiana, Christiana Dierehospitaal Beef: 2 Lichtenburg, Dr CM Kruger-Rall Beef: 2 Free State Hoopstad, Hoopstad Dierekliniek Beef: 3, Sheep: 3 Reitz, Riemland Dierehospitaal Beef: 2 Winburg, Winburg Dierekliniek
Sheep: 2 Kwazulu-Natal Bergville, Tugela Vet Clinic Beef: 1 Dundee, Endumeni Herd health Beef: 2 Howick, Howick Veterinary Clinic Beef: 3, Dairy: 3, Sheep: 2 Kokstad, E.G.Veterinary Services Beef: 3 Mooi River, Mooirivier Vet Clinic Beef: 2, Dairy: 2 Mtubatuba, Mtubatuba Animal Clinic Beef: 1 Underberg, Underberg Veterinary Surgery Beef: 1, Dairy: 1 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Dairy: 1 Uitenhage, Uitenhage Dierehospitaal Beef: 1 Western Cape Heidelberg (WC), Heidelberg Dierekliniek Dairy: 2 Malmesbury, Dr Otto Kriek Dairy: 2 Swellendam, Swellendam Dierehospitaal Dairy: 3 Northern Cape Kuruman, Lea Shuda CSS Vet Beef: 3
Stillbirths ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 2.0 (1) 2.3 (3) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 2.0 (1) 3.0 (1)
Dairy 2.0 (1) 2.0 (1) Sheep 2.0 (1) Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 1 Free State Clocolan, Clocolan Dierekliniek Beef: 2 Kwazulu-Natal Howick, Howick Veterinary Clinic Dairy: 2, Sheep: 2 Kokstad, E.G.Veterinary Services Beef: 3
Western Cape Swellendam, Swellendam Dierehospitaal Dairy: 2
Abscesses ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.3 (4) 1.5 (2) 1.3 (3) 2.0 (2)
2.0 (8) 2.0 (6) 2.0 (1) 1.6 (5) 1.7 (3)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.3 (3) 1.0 (1) 1.0 (2) 2.0 (1)
2.3 (3) 2.0 (3) 1.5 (2)
Dairy 1.0 (1) 3.0 (1) 1.0 (1)
Sheep 1.0 (1) 2.0 (1) 2.0 (1) 2.0 (4) 2.0 (1) 1.5 (2)
Goat 2.0 (1) 1.5 (2) 2.0 (1) 2.0 (1) 2.0 (1)
Mpumalanga Balfour, Balfour Dierekliniek Beef: 1 Grootvlei, Grootvlei Dierekliniek Beef: 1 Middelburg , Middelburg Dierehospitaal Sheep: 1 Nelspruit, Nelspruit Animal Hospital Beef: 2 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 1 Pretoria, Anima Veterinary Consulting Rooms Sheep: 2 Limpopo Bela-Bela, Warmbad Dierekliniek Sheep: 2 Mokopane, Potgietersrus Dierekliniek Beef: 1 Polokwane, Pietersburg Veterinary Clinic Beef: 1 North West Vryburg, Vryburg Dierehospitaal Beef: 2, Goat: 2 Free State Bultfontein, Greylingsrust Dierespreekkamer Beef: 2 Clocolan, Clocolan Dierekliniek Beef: 2 Hoopstad, Hoopstad Dierekliniek Beef: 3, Sheep: 3 Vrede, Vrede Dierehospitaal Sheep: 2 Wesselsbron, Wesselsbron Dierekliniek
Dairy: 1, Sheep: 1 Winburg, Winburg Dierekliniek Sheep: 2 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Bergville, Tugela Vet Clinic Goat: 1 Estcourt, Estcourt Vet Clinic Beef: 2, Goat: 2 Howick, Howick Veterinary Clinic Dairy: 3 Pietermaritzburg, Richmond Veterinay Clinic Beef: 2 Eastern Cape Graaff-Reinet, Graaff Reinet Veterinary Clinic Goat: 2 Western Cape Oudtshoorn, Ostrimed Beef: 2, Sheep: 2, Goat: 2 Stellenbosch, Stellenbosch Animal Hospital Beef: 1, Dairy: 1 Northern Cape Kuruman, Kuruman Dierekliniek Sheep: 2, Goat: 2 Philipstown, Rowelsfontein veearts Spreekkamer Sheep: 1
Abscesses in general ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 2.0 (2) 2.0 (5) 1.5 (2) 2.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (2) 1.0 (1) Dairy 2.0 (1) 2.0 (2)
Sheep 2.0 (2) 2.0 (1) 2.0 (1)
Goat 2.0 (1) 2.0 (1) Gauteng Pretoria, Dr Rosaly Steyn (LNR) CSS vet Dairy: 2 Free State Memel, Memel Veterinary Clinic Sheep: 2 Reitz, Riemland Dierehospitaal Sheep: 2 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Dundee, Endumeni Herd health Dairy: 1 Howick, Howick Veterinary Clinic
Dairy: 3 Mtubatuba, Mtubatuba Animal Clinic Beef: 2, Goat: 2 Western Cape George, George Animal Hospital Beef: 1, Sheep: 2 Northern Cape Kuruman, Kuruman Dierekliniek Sheep: 2, Goat: 2
Bladder stones ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.7 (3) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 1.7 (3) 1.0 (1)
Free State Clocolan, Clocolan Dierekliniek Sheep: 1 Kroonstad, Kroonstad Dierehospitaal Sheep: 2 Reitz, Riemland Dierehospitaal Sheep: 2 Kwazulu-Natal Mtubatuba, Mtubatuba Animal Clinic Sheep: 1
Blindness ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 2.0 (4) 2.0 (2) 2.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 2.0 (1) Dairy 2.0 (1)
Sheep 2.0 (4) 2.0 (1)
Goat 2.0 (1) Mpumalanga Grootvlei, Grootvlei Dierekliniek Beef: 1 Free State Hoopstad, Hoopstad Dierekliniek Sheep: 3 Kroonstad, Kroonstad Dierehospitaal
Sheep: 2 Vrede, Vrede Dierehospitaal Sheep: 2 Wesselsbron, Wesselsbron Dierekliniek Sheep: 1 Western Cape Heidelberg (WC), Heidelberg Dierekliniek Dairy: 2, Sheep: 2 Northern Cape Kuruman, Kuruman Dierekliniek Beef: 2, Goat: 2
Bloat ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 2.0 (2) 1.7 (3) 2.0 (1) 2.0 (4)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 2.0 (1) 1.0 (1) 2.0 (1)
Dairy 2.0 (1) 3.0 (1)
Sheep 2.0 (1) 2.0 (1) 1.7 (3)
Mpumalanga Grootvlei, Grootvlei Dierekliniek Beef: 2 Free State Bultfontein, Greylingsrust Dierespreekkamer Sheep: 2 Clocolan, Clocolan Dierekliniek Beef: 2 Kwazulu-Natal Camperdown, Camperdown Vet Clinic Beef: 1 Frothy bloat on lush kikuyu Estcourt, Estcourt Vet Clinic Dairy: 2 Mooi River, Mooirivier Vet Clinic Sheep: 2 Eastern Cape Humansdorp, Humansdorp Veterinary Clinic Beef: 2 Western Cape Caledon, Caledon Dierekliniek Sheep: 2 Malmesbury, Dr Otto Kriek Dairy: 3 Some nutritionists use a fair amount of lucerne in calf starter/grower formulations resulting in unnecessary mortalities. Oudtshoorn, Ostrimed Sheep: 2 Protein bloat Wellington, Wellington Dierehospitaal
Sheep: 1 Frothy bloat, one farm
Blue udder ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.6 (7) 1.0 (1) 2.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Dairy 1.0 (1) 1.0 (1) 2.0 (1)
Sheep 1.7 (6) 2.0 (1)
Free State Clocolan, Clocolan Dierekliniek Dairy: 1, Sheep: 1 Ficksburg, Oosvrystaat Diere Produkte Sheep: 1 Hoopstad, Hoopstad Dierekliniek Sheep: 3 Ladybrand, Ladybrand / Excelsior Dierekliniek Sheep: 2 Reitz, Riemland Dierehospitaal Sheep: 2 Wesselsbron, Wesselsbron Dierekliniek Sheep: 1 Kwazulu-Natal Mooi River, Mooirivier Vet Clinic Dairy: 1 Eastern Cape Graaff-Reinet, Graaff Reinet Veterinary Clinic Sheep: 2 Western Cape Stellenbosch, Stellenbosch Animal Hospital Dairy: 2
Diarrhoea ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.5 (2) 2.0 (2) 2.8 (6)
2.7 (17) 2.0 (10) 1.0 (1) 1.5 (2) 1.5 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.5 (2) 3.0 (1) 2.8 (5)
2.7 (10) 1.7 (3) 1.0 (1) 1.5 (2)
Dairy 2.5 (2) 2.5 (2) 1.0 (1) 2.0 (1)
Sheep 3.0 2.8 2.0 (2)
(1) (5) Goat 1.0 (1) 2.0 (3) Mpumalanga Grootvlei, Grootvlei Dierekliniek Beef: 1 Middelburg , Middelburg Dierehospitaal Beef: 2 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 3 Calves Pretoria, Dr Rosaly Steyn (LNR) CSS vet Goat: 1 North West Christiana, Christiana Dierehospitaal Beef: 3 Klerksdorp, Klerksdorp Dierehospitaal Beef: 2 Stella, Stella Dierekliniek Beef: 3 Ventersdorp, Buffelsvlei Dierekliniek Beef: 3, Sheep: 3 Vryburg, Vryburg Dierehospitaal Beef: 3 Free State Bultfontein, Greylingsrust Dierespreekkamer Beef: 2, Sheep: 3 Most lambs test positive on the BOVID test strip for Cryptosporidium. Clocolan, Clocolan Dierekliniek Beef: 3, Dairy: 3, Sheep: 3 Harrismith, Harrismith Dierehospitaal Beef: 3 Kroonstad, Kroonstad Dierehospitaal Beef: 2, Sheep: 3 Ladybrand, Ladybrand / Excelsior Dierekliniek Beef: 3 Calves suspect E.coli Memel, Memel Veterinary Clinic Beef: 3 Parys, Parys Dierehospitaal Sheep: 3 Reitz, Riemland Dierehospitaal Beef: 3, Sheep: 2 Viljoenskroon, Viljoenskroon Dierekliniek Beef: 3 Vrede, Vrede Dierehospitaal Beef: 3, Dairy: 2 Winburg, Winburg Dierekliniek Beef: 2 Kwazulu-Natal Bergville, Tugela Vet Clinic Beef: 2, Sheep: 2, Goat: 2 Estcourt, Estcourt Vet Clinic Beef: 2, Sheep: 2, Goat: 3 Howick, Howick Veterinary Clinic Dairy: 3 Pongola, Pongola Animal Clinic Beef: 1, Goat: 1 Underberg, Underberg Veterinary Surgery
Dairy: 2 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Dairy: 1 Western Cape Caledon, Overberg Veterinary Hospital Beef: 1 Swellendam, Swellendam Dierehospitaal Dairy: 2 Northern Cape Kathu, Kathu Dierekliniek Beef: 1 Kuruman, Kuruman Dierekliniek Beef: 2
Epididymitis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) Northern Cape Kuruman, Kuruman Dierekliniek Beef: 2
Eye Cancer ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.3 (4) 2.0 (2) 2.0 (1) 1.5 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (2) 1.0 (1) 2.0 (1)
Dairy 2.0 (1) 3.0 (1) 2.0 (1)
Sheep 1.0 (1) 1.0 (1)
Free State Hoopstad, Hoopstad Dierekliniek Beef: 1, Sheep: 1 Reitz, Riemland Dierehospitaal Dairy: 2 Vrede, Vrede Dierehospitaal Beef: 1 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 1 Howick, Howick Veterinary Clinic
Dairy: 3 Western Cape Swellendam, Swellendam Dierehospitaal Dairy: 2 Northern Cape Kuruman, Kuruman Dierekliniek Beef: 2 Kuruman, Lea Shuda CSS Vet Sheep: 1
Eye infections ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.8 (10) 2.3 (3) 2.0 (1) 2.4 (8)
2.3 (18) 2.5 (14) 2.4 (5) 1.7 (10) 1.5 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (5) 2.5 (2) 2.0 (1) 2.4 (5)
2.3 (12) 2.5 (6) 2.0 (1) 1.6 (5) 2.0 (1)
Dairy 2.0 (1) 2.0 (1) 3.0 (4) 2.5 (2) 2.3 (3) 1.0 (1)
Sheep 1.7 (3) 2.0 (2)
2.4 (5) 3.0 (1) 2.5 (2) 1.0 (2)
Goat 1.5 (2) 3.0 (1) 1.7 (3)
Mpumalanga Balfour, Balfour Dierekliniek Beef: 1, Sheep: 1, Goat: 1 Grootvlei, Grootvlei Dierekliniek Beef: 2 Nelspruit, Nelspruit Animal Hospital Beef: 3, Goat: 2 Standerton, Econovet Beef: 2, Sheep: 2 Volksrust, Cape Cross Volksrust Dierehospitaal Beef: 2, Sheep: 2 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 2 Pretoria, Anima Veterinary Consulting Rooms Beef: 3 Pretoria, Dr Rosaly Steyn (LNR) CSS vet Dairy: 2 Limpopo Polokwane, Pietersburg Veterinary Clinic Beef: 2 North West Christiana, Christiana Dierehospitaal Beef: 3 Klerksdorp, Klerksdorp Dierehospitaal Beef: 1, Sheep: 1 Lichtenburg, Dr CM Kruger-Rall Beef: 3
Ventersdorp, Buffelsvlei Dierekliniek Beef: 2 Vryburg, Vryburg Dierehospitaal Beef: 3, Sheep: 3, Goat: 3 Free State Bultfontein, Greylingsrust Dierespreekkamer Beef: 1 Clocolan, Clocolan Dierekliniek Beef: 2 Dewetsdorp, Platkop Dierekliniek Beef: 2, Sheep: 2 Ficksburg, Oosvrystaat Diere Produkte Beef: 3 Kroonstad, Kroonstad Dierehospitaal Beef: 2, Sheep: 3 Memel, Memel Veterinary Clinic Beef: 2 Parys, Parys Dierehospitaal Beef: 2 Reitz, Riemland Dierehospitaal Beef: 3, Dairy: 2, Sheep: 2 Viljoenskroon, Viljoenskroon Dierekliniek Beef: 3 Vrede, Vrede Dierehospitaal Beef: 3, Sheep: 3 Wesselsbron, Wesselsbron Dierekliniek Beef: 2, Sheep: 2 Winburg, Winburg Dierekliniek Beef: 3 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 3 Dundee, Endumeni Herd health Beef: 3, Dairy: 3 Estcourt, Estcourt Vet Clinic Dairy: 3, Goat: 2 Howick, Howick Veterinary Clinic Beef: 3, Dairy: 3 Mtubatuba, Mtubatuba Animal Clinic Beef: 2, Goat: 2 Newcastle, Ncanduvet Newcastle Beef: 2 Pietermaritzburg, Richmond Veterinay Clinic Beef: 2 Pongola, Pongola Animal Clinic Goat: 1 Underberg, Underberg Veterinary Surgery Dairy: 3, Sheep: 3 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Dairy: 2 Aliwal North, Hertzogbrug Dierekliniek Beef: 2 Graaff-Reinet, Graaff Reinet Veterinary Clinic Sheep: 2 Jeffreys Bay, Cape Cross Veterinary Hospital Dairy: 3 Middelburg (EC), Steynsburg Dierehospitaal Sheep: 3 Western Cape
Caledon, Caledon Dierekliniek Beef: 1 Darling, Darling Dierekliniek Beef: 2, Sheep: 1 Malmesbury, Dr Otto Kriek Dairy: 3 Oudtshoorn, Ostrimed Beef: 1, Sheep: 1 Piketberg, Piketberg Dierehospitaal Beef: 2 Moraxella bovis Stellenbosch, Stellenbosch Animal Hospital Beef: 2, Dairy: 2 Swellendam, Swellendam Dierehospitaal Dairy: 2 Northern Cape Kuruman, Kuruman Dierekliniek Beef: 2 Philipstown, Rowelsfontein veearts Spreekkamer Dairy: 1
Joint Ill ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 2.0 (1)
1.0 (2) 1.5 (2) 2.0 (2) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 2.0 (1)
1.0 (1) 1.5 (2)
Sheep 1.0 (1) 2.0 (1)
Goat 2.0 (1) 1.0 (1) Mpumalanga Balfour, Balfour Dierekliniek Beef: 2 North West Christiana, Christiana Dierehospitaal Beef: 2 Free State Ficksburg, Oosvrystaat Diere Produkte Beef: 1, Sheep: 1 Kwazulu-Natal Kokstad, E.G.Veterinary Services Beef: 1 Pietermaritzburg, Richmond Veterinay Clinic Beef: 2 Eastern Cape Graaff-Reinet, Graaff Reinet Veterinary Clinic Sheep: 2, Goat: 2 Northern Cape Kuruman, Kuruman Dierekliniek Goat: 1
Lameness/Foot Problems ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (2) 2.0 (2) 2.0 (2)
2.2 (6) 2.0 (8) 2.0 (2) 2.0 (3) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (2) 2.0 (1) 2.0 (2)
2.0 (3) 2.0 (3) 3.0 (1)
Dairy 2.0 (1) 2.0 (1) 2.7 (3) 2.0 (2)
Sheep 2.5 (2) 1.0 (1) 2.0 (3)
Goat 1.0 (1) Mpumalanga Balfour, Balfour Dierekliniek Beef: 2 Middelburg , Middelburg Dierehospitaal Beef: 2 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 2 Pretoria, Dr Rosaly Steyn (LNR) CSS vet Dairy: 2 North West Christiana, Christiana Dierehospitaal Beef: 3 Ventersdorp, Buffelsvlei Dierekliniek Beef: 1 Free State Clocolan, Clocolan Dierekliniek Beef: 2 Reitz, Riemland Dierehospitaal Beef: 3, Dairy: 2, Sheep: 3 Viljoenskroon, Viljoenskroon Dierekliniek Sheep: 2 Wesselsbron, Wesselsbron Dierekliniek Beef: 1 Kwazulu-Natal Dundee, Endumeni Herd health Beef: 2 Howick, Howick Veterinary Clinic Beef: 3, Dairy: 3 Mooi River, Mooirivier Vet Clinic Dairy: 2 Newcastle, Ncanduvet Newcastle Beef: 1 Pietermaritzburg, Richmond Veterinay Clinic Dairy: 3 Pongola, Pongola Animal Clinic Sheep: 1, Goat: 1 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer
Dairy: 2 Humansdorp, Humansdorp Veterinary Clinic Dairy: 2 Western Cape Darling, Darling Dierekliniek Sheep: 1 Foot rot George, George Animal Hospital Sheep: 3 Wellington, Wellington Dierehospitaal Sheep: 2 Two farms Northern Cape Kuruman, Lea Shuda CSS Vet Beef: 3
Lung infection ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.7 (3) 1.0 (2) 2.0 (1) 2.0 (4)
1.9 (7) 2.0 (9) 2.0 (4) 2.0 (3) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (2) 1.0 (1) 2.0 (1) 2.0 (4)
1.8 (6) 2.0 (5) 1.0 (1)
Dairy 3.0 (1) 2.0 (1)
Sheep 1.0 (1) 2.0 (1) 2.0 (2) 2.0 (2) 2.5 (2) 2.0 (1)
Goat 1.0 (1) 1.0 (1) 2.0 (1) Mpumalanga Bethal, Bethal Dierekliniek Goat: 1 Middelburg , Middelburg Dierehospitaal Beef: 2 Standerton, Econovet Beef: 2 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 1, Sheep: 1 Limpopo Makhado, Blouberg Dierekliniek Beef: 2 Pasteurellosis North West Christiana, Christiana Dierehospitaal Beef: 1 Klerksdorp, Klerksdorp Dierehospitaal Beef: 3 Leeudoringstad, Leeudoringstad Dierekliniek Beef: 2 Pasteurella multocida - large calves - 6 months old Lichtenburg, Dr CM Kruger-Rall Beef: 2 Free State
Clocolan, Clocolan Dierekliniek Beef: 2, Sheep: 2 Ficksburg, Oosvrystaat Diere Produkte Beef: 1 Kroonstad, Kroonstad Dierehospitaal Beef: 2 Reitz, Riemland Dierehospitaal Beef: 2 Wesselsbron, Wesselsbron Dierekliniek Beef: 2 Winburg, Winburg Dierekliniek Beef: 2 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Bergville, Tugela Vet Clinic Beef: 1, Sheep: 1, Goat: 1 Dundee, Endumeni Herd health Beef: 3 Kokstad, E.G.Veterinary Services Beef: 1 Pietermaritzburg, Richmond Veterinay Clinic Beef: 3 Underberg, Underberg Veterinary Surgery Dairy: 3, Sheep: 3 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Dairy: 2 Aliwal North, Hertzogbrug Dierekliniek Sheep: 2 Uitenhage, Uitenhage Dierehospitaal Sheep: 2 Witelsbos, Witelsbos Veterinary Consulting Rooms Goat: 2 Western Cape Beaufort West, Beaufort West State Vet Sheep: 3 George, George Animal Hospital Sheep: 2 Stellenbosch, Stellenbosch Animal Hospital Beef: 1 Northern Cape Philipstown, Rowelsfontein veearts Spreekkamer Sheep: 2
Mastitis in general ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 1.0 (2) 1.0 (1) 1.8 (5) 2.0 (8) 1.0 (1) 2.8 (4)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 1.0 (1) 1.0 (1) 2.0 (2) 1.3 (3)
Dairy 1.5 2.4 (5) 1.0 (1) 2.8 (4)
(2)
Sheep 1.0 (1) 2.0 (1)
Mpumalanga Balfour, Balfour Dierekliniek Beef: 1 Gauteng Pretoria, Anima Veterinary Consulting Rooms Beef: 1 Pretoria, Dr Rosaly Steyn (LNR) CSS vet Sheep: 1 Limpopo Bela-Bela, Warmbad Dierekliniek Beef: 1 One cow with necro-haemorrhagic mastitis Free State Ficksburg, Oosvrystaat Diere Produkte Dairy: 1 Harrismith, Harrismith Dierehospitaal Beef: 2 Kroonstad, Kroonstad Dierehospitaal Dairy: 2, Sheep: 2 Winburg, Winburg Dierekliniek Beef: 2 Kwazulu-Natal Bergville, Tugela Vet Clinic Beef: 1 Camperdown, Camperdown Vet Clinic Dairy: 1 Dundee, Endumeni Herd health Dairy: 2 Howick, Howick Veterinary Clinic Dairy: 3 Kokstad, E.G.Veterinary Services Beef: 2, Dairy: 3 Mooi River, Mooirivier Vet Clinic Dairy: 3 Pongola, Pongola Animal Clinic Beef: 1 Eastern Cape Humansdorp, Humansdorp Veterinary Clinic Dairy: 1 Western Cape George, George Animal Hospital Dairy: 3 Heidelberg (WC), Heidelberg Dierekliniek Dairy: 2 Malmesbury, Dr Otto Kriek Dairy: 3 DCAD (dietary cation -anion difference) is often neglected for Close-up cows with serious consequences especially with regard to re-conception. Swellendam, Swellendam Dierehospitaal Dairy: 3
Navel Ill ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 2.0 (1)
1.0 (1) 2.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 2.0 (1)
1.0 (1) 2.0 (2)
Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 1 North West Christiana, Christiana Dierehospitaal Beef: 2 Free State Bultfontein, Greylingsrust Dierespreekkamer Beef: 1 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Pietermaritzburg, Richmond Veterinay Clinic Beef: 2
Trauma ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1)
Free State Ladybrand, Ladybrand / Excelsior Dierekliniek Beef: 2
Downer ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 2.0 (1) 1.5 (4) 1.5 (2) 2.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 2.0 (1) 1.5 (2) 1.5 (2) 2.0 (2)
Dairy 1.5 (2)
Mpumalanga Bushbuckridge, Dr Martin Jansen CSS Vet
Beef: 2 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 2 Free State Clocolan, Clocolan Dierekliniek Dairy: 2 Harrismith, Harrismith Dierehospitaal Beef: 2 Ladybrand, Ladybrand / Excelsior Dierekliniek Beef: 1 Vrede, Vrede Dierehospitaal Dairy: 1 Kwazulu-Natal Camperdown, Camperdown Vet Clinic Beef: 1 Obturator paralysis, difficult calving Kokstad, E.G.Veterinary Services Beef: 2 Northern Cape Kuruman, Kuruman Dierekliniek Beef: 2 Kuruman, Lea Shuda CSS Vet Beef: 2
Other ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 1.0 (1) 3.0 (1) Kwazulu-Natal Camperdown, Camperdown Vet Clinic Sheep: 1 Rumen stasis Northern Cape Upington, Upington Veterinary Clinic Sheep: 3 Lambs eat sand, chronic stunted growth, diarrhoea (1,5 to 3 months old). Water quality poor. Wet carcasses at abbatoir - Sheep consumes salt licks, loaded on lorries, transported to abattoir and drink a lot of water. Reduce salt intake before sending sheep to abattoir.
Metabolic Diseases
Acidosis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.8 (4) 2.0 (1) 2.0 (5)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.5 (2) 2.0 (1)
Dairy 2.0 (3)
Sheep 2.0 (2) 2.0 (2)
Free State Clocolan, Clocolan Dierekliniek Beef: 1, Sheep: 2 Hertzogville, Hertzogville Dierekliniek Beef: 2, Sheep: 2 Kwazulu-Natal Dundee, Endumeni Herd health Beef: 2 Western Cape Caledon, Caledon Dierekliniek Sheep: 2 Heidelberg (WC), Heidelberg Dierekliniek Dairy: 2, Sheep: 2 Malmesbury, Dr Otto Kriek Dairy: 3 As mentioned in a previous report, the driver of the feed-mixer has a huge responsibility and he needs to be reminded about that. Poorly mixed feed comes at a huge cost!!! Stellenbosch, Stellenbosch Animal Hospital Dairy: 1
Displaced abomasum ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (2) 2.0 (2) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1)
Dairy 3.0 (1) 2.0 (2) 1.0 (1)
Free State Kroonstad, Kroonstad Dierehospitaal Dairy: 3 Memel, Memel Veterinary Clinic Beef: 1 Kwazulu-Natal Dundee, Endumeni Herd health Dairy: 2 Howick, Howick Veterinary Clinic Dairy: 2 Western Cape Darling, Darling Dierekliniek Dairy: 1
Ketosis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Sheep 2.0 (1)
Goat 2.0 (1) Free State Clocolan, Clocolan Dierekliniek Sheep: 2 Northern Cape Kuruman, Lea Shuda CSS Vet Goat: 2
Milk Fever ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (2) 3.0 (1) 2.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1)
Dairy 1.0 (1) 3.0 (1) 2.0 (2)
Free State Ficksburg, Oosvrystaat Diere Produkte Dairy: 1 Memel, Memel Veterinary Clinic Beef: 1 Kwazulu-Natal Howick, Howick Veterinary Clinic Dairy: 3 Western Cape George, George Animal Hospital Dairy: 2 Heidelberg (WC), Heidelberg Dierekliniek Dairy: 2
Reproductive diseases
Dystocia (Difficult Births) ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.9 (10) 2.0 (2) 2.0 (4) 2.2 2.1 2.0 (16) 2.0 (6) 1.8 (6) 1.0 (3)
(5) (19)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.1 (7) 2.0 (2) 2.3 (3) 2.2 (5)
2.2 (14) 2.1 (11) 2.0 (6) 1.7 (3) 1.0 (2)
Dairy 2.0 (2) 2.3 (3) 2.0 (3)
Sheep 1.3 (3) 1.0 (1) 1.7 (3) 1.0 (1) 1.0 (1)
Goat 1.0 (1) Mpumalanga Balfour, Balfour Dierekliniek Beef: 2 Bethal, Bethal Dierekliniek Beef: 2, Sheep: 2 Bushbuckridge, Dr Martin Jansen CSS Vet Beef: 2 Grootvlei, Grootvlei Dierekliniek Beef: 2, Sheep: 1 Middelburg , Middelburg Dierehospitaal Beef: 2, Sheep: 1 Nelspruit, Nelspruit Animal Hospital Beef: 2 Volksrust, Cape Cross Volksrust Dierehospitaal Beef: 3 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 2 Poor condition main problem Pretoria, Anima Veterinary Consulting Rooms Beef: 2 Limpopo Bela-Bela, Warmbad Dierekliniek Beef: 2 Modimolle, Kranskop Dierekliniek Beef: 2, Sheep: 1 Polokwane, Pietersburg Veterinary Clinic Beef: 3 North West Christiana, Christiana Dierehospitaal Beef: 3 Klerksdorp, Klerksdorp Dierehospitaal Beef: 3 Lichtenburg, Dr CM Kruger-Rall Beef: 2 Ventersdorp, Buffelsvlei Dierekliniek Beef: 1 Vryburg, Vryburg Dierehospitaal Beef: 2 Free State Bultfontein, Greylingsrust Dierespreekkamer Beef: 1 Clocolan, Clocolan Dierekliniek Beef: 2, Dairy: 2 Ficksburg, Oosvrystaat Diere Produkte
Beef: 2 Frankfort, Frankfort Dierekliniek Beef: 3 Hertzogville, Hertzogville Dierekliniek Beef: 2 Five dystocias Hoopstad, Hoopstad Dierekliniek Beef: 3, Sheep: 1 Kroonstad, Kroonstad Dierehospitaal Beef: 3, Sheep: 2 Memel, Memel Veterinary Clinic Beef: 3 Parys, Parys Dierehospitaal Beef: 2 Reitz, Riemland Dierehospitaal Beef: 3, Dairy: 2, Sheep: 2 Viljoenskroon, Viljoenskroon Dierekliniek Beef: 2 Vrede, Vrede Dierehospitaal Beef: 2 Wesselsbron, Wesselsbron Dierekliniek Beef: 1 Winburg, Winburg Dierekliniek Beef: 2 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Camperdown, Camperdown Vet Clinic Beef: 1 Dundee, Endumeni Herd health Beef: 3 Estcourt, Estcourt Vet Clinic Beef: 2 Howick, Howick Veterinary Clinic Beef: 2, Dairy: 3 Kokstad, E.G.Veterinary Services Beef: 3 Mooi River, Mooirivier Vet Clinic Beef: 2, Dairy: 2 Mtubatuba, Mtubatuba Animal Clinic Beef: 2, Goat: 1 Newcastle, Ncanduvet Newcastle Beef: 3, Sheep: 1 Pietermaritzburg, Richmond Veterinay Clinic Beef: 2 Pongola, Pongola Animal Clinic Beef: 1 Underberg, Underberg Veterinary Surgery Dairy: 2 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Beef: 2 Aliwal North, Hertzogbrug Dierekliniek Beef: 2 Graaff-Reinet, Graaff Reinet Veterinary Clinic Beef: 1 Humansdorp, Humansdorp Veterinary Clinic Beef: 2 Middelburg (EC), Steynsburg Dierehospitaal Beef: 3
Queenstown, Queenstown Veterinary clinic Beef: 2 Western Cape Caledon, Overberg Veterinary Hospital Beef: 2 Malmesbury, Dr Otto Kriek Dairy: 2 Oudtshoorn, Oudtshoorn Dierekliniek Beef: 1 Stellenbosch, Stellenbosch Animal Hospital Beef: 2, Dairy: 2 Swellendam, Swellendam Dierehospitaal Dairy: 2 Northern Cape Kathu, Kathu Dierekliniek Beef: 1, Sheep: 1 Kimberley, Kimberley Dierekliniek Beef: 1
Endometritis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 1.7 (3) 2.5 (4)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 1.0 (1) 2.0 (1)
Dairy 2.0 (2) 2.7 (3)
Mpumalanga Grootvlei, Grootvlei Dierekliniek Beef: 2 Free State Bultfontein, Greylingsrust Dierespreekkamer Dairy: 2 Clocolan, Clocolan Dierekliniek Dairy: 2 Ladybrand, Ladybrand / Excelsior Dierekliniek Beef: 1 Kwazulu-Natal Dundee, Endumeni Herd health Beef: 2, Dairy: 2 Howick, Howick Veterinary Clinic Dairy: 3 Mooi River, Mooirivier Vet Clinic Dairy: 3
Metritis ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (2) 2.0 (1) 2.0 2.0 (4) 3.0 (1) 3.0 (1)
(1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (2) 2.0 (1) 2.0 (1)
Dairy 2.0 (4) 3.0 (1) 3.0 (1) Mpumalanga Balfour, Balfour Dierekliniek Beef: 2 Bushbuckridge, Dr Martin Jansen CSS Vet Beef: 2 Gauteng Pretoria, Anima Veterinary Consulting Rooms Beef: 2 North West Christiana, Christiana Dierehospitaal Beef: 2 Kwazulu-Natal Dundee, Endumeni Herd health Dairy: 1 Howick, Howick Veterinary Clinic Dairy: 3 Pietermaritzburg, Richmond Veterinay Clinic Dairy: 2 Underberg, Underberg Veterinary Surgery Dairy: 2 Eastern Cape Kareedouw, Tenax Vet Clinic Dairy: 3 49 cases Western Cape Malmesbury, Dr Otto Kriek Dairy: 3 DCAD (dietary cation -anion difference) is often neglected for Close-up cows with serious consequences especially with regard to re-conception.
Poor conception ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 1.0 (1) 3.0 (1)
2.2 (6) 2.0 (4) 3.0 (1) 2.0 (2) 3.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 3.0 (1)
2.2 (5) 2.0 (1) 3.0 (1)
Dairy 2.5 (2) 3.0 (1) 2.0 (2)
Sheep 2.0 (1) 2.0 (1) 1.0 (1)
Gauteng Pretoria, Anima Veterinary Consulting Rooms Sheep: 2
Limpopo Polokwane, Pietersburg Veterinary Clinic Beef: 1 North West Christiana, Christiana Dierehospitaal Beef: 3 Free State Bultfontein, Greylingsrust Dierespreekkamer Beef: 2 Clocolan, Clocolan Dierekliniek Beef: 3 Ladybrand, Ladybrand / Excelsior Dierekliniek Beef: 2, Sheep: 2 Reitz, Riemland Dierehospitaal Beef: 2 Winburg, Winburg Dierekliniek Beef: 2 Kwazulu-Natal Bergville, Tugela Vet Clinic Sheep: 1 Howick, Howick Veterinary Clinic Dairy: 3 Mooi River, Mooirivier Vet Clinic Beef: 2 Underberg, Underberg Veterinary Surgery Dairy: 2 Eastern Cape Alexandria, Alexandria Platteland Spreekkamer Dairy: 3 Low body condition score especially in heifers, first calvers. Grazing as dry as a bone Western Cape Malmesbury, Dr Otto Kriek Dairy: 2 Swellendam, Swellendam Dierehospitaal Dairy: 2 Northern Cape Kuruman, Kuruman Dierekliniek Beef: 3
Retained afterbirth ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.7 (3) 1.5 (2) 1.0 (2)
1.4 (5) 2.1 (8) 2.0 (2) 1.5 (2) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.7 (3) 1.5 (2) 1.0 (2)
1.5 (4) 2.0 (5) 2.0 (2) 1.0 (1) 2.0 (1)
Dairy 1.0 (1) 2.3 (3) 2.0 (1)
Mpumalanga Bushbuckridge, Dr Martin Jansen CSS Vet Beef: 2 Grootvlei, Grootvlei Dierekliniek
Beef: 1 Nelspruit, Nelspruit Animal Hospital Beef: 2 Limpopo Mokopane, Potgietersrus Dierekliniek Beef: 1 Polokwane, Pietersburg Veterinary Clinic Beef: 2 North West Christiana, Christiana Dierehospitaal Beef: 1 Ventersdorp, Buffelsvlei Dierekliniek Beef: 1 Free State Ficksburg, Oosvrystaat Diere Produkte Beef: 1, Dairy: 1 Frankfort, Frankfort Dierekliniek Beef: 2 Ladybrand, Ladybrand / Excelsior Dierekliniek Beef: 1 Reitz, Riemland Dierehospitaal Beef: 2 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 2 Dundee, Endumeni Herd health Beef: 2 Estcourt, Estcourt Vet Clinic Beef: 2, Dairy: 2 Howick, Howick Veterinary Clinic Dairy: 3 Kokstad, E.G.Veterinary Services Beef: 3 Mtubatuba, Mtubatuba Animal Clinic Beef: 1 Pietermaritzburg, Richmond Veterinay Clinic Dairy: 2 Eastern Cape Middelburg (EC), Steynsburg Dierehospitaal Beef: 3 Uitenhage, Uitenhage Dierehospitaal Beef: 1 Western Cape Caledon, Overberg Veterinary Hospital Beef: 1 Swellendam, Swellendam Dierehospitaal Dairy: 2 Northern Cape Kuruman, Kuruman Dierekliniek Beef: 2
Sheath Prolaps ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.5 (2) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.5 (2) 1.0 (1)
Free State Ficksburg, Oosvrystaat Diere Produkte Beef: 1 Hoopstad, Hoopstad Dierekliniek Beef: 2 Kwazulu-Natal Mtubatuba, Mtubatuba Animal Clinic Beef: 1
Uterus prolaps ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 1.0 (1) 1.0 (1) 1.8 (9) 1.6 (5) 1.3 (3) 2.0 (2)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.0 (1) 1.0 (1) 1.9 (7) 1.5 (4) 2.0 (2)
Dairy 1.0 (1) 2.0 (1) 1.3 (3)
Sheep 2.0 (1)
Mpumalanga Grootvlei, Grootvlei Dierekliniek Beef: 1 Limpopo Bela-Bela, Warmbad Dierekliniek Beef: 1 Free State Clocolan, Clocolan Dierekliniek Dairy: 1 Ficksburg, Oosvrystaat Diere Produkte Beef: 2 Frankfort, Frankfort Dierekliniek Beef: 3 Hertzogville, Hertzogville Dierekliniek Beef: 1 Kroonstad, Kroonstad Dierehospitaal Beef: 2 Ladybrand, Ladybrand / Excelsior Dierekliniek Beef: 1 Reitz, Riemland Dierehospitaal Beef: 3, Sheep: 2 Vrede, Vrede Dierehospitaal Beef: 1 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 1
Dundee, Endumeni Herd health Beef: 2 Howick, Howick Veterinary Clinic Dairy: 2 Kokstad, E.G.Veterinary Services Beef: 2 Mtubatuba, Mtubatuba Animal Clinic Beef: 1 Western Cape Heidelberg (WC), Heidelberg Dierekliniek Dairy: 1 Stellenbosch, Stellenbosch Animal Hospital Dairy: 1 Swellendam, Swellendam Dierehospitaal Dairy: 2 Northern Cape Kuruman, Kuruman Dierekliniek Beef: 2 Kuruman, Lea Shuda CSS Vet Beef: 2
Vaginal (Cervical) prolaps ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 1.4 (9) 1.8 (5) 1.0 (1) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 1.6 (7) 1.8 (5) 1.0 (1)
Sheep 1.0 (2)
Goat 1.0 (1) Mpumalanga Bushbuckridge, Dr Martin Jansen CSS Vet Beef: 2 Free State Ficksburg, Oosvrystaat Diere Produkte Beef: 2 Frankfort, Frankfort Dierekliniek Beef: 2 Hoopstad, Hoopstad Dierekliniek Beef: 1, Sheep: 1 Kroonstad, Kroonstad Dierehospitaal Beef: 2 Ladybrand, Ladybrand / Excelsior Dierekliniek Beef: 1 Memel, Memel Veterinary Clinic Beef: 1, Sheep: 1 Reitz, Riemland Dierehospitaal Beef: 2 Kwazulu-Natal Bergville, Bergville Veterinary Clinic Beef: 3
Dundee, Endumeni Herd health Beef: 1 Estcourt, Estcourt Vet Clinic Beef: 1 Howick, Howick Veterinary Clinic Beef: 2 Mtubatuba, Mtubatuba Animal Clinic Beef: 2 Western Cape Caledon, Caledon Dierekliniek Goat: 1 Northern Cape Kuruman, Kuruman Dierekliniek Beef: 1
Climatical Cause
Drought ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (1) 2.0 (2) 2.0 (3) 2.5 (6)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1) 2.0 (1) 2.0 (1) 2.5 (2)
Sheep 2.0 (1) 2.0 (1) 2.5 (2)
Goat 2.0 (1) 2.5 (2) Mpumalanga Bushbuckridge, Dr Martin Jansen CSS Vet Beef: 2 Free State Ladybrand, Ladybrand / Excelsior Dierekliniek Beef: 2, Sheep: 2 eat plastic & rubbish Eastern Cape Witelsbos, Witelsbos Veterinary Consulting Rooms Beef: 2, Sheep: 2, Goat: 2 Northern Cape Kuruman, Lea Shuda CSS Vet Beef: 2, Sheep: 2, Goat: 2 Postmasburg, Postmasburg Dierekliniek Beef: 3 Severe drought, animals unable to stand, animals dying. Sheep: 3, Goat: 3
Heat stress ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.3 (4)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.5 (2) Sheep 2.0 (1) Goat 2.0 (1) Northern Cape Kuruman, Kuruman Dierekliniek Beef: 3 Kuruman, Lea Shuda CSS Vet Beef: 2, Sheep: 2, Goat: 2
Lightning ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.0 (6) 1.5 (2) 2.0 (1)
2.0 (4) 2.0 (2) 1.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 1.8 (5) 2.0 (1) 2.0 (1)
2.0 (4) 2.0 (2) 1.0 (1)
Sheep 3.0 (1) 1.0 (1) Mpumalanga Balfour, Balfour Dierekliniek Beef: 1 Bethal, Bethal Dierekliniek Beef: 1 Grootvlei, Grootvlei Dierekliniek Beef: 1 Middelburg , Middelburg Dierehospitaal Beef: 3 Volksrust, Cape Cross Volksrust Dierehospitaal Beef: 3, Sheep: 3 Gauteng Bronkhorstspruit, Kerkstraat Dierekliniek Beef: 2 6 animals at one farm Pretoria, Dr Rosaly Steyn (LNR) CSS vet Sheep: 1 North West Vryburg, Vryburg Dierehospitaal Beef: 2 Free State Frankfort, Frankfort Dierekliniek Beef: 2 Harrismith, Harrismith Dierehospitaal Beef: 2 Memel, Memel Veterinary Clinic Beef: 2 Reitz, Riemland Dierehospitaal Beef: 2 Kwazulu-Natal Dundee, Endumeni Herd health Beef: 2
Howick, Howick Veterinary Clinic Beef: 2 Eastern Cape Queenstown, Queenstown Veterinary clinic Beef: 1
Non specific diseases
Preditors ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.7 (3) 2.0 (1) 2.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1)
Dairy 2.0 (1)
Sheep 3.0 (2) 2.0 (1) 2.0 (1)
Free State Clocolan, Clocolan Dierekliniek Beef: 2, Sheep: 3 Frankfort, Frankfort Dierekliniek Sheep: 3 Kwazulu-Natal Howick, Howick Veterinary Clinic Dairy: 2 Western Cape Caledon, Caledon Dierekliniek Sheep: 2 Northern Cape Philipstown, Rowelsfontein veearts Spreekkamer Sheep: 2
Sabotation - Theft ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 2.3 (4) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1)
Sheep 2.3 (3) 2.0 (1)
Free State Clocolan, Clocolan Dierekliniek Beef: 2, Sheep: 3
Ficksburg, Oosvrystaat Diere Produkte Sheep: 1 Frankfort, Frankfort Dierekliniek Sheep: 3 Kwazulu-Natal Kokstad, E.G.Veterinary Services Sheep: 2
Trauma ^
PROVINCE Mpumalanga Gauteng Limpopo North West
Free State
Kwazulu-Natal
Eastern Cape
Western Cape
Northern Cape
Average 3.0 (1) 2.0 (1)
Level of importance scale: 1 = one case, 2 = more than one case but less than ten and 3 = more than 10 cases reported
Beef 2.0 (1)
Sheep 3.0 (1)
Free State Frankfort, Frankfort Dierekliniek Sheep: 3 Kwazulu-Natal Camperdown, Camperdown Vet Clinic Beef: 2 Fractured tibia
rep_disease_sum vetprac
rep_disease_sum vetprac
rep_disease_sum vetprac
rep_disease_sum vetprac