Natural Awakenings New Haven & Middlesex SEPT 2015

1natural awakenings September 2015

September 2015 | New Haven-Middlesex | NaturalNewHaven.com

FREE

Ageless Mind, Body

and SpiritForever Young the

Natural Way

Yoga as MedicineResearch Proves Health Benefits The Tao of

Yin YogaA gentle

Soft Style of Yoga

H E A L T H Y L I V I N G H E A L T H Y P L A N E T

feel good • live simply • laugh more

2 New Haven / Middlesex NaturalNewHaven.com

10th Location: The Graduate Institute171Amity Road, Bethany, CT


Medically SupervisedWeight Loss & Wellness Program

Achieve Your Ideal Weight

203-239-3400North Haven and West Hartford

www.thelifecenterofct.com

VOTED #1 WEIGHT LOSS PROGRAM IN THE AREA

Thousands of Years of Food Wisdom in Twelve Months

Time in the Garden learning to Grow nourishing

food and herbs

Moving into the Kitchen to create

delicious food

Using Food and Herbs to make

Kitchen Medicine

Identifying and using nutrient dense Wild Foods

in delicious dishes

Embark on this life-altering journey and be part of the movement to change the paradigm of our food for future generations.

Join our experienced staff one weekend a month as you use hands on education to delve into and explore diverse aspects of how food and herbs enhance the

health of your clients, family, yourself and the environment.

Now Accepting Applications for 2015-16. Call 860-764-9070 Today!

West Granby, CT • www.tiosn.com

CLASSES BEGIN

September 25


The lazy, hazy days of summer are now behind us, and the energy is now shifting into higher gear as we enter the fall season. We hope our September issue themed Agelessness and Benefits of Yoga will inspire you to fine tune your health habits in ways that will amp up your vitality, enthusiasm and overall well-being in ways you never imagined during this new season! Our main feature article, “Ageless Being: Staying Vibrant in Mind, Body and Spirit” offers a refreshing new perspective on aging—especially for those of us who are over 50.

In 10 years, I will be 65 years old and I absolutely abhor the thought of being labeled as a “senior citizen”—or even worse, being referred to as “elderly.” As Dr. Christian Northrop asserts, “Words are powerful.” We eventually become what we believe, feel and expect, so why default to expecting mental, physical and emotional decline as inevitable? It is because we have conditioned ourselves to think this way. The good news is that we can retrain ourselves to shift our thinking in a way that motivates us to take healthy actions, leading to longer, happier and more vibrant lives. As we all know, long-term physical, mental and emotional stress can take a huge toll on our well-being, age us quicker—and ultimately shorten our life span. Studies have shown that yoga is one of the most effective practices for reducing the effects of stress, while enhancing physical fitness, reproductive functions and mindfulness. Many doctors also recommend yoga to help manage osteoporosis. Read more about the benefits of yoga in our Fit Body feature: “Yoga Enters the Mainstream: Research Proves its Health Benefits.” There are many different types of yoga for all levels. Some styles of yoga are more intense and high energy, such as Vinyasa, Ashtanga and Bikram, whereas other styles are more gentle and “yin.” Christine Ucich, yoga practitioner/instructor, owner and operator of One World Wellness & Yoga in East Haven (OneWorld-Wellness.com) has written a very informative article about a softer, gentler kind of yoga, known as Yin Yoga. Read more about this soft, more relaxed style of yoga in her article, “The Tao of Yin Yoga” on page 28. Happiness is also intimately connected with agelessness—and, as you will read in our Healing Ways feature “Choose Happiness: Four Tips to Flip the Joy Switch,” we can choose happiness, in spite of our history or current conditions of our life. As you turn the pages, you will find an abundance of local resources, events, services and products, which will enhance your health and wellness, personal growth and—agelessness! So, be sure to check out our news briefs, event spotlight and community calendar. Don’t miss the Connecticut Folk Festival and Green Expo on Saturday, September 12, from 11a.m. to 10p.m. in Edgerton Park, New Haven and the Broadway Open Farmers Markets, every Friday from 11a.m. to 2p.m. on 56 Broadway in New Haven (through November 20). Natural Awakenings will be at both of these wonderful events, so stop by our table and say “hello.” As always, we’ll have our magazines in tow!

Happy Fall Equinox!

Publisher Art DirectorGail Heard 203-988-1808 [email protected]

Managing Local Editor Ariana Rawls Fine

Managing National Editor S. Alison Chabonais

Design and Production Gail Heard

Printer TN Printing

Franchise Sales 239-530-1317

To contact Natural AwakeningsNew Haven/Middlesex Counties:Natural Awakenings PO Box 525North Branford, CT 06471Phone: [email protected]

© 2015 by Natural Awakenings. All rights reserved. Although some parts of this publication may be reproduced and reprinted, we require that prior permission be obtained in writing.

Natural Awakenings is a free publication distributed locally and is supported by our advertisers. It is available in selected stores, health and education centers, healing centers, public libraries and wherever free publications are generally seen. Please call for a location near you or if you would like copies placed at your business.

We do not necessarily endorse the views expressed in the articles and advertisements, nor are we responsible for the products and services advertised. We welcome your ideas, articles and feedback.

SUBSCRIPTIONSSubscriptions are available for $30 ( for 12 issues ). Please call 203-988-1808 with credit card information.

Natural Awakenings is printed on recycled newsprint with soy-based ink.

contact us

letterfrompublisher


how to ADvErtiSE To advertise with Natural Awakenings or request a media kit, please contact us at 203-988-1808 or email [email protected]. Deadline for ads: the 10th of the month.

EDitoriAL SubMiSSioNSEmail articles, news items and ideas to [email protected] Deadline for editorial: the 1st of the month.

cALENDAr SubMiSSioNSSubmit calendar events online at NaturalNewHaven.com. To revise or discontinue a calendar listing email [email protected]. Deadline for calendar: the 10th of the month.

rEgioNAL MArkEtSAdvertise your products or services in multiple markets! Natural Awakenings Publishing Corp. is a growing franchised family of locally owned magazines serving communities since 1994. To place your ad in other markets call 239-449-8309. For franchising opportunities call 239-530-1377 or visit NaturalAwakeningsMag.com.

NaturalNewhaven.com

6 newsbriefs

12 healthbriefs

14 globalbriefs

16 inspiration

17 eventspotlight

22 healingways

24 consciouseating

26 fitbody

30 wisewords

32 naturalpet

34 calendar

42 classifieds

43 resourceguide

contentsNatural Awakenings is your guide to a healthier, more balanced life. In each issue readers find cutting-edge information on natural health, nutrition, fitness, personal growth, green living, creative expression and the products and services that support a healthy lifestyle.

16 thE ADvENturE oF couchSurFiNg Stay with Locals and Make New Friends by Lisa Rosinky

18 AgELESS bEiNg Staying Vibrant in Mind, Body and Spirit by Kathleen Barnes

22 chooSE hAPPiNESS Four Tips to Flip the Joy Switch by Linda Joy

24 SurF to turF U.S. Farmed Seafood That’s Safe and Sustainable by Judith Fertig

26 YogA ENtErS thE MEDicAL MAiNStrEAM Research Proves its Health Benefits by Meredith Montgomery

28 thE tAo oF YiN YogA A Gentle, Soft Style of Yoga by Christine Ucich

30 ALEXANDrA PAuL oN vEgAN ActiviSM Her Kind Lifestyle Honors All Living Things by Gerry Strauss

32 EYE hEALth For DogS 10 Foods to Keep Canine Vision Sharp by Audi Donamor

12

18

24

32

14

14

16

advertising & submissions


newsbriefs

Holistic Girls Night Out in Clinton

Several practitioners will be hosting a healthy, fun,

photo-worthy Girls Night Out on October 1 at 6:30-8:30 p.m. at the Clinton Country Club. Chris Schafer of Arbonne International will speak about health, wellness and anti-aging while Jadak Hair Restoration’s Agnieshka Jadak will touch upon non-surgical hair

replacement. Cathy Wilson of Ramin Photography, LLC will offer portraits focusing on authenticity and simplicity. The event will feature health, wellness and anti-aging suggestions and 100 percent natural human hair restoration and extensions. Attendees will be able

to sample pure, safe and beneficial nutrition, skincare and cosmetics along with makeup applications. A professional photographer will be there to offer before and after photos of the trans-formation. Guests will experience learning how small changes can have a big impact not only on their health but also their self-esteem. To RSVP, call Chris Schafer at 602-516-4689. Space is limited; reservations are required. Location: Clinton Country Club, 128 Old Post Rd., Clinton, CT. For more information about services, call Chris Schafer at 602-516-4689, Agnieshka Jadak at 203-859-0605 or Cathy Ramin at 203-554-0365. See ad on page 13 and profile on page 21.

Special Cocoa Butter Now Offered Locally

ChocoNut Butter is available at Edge of The Woods on 379 Whalley Avenue in New Haven, Connecticut. This

new product was created by a Connecticut native during the holiday season of 2014. What started out as a gift for friends and family has now become a brand of its own. ChocoNut Butter, which is composed of raw cocoa butter and certified organic coconut oil, aids in skin rejuvenation, helps to main-tain youthful and healthy skin, and is great for all seasons. Some benefits of cocoa butter include aiding with scar removal, preventing stretch marks, protecting skin from the sun, and increasing skin moisture and elasticity with the fatty

acids that it contains. Coconut oil can help moisturize and condition skin, protect skin from microbes, safely remove eye makeup and can be used as massage oil. For more information, email Mishon Jones at [email protected] or call 347-956-8630.

New Age and Craft Expo in October

On October 18 from 10 a.m. to 5 p.m., come experience a day of creative and spiritual enlightenment at the

New Age and Craft Expo in Southbury. The event will feature two rooms of dynamic speakers and guided meditations,

including health and wellness topics, crystals, intuitive read-ers and aura photos. Unique hand-crafted products will be available as well. Admission to the event is $6 per person.

If you would like to be a vendor, contact 203-733-6560, [email protected] before September 18. Location: Crowne Plaza, 1284 Strongtown Rd., Southbury, CT. See ad on page 35.

Grand Opening of Reiki Studio

Sacred Song Reiki announced a grand opening in its new location at 60 Church Street, Suite 4G in Wallingford,

Connecticut. Sacred Song Reiki offers more than just Reiki to improve health and well-being, utilizing multiple healing modalities and techniques, including reconnective healing, Himalayan singing bowls, magnified healing, Blue Moon Isis, conscious-ness bars and crystal singing bowls. Sacred Song Reiki is owned by Rev. Priscilla Estelle, Reiki master teacher and ordained minister in the Universal Brotherhood Movement. Estelle also holds a masters certification in Himalayan singing bowls. Reiki can help reduce stress, chronic aches and pains, fibromyalgia, high blood pressure, difficulty sleeping, prepar-ing for surgery or recovering from surgery, and much more. Recipients often experience joy, peace, confidence, balance, restored feelings of well-being and reduced pain along with more energy and clarity of thought. Sessions are gentle and professional, tailored to each person’s individual need. For more information, contact Priscilla Estelle at 508-517-2400 or [email protected] or visit SacredSongReiki.com.

Agnieshka Jadak

Cathy Wilson

Chris Schafer


Adult Creative Journaling Workshop Offered

The newly relocated and renovated Bird Nest Gallery & Salon Suites is hosting Mastering the Art of

Self-Expression, an interactive creative journaling workshop for adults. It will take place September 13, October 18 and November 8 from 1 to 3 p.m.

Laura Thoma, an artist and life coach, will lead this workshop that is designed for both the “creatively challenged” and the “creatively confident.” Creative journaling is a great place to let go of your daily pressures and reclaim your refrigerator art. Practice self-expression in a judgment-free zone while you explore your thoughts and dreams one creative exercise at a time. “Come for crayons, stay for the connection,” says Laura Thoma. For more information and to register, call 203-689-5745 or visit TheBirdNestSalon.com. See ad on lower right.

Survive to Thrive

In collaboration with the Harold Leever Cancer Center, The Salt of the Earth Spa is sponsoring a day of rejuvenation for

cancer patients and survivors. Come to scenic Woodbury and Southbury to relax, relieve stress, and enjoy a special array of free and discounted services on September 12. The Salt of the Earth will offer free salt cave sessions with crystal singing bowls, guided meditation, energy healing and chair massages. New Morning Market will host an informative lineup of speakers: Kim Schmus and Pam Picard on Mind, Body and Spirit (10-10:30am), Morgan O’Connell with The Benefits of Yoga for Cancer Patients (10:30-10:45am), Joe Bentivoglio on The Benefits of Massage for Cancer Patients and Survivors (10:45-11am) and Life Coach Sarah Hamilton about Life is Now: A Seminar on staying in the moment with focus on health and recovery (11am-noon). In the afternoon, Alison Birks will speak about Preventing Cancer with Nutrition (noon-12:45) and Eugenia Magill will lead the Guided Self-Healing Meditation (1-2pm). After a break for lunch and New Morning promotions, Eugene Zampieron, a naturo-path, herbalist and professor, will offer Unique and Evi-dence-based Botanical Medicines for Cancer and Maintain-ing Strong Immune System (2:45-3:45pm). Dr. Melissa Beck will talk about Chiropractic Healing for Cancer (3-4pm) and Becca Zeretsky will perform original comedic songs from 4-4:30pm. The MC of the event, JodiLynn Natale, will show cancer survivors how to live with passion, laughter and love of life (4:30-4:45pm) while Miles Arnell, a local pop/soul

49$

59$

*Introductory prices apply to your massage OR facial service during your irst visit


singer and songwriter, will finish the day by commemorating his own family’s challenge with cancer (4:45-5:15pm). Other participants include Brennan Healing Science, DermAesthetics, The Spa Room at DermAesthetics, Community Accupuncture, Villarina’s and many others. Pre-registration is required. To register, call Harold Leever Cancer Center in Waterbury at 203-575-5555 or Praxair Cancer Center in Danbury at 800-511-8639. Sign-up sheets are located at both locations and at Salt of the Earth Spa in Woodbury.

Father and Son Dental-Medical Team Moves to Fairfield

Drs. Mark Breiner and Adam Breiner, with their respective holistic dental and medical practices in the Breiner

Whole-Body Health Center, have long been based in Trumbull, Connecticut. They have moved to new offices conveniently located at 501 Kings Highway East in Fairfield, Connecticut. Dr. Mark A. Breiner, DDS, is a holistic dentist and an authority in the field of biological dentistry with over 40

years of experience. He is also the author of Whole-Body Dentistry: A Complete Guide to Understanding the Impact of Dentistry on Total Health. Mark’s son, Adam Breiner, ND, is a naturopathic physician who uses various approaches to treat a wide range of health conditions, including the combined use of hyper-baric oxygen therapy and EEG neurobiofeedback. Dr. David Brady, an internationally recognized authority in integrative medicine and Dr. Elena Sokolova, an expert in oriental medicine, also practice at the center.

For more information, visit WholeBodyMed.com or call 203-271-0300 (dental) or 203-371-8258 (medical). See ads on page 31.

Holistic Chamber of Commerce Offers Bookkeeping Info

The New Haven Chapter of the Holistic Chamber of Com-merce business education topic for September features

Bookkeeping Options of Small Business. The informational session will be held during their monthly business meet-ing at The Graduate Institute at 171 Amity Road in Bethany, Connecticut, on September 10 from 6:30-8:30 p.m. Iuliana Scheir, owner of IB Holistic Connection and IB & Co Accounting and Bookkeeping, will be presenting. The meeting is free to Chamber members and interested first-time guests who wish to explore membership. The regular fee for the evening is $15.

The New Haven Chapter is also sponsoring a Member SpotLight of Drumming Circle with Lynne Grobsky on Sep-tember 16 at Rhythm of Your Soul in Meridan from 6:30-8:00 p.m. Join the chapter for an evening of rhythm, laughter and friendship. No experience necessary. Bring a drum or shaker, if you have one, or choose from the instruments provided. Donations of $20 are accepted for non-members. Benefits of becoming a member of the Holistic Chamber of Commerce include networking with local practitioners, business-building education, chapter- sponsored events, an online member directory listing and social media networking.

To register, visit Meetup.com/HCC-New-Haven. For more information, visit HolisticChamberofCommerce.com/Ne-wHaven or call New Haven Chapter President Rosa Chyan at 203-228-1777 or [email protected]. See ad on inside front cover.

Free Screenings Available in Guilford

Physical Therapy Services of Guilford is offering free biomechanical assessments at its Branford, Connecticut,

location on September 9 from 4-5 p.m. and on September 22 from 1-3 p.m. Workouts should be pain-free from your warm-up through your cool-down. If you are experiencing pain during your workout, it is natural to assume it is because you are not in

newsbriefs

Dr. Mark Breiner (left) and Dr.Adam Breiner (right)


top physical condition. This may not be the case; the source of your pain may be due to a biomechanical issue. The bio-mechanical assessments can help identify the true source of your pain. Often help with the pain can be achieved within a few physical therapy sessions. To reserve a spot, call 203- 315-7727. For more information, visit PhysicalTherapyGuilford.com. Location: Physical Thera-py Services of Guilford, 500 East Main St., Ste. 310, Branford, CT. See ad on page 25.

More Produce For All at New Farmers’ Market

A new farmers’ market is coming to Broadway in New Haven every Friday, 11 a.m. to 2 p.m. until November

20. Located just outside J. Crew and the Apple Store, this

farmers’ market, hosted by The Shops at Yale and Specialty Events, LLC, boasts local produce, herbs, gluten-free baked goods, custom dog food and treats, mushrooms, maple syrup, honey, candles, soaps and more. In addition, farm-fresh beef, poultry, pork, lamb and veal will be available. For more information, call 203-856-8534, email [email protected] or visit SpecialtyEventsLLC.com or BroadwayOpenMarkets.com. See ad on page 25.

Connecticut’s First Cohousing Neighborhood Set to Begin Building

Rocky Corner, a multigenerational community developed and managed by the people who plan to live there, will

begin construction in Bethany this fall. The neighborhood will include 30 energy-efficient, sustainable homes and a large common house with shared facilities. The homes will be clustered in a pedestrian-friendly arrangement, with cars kept to the perimeter. Surrounding

the neighborhood will be about 20 acres of farmland that interested residents will use to produce food primarily for the community. The goals of cohousing are sustainability, cooperation and socialization, which can increase the health and well-being of residents; sharing increases efficiency and decreases waste and a strong sense of community combats loneliness and isolation. Green Haven, Inc., the company formed by future residents of the community to develop Rocky Corner, has received a $2.6 million award from the Connecticut Depart-ment of Housing that will enable them to offer 13 of the

Avant Garde

AvantGardeCT.com

328 East Main StreetBranford, CT 06405

203-481-8443

Pamper, Shop & RestoreIntro Offer

Spa AromatherapyFacial for $35

(Regular Price $55)

Visit our website to learn about our classes & events. Receive special invites by joining our email list. Salon • Spa • Boutique • Holistic Center

Free Gift with any boutique purchase with this ad

Largest selection of fair trade, eco-friendly, new age, unique gifts & jewelry


30 homes to income-qualified families at affordable prices. There are still a few market-rate homes available. Applica-tions to be on the waiting list for an affordable home are also being accepted. Information on the application process is available at RockyCorner.org. To learn how to reserve a home, email Welcome@ RockyCorner.org.

Step By Step to a Healthier Milford

The annual event will kick off on September 19 at 9 a.m. at the Walnut Beach Pavilion in Milford, Connecticut.

Step by Step to a Healthier Milford is presented by the Milford Regional Chamber of Commerce’s Health & Wellness Council (HWC). This six-week, self-monitored walking program is de-signed to foster a healthier community. It also benefits the Health & Wellness student scholarship fund. Solo and walk-

ing teams are invited to participate. A wrap-up celebration will take place on November 9 at 5:30 p.m. at Milford Hospital. The guest speaker will be Betsy Ratner, a motivational speaker. The title sponsor is Milford businesswoman Priscilla Lynn of PrisCo Consulting, LLC, who is also the HWC founder and current chair. The official media sponsor is Natural Awakenings New Haven and Middlesex Counties’ magazine. Pedometer Sponsor Clinical Research Consulting joins other HWC sponsors including Always Best Care Senior Services, American Medical Response, Inc., Dr. Brian Hollander of CORE Chiropractic & Rehabilitation, and Dr. Victoria Rothenhausen of Family Chiropractic Services. For details and registration information, contact the Milford Regional Chamber of Commerce at 203-878-0681. See ad on left.

newsbriefsStep by Step to aHealthier MilfordSeptember 19 - October 31, 2015

Presented By:

Official Print Media Sponsor:

More Information: www.milfordct.com or call Milford Chamber (203) 878-0681

Join the walking program! 6-week self-monitored, developed to inspire a user-friendly and practical way to adopt/maintain

a healthier lifestyle. Solo or Team: All are invited to register and participate. $20 Registration fee includes: Pedometer, Goodie Bag,

T-shirt, Weekly inspirational emails, Wrap Up Celebration. PLUS: Discounted registration for Folks on Foot Event.

Visit www.bridgesct.org for details.

Take part in the Kick-Off Event! Saturday, September 19th, 9 a.m.

Walnut Beach PavilionRegistrants are also invited to a Wrap Up Celebration, Monday, November 9th, 5:30 p.m. at Milford Hospital. Highest 3 steppers will receive acknowledgement and gifts,

everyone will receive a Participation Certificate, and all will enjoy Guest Speaker Betsy Ratner.

Annual Six-Week Walking Program to foster a healthier community and benefit the

Health & Wellness student scholarship fund

Pedometer Sponsor: Clinical Research Consulting HWC Member Sponsors: Always Best Care Senior Services, American Medical Response, Inc., Dr. Brian Hollander/CORE Chiropractic & Rehabilitation; Dr. Victoria Rothenhausen/Family Chiropractic Services


Master Naturalist Certification Presented in Fairfield

Are you interested in expanding your knowledge of the habitats, plants, animals and natural history of

Connecticut? Connecticut Audubon Society (CAS) is offering a master naturalist training program September 15-November 17 on Tuesdays from 10 a.m. to 2 p.m. The training program prepares people of all experience levels to become naturalists in their communities and to contribute to environmental education and conservation efforts through volunteer service. The program provides 40 hours of classroom and field training in four-hour sessions over 10 weeks. Classes are taught by field experts such as Bill Kenny, a Fairfield-based

ecologist and landscape architect, and James E. Biardi, Ph.D., the director of environmental studies at Fairfield University. All sessions will include a mix of indoor classroom presenta-tions and outdoor, hands-on field experiences. At the conclusion of the training, graduates receive certificates and apply their knowledge and individual skills in volunteer capacities to help maintain and support educa-tion activities and operations at the center and its adjoining Larsen Sanctuary, as well as in their own communities. Registration deadline is September 8. The program fee is $195 for CAS members and $250 for non-members (includes a CAS membership). As part of the tuition, participants must be able to volunteer 40 hours within the year following the training. To complete the program, expect to attend every class. If a session is missed, it may be possible to arrange a make-up class with the instructor. For more information and the registration and application, visit http://www.CTAudubon.org/2015/07/Master-Naturalist-Training-2 or call 203-259-6305, extension 109. Location: Connecticut Audubon Society Center at Fairfield, 2325 Burr St, Fairfield, CT.

Master of Arts Degrees: Integrative Health and Healing Organizational Leadership Learning and Thinking Writing and the Oral Tradition Consciousness Studies

Certiicate Programs: Ecotherapy Positive Psychology Integrative Health and Healing Applied Storytelling Coach Training

with Dr. Enrico Cheli & Cristina Antoniazzi

SEPTEMBER 8TH, 7:00 PM171 Amity Rd, Bethany CT


healthbriefs

Yoga Boosts Brain Gray MatterResearch from the Brain Imaging and Analysis Center at

Duke University Medical Center has found that a regular hatha yoga practice increases gray matter within the brain, reversing the loss found among those with chronic pain. The researchers tested seven hatha yoga meditation practitioners and seven non-practitioners. Each of the subjects underwent tests for depression, anxiety, moods and cognition levels, along with magnetic resonance imaging (MRI) brain scans. The scientists found that the brains of the yoga meditation practitioners contained significantly greater gray matter by

volume in key brain regions, including the frontal, temporal and occipital cortices, plus the cerebellum and the hippocampus, compared to the non-yoga subjects. The yoga meditation practitioners also had more gray area in the prefrontal cortex regions that are involved in decision-making, reward/consequence, control and coordination.

Smog Increases Stroke RiskResearch from Germany has found that the high particulate

numbers in smoggy areas increase the risk of stroke. The Heinz Nixdorf Recall study followed more than 4,400 people between the ages of 45 and 74 years old. The researchers began the study in 2000. They compared stroke and heart attacks to air pollution particulate matter (PM) levels of PM10 (particle sizes of 10 micrometers or less) and PM2.5 (2.5 micrometers or less). The study found that stroke incidence was more than two-and-a-half times higher among people with long-term

exposure to PM10, while stroke incidence increased by more than three times among people with long-term exposure to PM2.5 smog.

Support Groups Keep Artery Patients MobileResearch published in the Journal of the American

Heart Association has determined that when peripheral artery disease patients engage in behavioral support groups that encourage exercise, they realize increased mobility. The researchers from Northwestern University followed 194 patients for a year, testing subjects at six months and again at 12 months. The patients were divided into two groups; one attended weekly intervention group meetings, while the control group attended weekly lectures. After six months, the researchers found that only 6.3 percent of those that attended the support group meetings experienced mobility loss, compared to 26.5 percent of those that didn’t attend the meetings. After one year, the support group attendees again showed positive results. The control group had 18.5 percent loss in mobility, while only 5.2 percent of the support group attendees did.

Chamomile Tea Helps Us Live LongerIn a study of 1,677 Mexican-Amer-

ican men and women over the age of 65 from the Southwestern U.S., researchers have found that drinking chamomile tea decreases the risk of earlier mortality by an average of 29 percent. Researchers from the University of Texas Medical Branch followed the study population for seven years. Among those tested, 14 percent drank chamomile tea regularly. These were primarily women, and those women that drank chamomile tea experienced a 33 percent reduced mortality during the study period. The small group of men that drank the chamomile tea regularly did not register a significant difference in mortality. Chamomile also has a long his-tory of use in folk medicine and is primarily used to settle digestion and calm the mind. It is a leading natu-ral herbal tea in many countries and contains no caffeine. While various species may be used, chamomile tea is traditionally made by infusing the flowers of ei-ther German chamomile (Matricaria chamomilla) or Roman chamomile (Chamaemelum nobile) into hot water. In Spanish-speaking regions, chamomile tea is often referred to as manzanilla tea—consumed in Mexico and other Spanish cultures for centuries.


Daily Exercise Adds Five Years to LifeResearch published this year in the British Journal

of Sports Medicine has determined that just 30 minutes of exercise, six days a week, can result in a reduced risk of early death by 40 percent, regardless of the intensity of the exercise. The researchers followed nearly 15,000 men born between 1923 and 1932. The men’s exercise and sedentary levels were measured along with the number of deaths that occurred during two 12-year study periods. In the second 12-year period, the researchers followed almost 6,000 of the surviving men. The research-ers compared those men that were sedentary with those that exercised either mod-erately or intensely and found that moderate to intense exercise increased their average lifespan by five years. This improvement was comparable to the difference between smoking and non-smoking, according to the researchers. The data comes from the Norwegian School of Sport Sciences, in Oslo. The scientists’ finding confirms that public health practices for elderly men should include efforts to increase physical activity, along with efforts to reduce smoking.

Muscle-Building Supplements Linked to Testicular Cancer

New research published in the British Journal of Cancer has found that taking muscle-building

supplements can increase the risk of testicular cancer by up to 65 percent. The study monitored 356 cancer patients and 513 control subjects, all from Connecti-cut and Massachusetts. The case-control study was conducted by re-searchers from the Yale School of Public Health and

the Harvard School of Public Health, and tested for testicular germ cell cancer. About 90 percent of testicular cancers originate from germ cells. The researchers found the subjects that used multiple musclebuilding supple-ments and those that began using the supplements when they were younger had the greatest risk of developing cancer.

Tired of thinning hair or hair loss?We have the solution!The Evolve Volumizer

• The wearable solution for women with thinning hair or hair loss• Worn day & night for up to 4-5 weeks, when a reset is needed• 100% human hair, natural & undetectable, lightweight• Without the use of chemicals, glue or adhesives

Call for a free consultation today!JADAK HAIR RESTORATION

102 Wall St, Madison, CTJadakHairRestoration.com • (203) 859-0605

203-439-8689The Watch Factory Shoppes 116 Elm Street, Cheshire, CT

Our services include:

Naturopathic Medical Visits Chinese Medicine Evaluation

AcupunctureDiet and Nutritional Counseling

Supplement and Medication Evaluation

*Most Insurance Accepted*

East West Integrative Health Clinic, LLC

ewihealth.com

Sign up for a FREE newsletter at:

Lisa Rosenberger, ND, LAcNaturopathic Physician and

Licensed Acupuncturist

217 Montowese St.Branford, CT 06405

203.915.9125


globalbriefsNews and resources to inspire concerned citizens to work together in building a healthier, stronger society that benefits all.

Bottomless WellDe-Salting Water Could Help Drought-Stricken AreasA team from the Massachusetts Institute of Technology and Jain Irrigation Systems has devised a method of turn-ing brackish water into drinking water using renewable energy. This solar-powered machine is able to pull salt out of water and disinfect it with ultraviolet rays, making it suitable for both irrigation and drinking. Electrodialysis works by passing a stream of water between two electrodes with opposite charges. Because the salt dissolved in water consists of positive and negative ions, the electrodes pull the ions out of the water, leaving fresher water at the center of the flow. A series of membranes separate the freshwater stream from increasingly salty ones. The photovoltaic-powered electrodialysis reversal system recently won the top $140,000 Desal Prize from the U.S. Department of Interior. “This technology has the potential to bring agriculture to vast barren lands using brackish water,” says Richard Restuccia, Jain’s vice president of landscape solutions. The prize was developed to supply catalytic funding to capture and support innovative ideas and new technolo-gies that could have a significant impact on resolving global water demand. Among 13 desalination projects under consideration along the California coast, the Carlsbad Desalination Project will be the largest in the Western Hemisphere once it is completed in the fall.

Source: EcoWatch.com

Breeze PleaseA Third of U.S. Power May Be Wind by 2050According to a new study by the U.S. Energy Department (Tinyurl.com/EnergyDepartmentWindReport), wind power could provide more than a third of the nation’s electricity in a few decades, while posting a net savings in energy costs. Undersecretary for Technology and Energy Lynn Orr, Ph.D., states, “With continued commitment, wind can be the cheapest, cleanest option in all 50 states by 2050.”

Wind power has tripled since 2000, and now supplies nearly 5 percent of the country’s electric power. The report says that it could dramatically reduce air pollution and go a long way toward meeting the country’s goals of slowing climate change. Meanwhile, Spanish engineers have invented the Vortex Bladeless wind turbine, a hollow straw that sticks up 40 feet from the ground and vibrates when the wind passes through it. Instead of using a propeller, the Vortex takes advantage of an aerodynamic effect called vorticity. The result is a turbine that’s 50 percent less expensive than a bladed model and is nearly silent. It’s not as efficient as conven-tional turbines, but more of them can be placed in the same amount of space, for a net gain of 40 percent in efficiency. Plus, with no gears or moving parts, mainte-nance is much easier and they are safer for bats and birds.

Source: Wired

Embracing InvasivesRethinking the Balance of NatureEnvironmental journalist Fred Pearce, author of the new book, The New Wild: Why Invasive Species Will Be Nature’s Salvation, traveled across six continents and ecosystems from remote Pacific islands to the United Kingdom and the Great Lakes to reveal some outdated scientific ideas about invasive species and the bal-ance of nature. Pearce argues that mainstream environmentalists are correct that we need a rewilding of the Earth, but they are wrong if they believe it can be achieved by reengineering eco-systems. He thinks that humans have changed the planet too much, and nature never goes backward. But a growing group of scientists is taking a fresh look at how species interact in the wild. According to these new ecologists, we should applaud the dynamism of alien species and the new ecosystems they create. In an era of climate change and widespread ecological damage, it’s crucial that we find ways to help nature regenerate. Embracing this new ecology, Pearce proposes, is our best chance, maintaining, “To be an environmentalist in the 21st century means celebrating nature’s wildness and capacity for change.”

Source: Earthtalk.org


2015 ConnecticutFolk Festival and Green Expo

Edgerton Park, New Haven, ConnecticutGreen Kids Area sponsored by "CT Kids and Family"

FREE!

www.ctfolk.org

Family Friendly!

Saturday, September 12th Green Expo from 11 a.m. through 5 p.m.


Daniel Sperry, a “couchsurfer” in his late 50s, decided a few years ago to quit his day

job and make a living by performing cello music and reciting poetry in liv-ing rooms across the country. “I didn’t know it would become a catalyst for bringing communities of local people together,” he says, but his first gig, a “little shotgun shack” in Elko, Nevada, became more than a once in a lifetime experi-ence. Years later, his Elko host remains a close friend and hosts a regular (and lucrative) stop on his cross-country tours. Not only does creating connections with strangers make us happier—as Uni-versity of Chicago social sci-entists have proven—it leads to fun travel stories. If we choose to see the world via the decade-old organization at Couchsurfing.com, we might find ourselves sleep-ing on a sailboat in the Irish Sea; meeting backpackers by solar-powered light in a cave in Petra, Jordan; sharing a room with a pet bird that falls asleep listening to sappy love songs on the radio; or jamming to old-time banjo and fiddle tunes in a North Carolina kitchen. The global community of couch-surfers, now 10 million strong, consid-ers strangers “friends you haven’t met yet.” They currently are hosting and organizing more than half-a-million events in more than 200,000 cities worldwide this year. The aim is to make travel easier and more affordable, build

The Adventure of Couchsurfing

Stay with Locals and Make New Friendsby Lisa rosinky

people’s faith and trust in one another and create meaningful connec-

tions across cultures. It’s easy to become

a member by creating a profile as a host and/or a traveler, which includes verified

identification. Guests don’t need to reciprocate by

hosting or leaving gifts, al-though lasting friendships are a common result. Hosts and guests are en-couraged to leave honest reviews for each other, which helps ensure ongoing safety and good behavior all around. Meanwhile, non-members also are welcome to explore couchsurfing events in their city. Fun opportu-nities to make new con-nections include weekly language exchanges, skill swaps, outdoor activities and potlucks. “For me, it’s undeniably about the community, the kind of

person it tends to attract,” says Joseph Abrahamson, a couchsurfer in his mid-20s. “A room full of couchsurfers is full of stories and listening and sharing and trust. It changes a person in a positive way… people that travel like this for long enough can no longer survive with closed minds.”

Lisa Rosinky is a freelance writer in Boston.

inspiration

As a traveler, offer an ethnic meal, good story or how to say hello in a different language. As a host, be open to what guests can teach. Keep a travel log and guestbook to record memories.

SPIRITASTROLOGY.COM

“To Know is to understand...”Our paths are written in the Stars.

We can help you understand yours.

*Beautiful, easy-to-interpret charts

conveniently delivered to you by email.

To Know is to understand...

Youth is the gift of nature, but age is a work of art.~Stanislaw Jerzy Lec


The Women’s Renewal Retreat, focused on self- discovery, spiritual growth, and restoring and balancing your life, will be hosted on Sunday, October 4 at a beach setting in West Haven, Connecticut.

The day starts off with relaxation exercises and a morning meditation, followed by a yoga class with Certified Yoga Instructor Sharon Rinaldo. No yoga experience is necessary. Attendees should bring their own mats, wear comfortable clothing and bring water. The retreat continues with the calming and explorative creation of individual mandalas. They are circular designs that come from your heart and soul and express your inner thoughts, feelings, wisdom and spiritual nature. Bring your own lunch, drinks and snacks (a microwave for heating and refrigerator are available). You should also bring a short poem or inspirational quote that has meaning to you and be willing to share it with the group.

Taking place from 8:30 a.m. to 5 p.m., the fee for the Women’s Renewal Retreat will be $200, which also covers workshop materials, handouts, and gift bags of renewal and inspiration upon depar-ture. Space is limited with a maximum enrollment of 12 attendees. The sign-up deadline is September 16. A waiting list will be available. The workshop will be held again for those on waiting list on October 25. If needed, a third weekend may be available with the date to be announced. Both Rose-Ann C. Chrzanowski, M.A., and Sharon Rinaldo are Reiki masters, ordained ministers and justices of the peace. In addition, Rinaldo is a certified LifeLift Solutions facilitator and a holistic counselor.

For more information, contact Sharon Rinaldo at [email protected] or 203-494-7110 or RoseAnn Chrzanowski at [email protected]. or 203-560-6332.

RENEW&

DISCOVER

Taking a Day to

Sharon Rinaldo

Rose-Ann Chrzanowski

eventspotlight


In a nutshell, that’s the philosophy of visionary women’s health expert Dr. Christiane Northrup, of Yarmouth,

Maine, as explored in her latest book, Goddesses Never Age. “We’re long overdue for a para-digm shift about how we feel about growing older,” says Northrup. “You can change your future by adopting a new, ageless attitude that will help you flourish physically, emotionally, men-tally and spiritually. We don’t have to buy into modern medicine’s promotion of the idea of the pathology of aging.” One of Northrup’s primary admo-nitions: “Don’t tell anyone how old you are. Another birthday means nothing.”

Maintain a Sound MindOur Western society fosters a belief sys-tem that we will become decrepit, frail

and mentally feeble at a certain age. “When my mother turned 50, her mail-box suddenly filled with ads for adult diapers, walkers and long-term care insurance,” Northrup quips. The point is well taken. Think vibrant, healthy, gorgeous and yes, sexy Sandra Bullock, Johnny Depp, Chris Rock and Brooke Shields—all 50 or older—as the targets of ads for Depend. We’re living and working longer, and many of us are feeling, looking and staying young longer. So is 60 the new 40? Yes, say State University of New York at Stony Brook researchers, and further note that we’re generally leading longer and healthier lives. Centenarians are the fastest-grow-ing segment of the U.S. population. In the 2010 census, 53,364 people had surpassed their 100th year, an increase

of 40 percent over the 1980 census, and more than 80 percent of them are women. The National Institute on Aging projects that this number could increase tenfold or more by 2050. What we think of as “old” has changed. Many baby boomers refuse to buy into the mythology of aging, bristle at being called senior citizens and especially dislike being called elderly. Their position is backed by science. Stem cell biologist Bruce Lipton, Ph.D., author of Biology of Belief and currently a visiting professor at the New Zealand College of Chiropractic, in Auckland, is best known for promoting the concept that DNA can be changed by belief, for good or ill. Lipton explains that we all have billions of stem cells designed to repair or replace damaged—and aging—tissues and organs. “[These cells] are pro-foundly influenced by our thoughts and perceptions about the environment,” Lipton explains. “Hence our beliefs about aging can either interfere with or enhance stem cell function, causing our physiological regeneration or decline.” “Yes, we are destined to grow older, but decrepitude and what we call aging is an optional state,” Northrup adds. “Our genes, nutrition and environment are under our control far more than we may have thought.” More, she says, “Words are powerful. Don’t talk yourself into believing your brain is turning to mush just because you are over 40.”

Take Control of the Body“Manage the four horsemen of the ag-ing apocalypse,” encourages nutrition and longevity expert Jonny Bowden, Ph.D., a Los Angeles board-certified nutritionist and author of The Most Effective Ways to Live Longer. He says the aging process, including disease, loss of physical or mental function and the general breakdown of systems, is caused by one or more of four factors: oxidative damage (literally rusty cells); inflammation; glycation (excess sugar, metabolic syndrome); and stress. “Collectively, they damage cells and DNA, wear down organs and systems, deeply damage the vascular pathways that deliver blood and oxygen to the entire body, and even shrink brain size,” explains Bowden.

AGELESS BEINGStaying Vibrant in Mind, Body and Spirit

by kathleen barnes

Agelessness: Engaging in and experiencing life without

fear of falling, failing or falling apart.


While it may seem like a tall order to make lifestyle changes that vanquish these four horsemen, Bowden says they can be broken into manageable elements by employing an arsenal of healthful weapons: whole foods, nutrients, stress-reduction techniques, exercise, detoxification and relationship improvement. “All of these actually do double duty, battling more than one of the four processes that can effectively shorten your life,” he reports, based on his 25 years of study.

Oxidative Damage Consider what rust does to metal. That’s what free radical oxygen molecules do to cells. Over time, they damage them and cause aging from within. “Oxidative damage plays a major role in virtually every degenerative disease of aging, from Alzheimer’s to cancer to heart disease and diabetes, even im-mune dysfunction,” says Bowden. His recommended key to destroy-ing free radicals is a diet rich in antioxi-dants, including lots of fresh fruits and vegetables and healthy fats, nuts, grass-fed meats and organic dairy products. Avoid environmental free radicals that show up in toxic chemicals by eating as much organic food as possible and avidly avoiding residues of the poison-ous pesticides and herbicides sprayed on crops eaten by people and livestock.

InflammationLong-term inflammation is a silent killer because it operates beneath the radar, often unnoticed, damaging blood vessel walls. Like oxidative dam-age, inflammation is a factor in all the degenerative diseases associated with aging, says Bowden. His suggestion: First, get a C-reactive protein (CRP) test to determine the levels of inflammation in our body. A CRP level over 3 milligrams/liter indi-cates a high risk of a heart attack. Anti-inflammatory foods like onions, garlic, leafy greens, tomatoes, beans, nuts and seeds have all been widely scientifically proven to reduce chronic inflammation. Glycation This is the result of excessive sugar that glues itself to protein or fat molecules, leaving a sticky mess that creates ad-vanced glycation end (AGE) products that damage all body systems and are

Compute Your Real AgeLifestyle choices can make our bodies older, or younger, than our number of orbits around the sun, according to Michael Roizen, a doctor of internal medi-cine and author of This is Your Do-Over: The 7 Secrets of Losing Weight, Living Longer, and Getting a Second Chance at the Life You Want. “Seventy percent of aging is in the simple things you do or don’t do,” he maintains.

Here are a few sobering examples:

n An unresolved major life stressor, such as a divorce, being sued, the death of a close relative or other traumatic events, can add up to 32 years to chronological age. Managing the stress adds a relatively insignificant two years.

n Swap out saturated fats (cheese and meat) for monounsaturated fats (olive oil, nuts and avocados). Subtract 2.5 years from chronological age.

n Get up out of the chair every 15 minutes and also take a 10-minute walk every two hours. Subtract 2.1 years from chronological age.

n Have close friends. Subtract 2.1 years from chronological age.

Take the Real Age test at ShareCare.com/RealAge.

acknowledged culprits in the dreaded diseases associated with aging. Bowden’s basic answer is to mini-mize intake of sugar and simple carbs; anything made with white flour or white rice. Also avoid fried dishes and any foods cooked at high temperatures that actually skip the glycation produc-tion in the body and deliver harm-ful AGEs directly from the food. He advises taking 1,000 mg of carnosine (available in health food stores) daily to prevent glycation. StressThe long-term effects of physical, men-tal or emotional stress are tremendously damaging to the human physiology. Sustained exposure to the stress hor-mone cortisol can shrink parts of the brain, damage blood vessels, increase blood sugar levels, heart rate and blood pressure and contribute to chronic inflammation, according to well- established science recorded in the U.S. National Library of Medicine. Bowden warns, “Stress manage-ment is not a luxury.” In its many forms, including prayer, meditation and breathing exercises, it should be part of any agelessness program. Deep, restful sleep is as vital a component as ending toxic relationships, having a nurturing circle of friends and doing familiar, gentle exercise such as yoga or tai chi. Overall, Bowden adds, “Rather than thinking of such endeavors as anti-aging, I strive to embody the concept of age independence. I admire former Supreme Court Associate Justice John Paul Stevens, who resigned from the court when he reached age 90 because he wanted to play more tennis.” Bowden recommends embracing the concept of “squaring the curve”, meaning that instead of anticipating and experiencing a long downhill slope of poor health leading to death, “I look at a long plateau of health, with a steep drop-off at the end.” Wellness guru Dr. Michael Roizen, chair of the Cleveland Clinic’s Well-ness Institute, contends that although our chronological age can’t be changed, “Your ‘real age’ [calculated from data he collected from 60 million people] is the result of a wide variety of factors that are within your control. Dietary choices alone can make you


13 years younger or older than your actual age.” Roizen adds un-controlled portion sizes, tobacco use and physical inactivity to the list of life-shortening lifestyle options.

Align with Spirit“If you don’t have some kind of spiritual foundation, literally, God help you,” says Northrup. “God isn’t con-fined to a book or a church, mosque or synagogue. Divinity is the creative loving, vital flow of life force that we’re all part of and connected to. Our bodies are exquisite expressions meant to embody, not deny our spirits.” Touch, pleasure and sex can be part of it, too. Individuals that have the most fulfilling sex lives live the longest, according to researchers conducting the University of California, Riverside’s Longevity Project. “Pleasure comes in infinite forms,” says Northrup. “It can mean the exquisite taste of a pear or the sound of an angelic symphony, the kiss of sun on skin, the laughter of a child, spending time with friends or creating a pastel landscape. When you experience pleasure, God comes through and you become aware of your divine nature.

Age-Defying Exerciseby kathleen barnes

Specially designed movements performed to music can dramatically improve memory, as well as slow the process of physical aging, according to Denise

Medved, of Hendersonville, North Carolina, the founder of Ageless Grace. Medved’s foundational physical and mental exercise classes involve 21 ex-ercises that promote brain plasticity by activating all five functions of the brain: analytic, strategic, kinesthetic learning, memory/recall and creativity and imagi-nation. Find videos of Ageless Grace exercises by searching YouTube, including this one:

n While sitting in a chair (all exercises are taught in this position to develop core strength), make a circle with the right lower arm.

n Add a triangular motion with the left foot.

n Next, add a horizontal movement with the left hand.

n Finally, do the entire series in reverse.

Classes are available in all 50 states and in 12 countries. To find a teacher nearby, visit AgelessGrace.com.

You’ll find that joy comes in ways that are unique to you.” Connection with the natural world is an essen-tial element of agelessness, says Northrup. “The human body evolved to walk on the Earth, drinking its water, breathing its air and basking in its sunlight.” The bottom line is, “Agelessness is all about vitality. Taking all the right supplements and pills, or getting the right proce-

dure isn’t the prescription for anti-aging,” says this renowned physician. “It’s ageless living that brings back a sense of vibrancy and youthfulness.” We could live to be well over 100 years old and, as Northrup likes to paraphrase Abraham Hicks, of The Law of Attraction fame, “Wouldn’t you rather have your life end something like this: ‘Happy-healthy, happy-healthy, happy-healthy, dead.’ Isn’t that a lot bet-ter than suffering sickness, decrepitude and frailty for years?”

Kathleen Barnes is the author of numer-ous books on natural health, her latest being Food Is Medicine: 101 Prescrip-tions from the Garden. Connect at KathleenBarnes.com.

COMBINED EFFORTS CREATE RESULTS

To advertise or

participate in our

next issue, call

203-988-1808

JOIN US! How does your product, service

or project support our local or

global community? Be a part

of our special Working Together

October Issue


salonandspaprofiles

AVANT GARDE Salon, Spa, Holistic Center & Eco-Friendly Fair Trade Boutique

328 East Main Street, Branford, CT 203-481-8443 [email protected] AvantGardeCT.com

Summary of services/products offeredFull range of hair care, skin care & spa services and holistic services. Color, cut and styling, relaxers, perms, high lights, facials, Reiki, massage, guided meditation, shamballa, shamanic practices, medium/psychic readings, holographic sound healing, Kirtan, drum circles. Please call for additional services, classes and events.

What is different about the services and products you offer?Avant Garde is the only center that addresses our three part being: Body, Mind and Spirit. Once you arrive, you will feel the difference. The ambience is reminiscent of a Mediter-ranean retreat which include the Zen room, Buddha room, Ganesha room and Ares room. We create a state of well-being and peace that radiates from the inside out. Our boutique showcases the largest selection of eco friendly, fair trade, metaphysical and new age items, jewelry and gift items with 10% of each sale donated to the local animal shelter. Every item is attached to charitable causes. Areas of special training and/or certificationOur team of experts have trained nationally and internationally with countless awards and special certifications. We have been in business for over 33 years.

Are you planning any enhancements, changes or new products in in 2015-16? Avant Garde’s staff are always attending advanced training to stay current and our boutique receives new inventory from all over the world on a monthly basis. We pride ourselves in offering natural alternatives in hair and body care and are always adding to our lineup of events with classes in natural living, concerts, work shops and various holistic events.

What do you most want Natural Awakenings’ readers to know about your business, products or services? Avant Garde address your physical, spiritual, emotional well being, restoring balance and harmony into your life. Our facility is on three floors. If you are looking to create peace, happiness, enlightenment, spirituality and caring for your physical wellness, look no further. We are a one-stop oasis. Relax and enjoy the Avant Garde experience! Emerge calm, radiant and revitalized.

JADAK HAIR RESTORATION102 Wall Street, Madison, CT203-859-0605 [email protected] JadakHairRestoration.com Member of Ivolve Volumizers

Summary of services/products offered Jadak Hair Restoration is a beauty salon which offers wide range of hair services including sophisticated hair cuts, different techniques of hair coloring, hair exten-tions and the complete, non-surgical, eco-friendly solution for hair thinning or significant hair loss.

What is different about the services and products you offer?Jadak Hair Restoration is entirely dedicated to women of all ages to help with the problem of hair loss.

Areas of special training and/or certificationAgnieshka Jadak, owner and operator of Jadak Hair Restoration, was educated and trained in Europe and has been working in the U.S. for 25 years as a licensed hairdresser, specializing in thinning hair, restoration and makeup. Certified in Tape Hair Extensions by Perfectress.

Are you planning any enhancements, changes or new products in in 2015-16? Our latest technique for hair restoration is using a human hair volumizer attached in a semi permanent way without the use of a wig, chemicals or adhesives (no glue used). This hair system completely blends with the rest of your hair, so you can treat it as your own hair (ie. can shampoo your hair in the shower, blow-dry and style as you normally would).

What do you most want Natural Awakenings’ readers to know about your business, products or servicesFeeling good and looking great is our motto. Jadak Hair Restoration is the connection between a physician and a hairdresser. When modern medicine doesn’t work and your hairdresser reaches the limitation of their work, this is when Jadak Hair Restoration can help to restore your natural hair thickness as you always wanted. Jadak Hair Restoration is a member of The American Hair Counsel, which meets at an annual conference where we share the latest advances with the whole industry. You can successfully win the hair loss battle and restore your look and self-esteem with this new alternative treatment for hair loss!

Avant Garde

AvantGardeCT.com

328 East Main StreetBranford, CT 06405

203-481-8443

Pamper, Shop & RestoreIntro Offer

Spa AromatherapyFacial for $35

(Regular Price $55)

Visit our website to learn about our classes & events. Receive special invites by joining our email list. Salon • Spa • Boutique • Holistic Center

Free Gift with any boutique purchase with this ad

Largest selection of fair trade, eco-friendly, new age, unique gifts & jewelry


A recent Harris Interactive poll indicates that only one in three Americans are happy. Success,

education and increases in annual household income create only margin-ally more happiness. So what will it take to go the distance? Inspiration for a Woman’s Soul: Choosing Happiness endeavors to discover just that. Its collection of intimate stories from more than two dozen women reveals telling insights—most profoundly, that happiness is a choice that anyone can make, regard-less of their history or circumstances. Four tips from contributors to the book show how we all can rise up out of our troubles to the other side, shining.

Let Go of ‘Supposed To’Family, friends and society exert pres-sure on us to achieve certain goals or impose their definition of success. When our soul doesn’t fit the mold, exciting things can happen. Happiness strategist Kristi Ling seemed to have it all: a high-powered job in Hollywood, significant income and the envy of all her friends—but her

choose happinessFour Tips to Flip the Joy Switch

by Linda Joy

healingways

success felt empty. She writes from her home in Los Angeles, “Each morning I’d get up thinking about who I needed to please, and then prepare myself to exist for another day. I looked and felt exhausted just about all the time. The worst part was that I thought I was do-ing everything right!” After a middle-of-the-night epiph-any, Ling left her job and set out to discover what her heart wanted. She began following a completely differ-ent life path as a coach and healer, in which success means manifesting joy. Be Grateful NowWhile we’re striving to change our life or wishing things could have been dif-ferent, we often forget to pay attention to what we have right now. Boni Lonnsburry, a conscious creation expert and founder/CEO of Inner Art, Inc., in Boulder, Colorado, writes about the morning she decided to choose happiness, despite the enormous challenges she was facing, including divorce, foreclosure, bankruptcy and possible homelessness. “I thought to myself, ‘Yes, my life could be better, but it also could be a hell of a lot worse. I’m healthy and smart—why, I even have some wisdom. Why am I focusing on

how terrible everything is?’” Using the power of her choice

to be happy right now, Lonns-burry not only found joy

amidst the adversity, but created love and success beyond her

wildest dreams.

Let Love InWe all want to

feel loved, but when we’re afraid of getting hurt, we put up barriers to

an unforgettable,

LivingWithoutLimits.com

discovery, freedomexperiential evening of

and power!

Join for FREE! VisitNaturalAwakeningsSingles.com

Meet YourSoul Mate

on NaturalAwakeningsSingles.com


protect ourselves, even against the love we want. Certified Relationship Coach Stacey Martino, of Yardley, Pennsylvania, writes, “From the first day we met, I’d been waiting for [my boyfriend] Paul to end our relationship. I begged him for another chance—not for our relationship, but to be my authentic self—to figure out who I am and show up in our relationship as the real me.” Fourteen years later, Martino and her boyfriend, now husband, are still exploring the depths of their love for one an-other. For them, the choice to be vulnerable was the gateway to happiness.

Look Inward Instead of to Others If we can’t own our pain, how can we create our joy? Choosing happiness means taking full responsibility for our state of mind, with no excuses. Lisa Marie Rosati, of Kings Park, New York, who today helps other women catalyze their own transformation, writes: “I didn’t want to accept what was going on inside [me], so I looked outside for a way to make things better. I depended on intimate relationships to complete me, and on friends and acquaintances for entertainment. My self-esteem floated on incoming compliments and I absolutely never wanted to spend a minute alone with my own thoughts, lest they erode what-ever happiness I possessed at the moment. I was exhausted, frustrated and quite frankly, pissed off.” It took a flash of insight to set Rosati free of her pat-terns of blame—and then realizing she could create her own fulfillment was all it took to catapult her into a place of empowerment. Look out, world! As Los Angeles happiness expert and Positive Psychol-ogy Coach Lisa Cypers Kamen says, “Happiness is an inside job.” Joy, love and inspired living are ours for the taking—all we must do is choose.

Linda Joy is the heart of Inspired Living Publishing and Aspire magazine. Inspiration for a Woman’s Soul: Choosing Happi-ness is her third in a series of bestselling anthologies. Next up is Inspiration for a Woman’s Soul: Cultivating Joy. Learn more at InspiredLivingPublishing.com.

Reaching The Harmony Within

Akashic Records Classes / ConsultationHealing Touch / Arcturian / Meridian Therapy

203-228-1777 on FBreachingtheharmonywithin.com

reachingtheharmonywithin.com

Certified LifeLift CoachReiki MasterCounselor – Individual, Group, GriefLife Enhancement GroupsJustice of the Peace/Ordained Minister(Unique, personalized wedding ceremonies)

CHANGE YOUR BELIEFS CHANGE YOUR LIFE

LIFELIFT SOLUTION EXPERIENCEExperience freedom from untrue painful beliefs

Experience your TRUE NATURE

Continuous Creativity

Divine Love

Joy

Sharon Rinaldo, M.A. [email protected]

(203) 494-7110

™

REIKI | REFLEXOLOGY | READINGS | MEDITATION | ANGELSPEAKE™EMOTIONAL FREEDOM TECHNIQUE | AROMATHERAPY | MOTIVATIONAL SPEAKING

Diane C. Esposito, RMT/Holist ic Coach

Call for Your Complimentary Consultation

203-913-3869personalharmonyandhealth.com


consciouseating

With the demand for seafood outpacing what can safely be harvested in the wild,

half the seafood we eat comes from aquaculture, says Kathryn Sullivan, Ph.D., administrator for the National Oceanic and Atmospheric Administra-tion (NOAA). Yet, farmed seafood has a reputa-tion for uneven quality and question-able farming practices. A primary rea-son is that much of what Americans buy comes from Asia, where aquaculture is less stringently managed. Meanwhile, domestic aquaculture provides only about 5 percent of the seafood con-sumed here, according to NOAA.

Safe Seafood SolutionsIf we want to eat safer, sustainable, farmed seafood, there are two solu-tions. One is to purchase farmed fish raised in the U.S., says Sullivan. The agency’s FishWatch consumer informa-

tion service assures: “If it’s harvested in the United States, it’s inherently sustainable as a result of the rigorous U.S. management process that ensures fisheries are continuously monitored, improved and sustainable.” Whole Foods Markets have found that farming seafood (aquaculture) can provide a consistent, high-quality, year-round supply of healthy and deli-cious protein. Accordingly, “When it’s done right, aquaculture can be environmentally friendly and offer a crucial way to supplement wild-caught fish supplies. On the other hand, poor farming practices such as the overuse of chemicals and antibiotics and those that cause water pollution and other negative impacts on the environment are bad news.” A second solution is to consult with a trusted fishmonger that has high standards for flavor, health, safety, sus-tainability and environmental concerns.

The Green Fish FarmerChefs like Rick Moonen, who owns RM Seafood, in Las Vegas, are getting behind U.S. aquaculture farms that do it right, raising healthy, sustainable and delicious fish. Moonen recently became a brand ambassador for True North Salmon, a farm system that integrates the way nature keeps fish healthy and fresh. “They have a salmon farm near a mussel farm near a kelp farm, mimick-ing the way these three species interact in the wild,” says Moonen. The best seafood farms take what geography and climate offer—ocean inlets, a natural spring and a natural de-pression in the land or indoor controlled freshwater tanks—and use clean feed. With no antibiotics, non-GMO food (free of genetic modification) in the right ratio, good water quality and creative ways to use the effluent, they employ green farming practices to raise fish and shellfish that, in turn, are healthy to eat. The Atlantic coasts of Maine and Canada are where families have been making their living from the sea for cen-turies, says Alan Craig, of Canada’s True North Salmon Company. “The fish are fed pellets made from all-natural, non-GMO sources with no dyes, chemicals or growth hormones added. Underwa-ter cameras monitor the health of the fish to prevent overfeeding.” True North Salmon follows a three-bay system, similar to crop rotation on land. Each bay is designated for a particular age of fish: young salmon, market-ready fish and a fallow, or empty, bay, breaking the cycle of any naturally occurring diseases and parasites. Robin Hills Farm, near Ann Arbor, Michigan, offers vegetable, meat, egg and fruit community supported agricul-ture, U-pick fruit and a pair of stocked farm ponds. Farm Manager Mitzi Koors explains that the ponds are a way to leverage natural resources, add another income stream and attract visitors. “We first discovered a low-lying area that would become a beautiful pond with a little work,” Koors relates. “We then expanded to two close ponds that don’t connect, to keep the older fish raised on at least six months of non-GMO organic feed separate from the newer fish. The ponds are spring fed, providing a great environment for trout.”

SURF TO TURFU.S. Farmed Seafood That’s

Safe and Sustainableby Judith Fertig

Wild-caught fish from pure waters is the gold standard of seafood, but

sustainable populations from healthy waters are shrinking. That’s one

reason why fish farms are appearing in unusual places—barramundi

flourish on a Nebraska cattle ranch, shrimp in chilly Massachusetts and

inland tilapia in Southern California.


In northeastern Nebraska, five generations of the Garwood family have traditionally raised cattle and produced corn and tomatoes. To keep the farm thriving and sustainable, they have had to think outside the row crop. Today, they’re growing some-thing new—barramundi, or Australian yellow perch. They built a warehouse that now holds 18, 10,000-gallon fish tanks full of growing fish. A Maryland company provides old-fashioned cow manure and leftover grain sorghum from area ethanol plants to create algae, naturally non-GMO, to use as biofuel and fish food. “People prefer to eat locally raised food, even if it’s fish in Nebraska,” says Scott Garwood. The sophistication of closed con-tainment systems like the Garwoods use means that chefs, too, can raise their own fish, besides growing their own herbs and vegetables. California Chef Adam Navidi, owner of the Oceans & Earth restaurant, in Yorba Linda, also runs nearby Future Foods Farms, en-compassing 25 acres of herbs, lettuces, assorted vegetables and tank-raised ti-lapia. Baby greens, not GMO products, help feed the fish, while nitrates from the ammonia-rich fish waste fertilize the crops. The fish wastewater filters through the crops and returns to the fish tanks in an efficient, conservation-driven system that produces healthy, organic food. “Someday, chefs will be known both by their recipes and the methods used to produce their food,” Navidi predicts.

Judith Fertig blogs at AlfrescoFoodAnd Lifestyle.blogspot.com from Overland Park, KS.

Physical Therapy Services of Guilford • 500 East Main Street • Branford 203-315 7727 • PhysicalTherapyGuilford.com

1. Will my PT work ONLY with me during my treatment?

2. Will I ONLY be doing exercises during my treatment?

ABSOLUTELY! At Physical Therapy Services of Guilford,

No. Your physical therapist will be using hands-on techniques to relieve your pain and will provide youwith exercises to do at home.

we are one of the few remaining practices that spend 40 minutes, one-on-one, with YOU and ONLY YOU.

2 IMPORTANT QUESTIONSTO ASK WHEN SEEKING A PHYSICAL THERAPIST

Order online today atShopNaturalAwakenings.com

or call: 888-822-0246

Boost Your Mood and Energy Levels!One Serving Has the Equivalent Antioxidants

of Four Servings of Fruits and Vegetables.Made with certified-organic, non-GMO, Paleo profile ingredients, Natural Awakenings Green Powder supplement nourishes and strengthens every system in your body, providing support for:• DIGESTION & GASTROINTESTINAL FUNCTION• CIRCULATION & CARDIOVASCULAR FUNCTION• REGULATING BLOOD SUGAR & CHOLESTEROL• STRONGER IMMUNE SYSTEM• BALANCED, HEALTHY NUTRITION

9.5-oz jar $54.99 (30-day supply) plus $5 for shipping

Like us on Facebook at Natural Awakenings Webstore

Farmers MarketsOpen

AUGUST7 • 14 • 21 • 28

SEPTEMBER4 • 11 • 18 • 25

OCTOBER2 • 9 • 16 • 23 • 30

NOVEMBER6 • 13 • 20

FRIDAYS11AM–2PM

56 Broadway — Parking On Site

Vendor Information: 203-856-8534

• Fruit & Vegetables• Gourmet Foods• Honey & Maple Syrup

BroadwayOpenMarkets.com bwayopenmkts

You can’t help getting older, but you don’t have to get old.

~George Burns


fitbody

After practicing internal medicine for 10 years in Boston, Dr. Timothy McCall became a

full-time writer, exploring the health benefits of yoga. As the medical editor of Yoga Journal and the author of Yoga as Medicine: The Yogic Prescription for Health and Healing, he says, “In the late 90s, the conveyor belt of patient care continued to speed up and I got frustrated. There was less time to form relationships with patients, which is essential to providing quality care without excessive tests and drugs.” Initially, McCall found that most of the documented research on yoga was from India, and notes it was low in quality from a Western perspective (though it is now excellent). In the West, the first notable scientific yoga article was published in 1973 in The Lancet on combining yoga and biofeed-back to manage hypertension. Accord-ing to the International Journal of Yoga, the surge in yoga’s popularity here fi-nally gained academic interest in 2007, and there are now more than 2,000

yoga titles in the National Institutes of Health PubMed.gov database, with 200 added annually. Initially, yoga teacher and econo-mist Rajan Narayanan, Ph.D., founded the nonprofit Life in Yoga Foundation and Institute to offer free teacher training. Within a couple of years, the foundation’s focus shifted to integrat-ing yoga into the mainstream health-care system. “We realized that to make a real difference, we needed to teach doctors about yoga and its scientifi-cally proven effects,” he says. Medical providers can earn credits to keep their licenses current by attending courses by Life in Yoga, the only yoga institu-tion independently certified by the Accreditation Council for Continuing Medical Education. Currently, even if physicians don’t practice yoga, it’s likely that many of their patients do. “You now see it every-where from major medical centers to mainstream advertising,” says McCall, who notes an increase in doctors, nurses and therapists attending the Yoga as

Yoga Enters the Medical MainstreamResearch Proves its Health Benefits

by Meredith Montgomery

SusaneGrasso

R E I K I M A S T E R

Relaxation Therapy

Chakra Balancing

Aura Readings

203.500.6950

2489 Boston Post RoadSuite F

Guilford CT 06437

Wrinkles should merely indicate

where smiles have been.

~Mark Twain


Medicine seminars he and his wife Eliana teach inter-nationally and from their Simply Yoga Institute studio, in Summit, New Jersey.

Mounting Evidence“Yoga may help prevent diseases across the board be-cause the root cause of 70 to 90 percent of all disorders is stress,” says Narayanan. Yoga increases the body’s ability to successfully respond to stress by activating the parasympa-thetic nervous system, which slows the heart and lowers blood pres-sure. That in turn suppresses sympathetic activity, reducing the amount of stress hormones in the body. Studies collected on PubMed.gov demonstrate that yoga has been found to help manage hypertension, osteoporosis, body weight, physical fitness, anxiety, depression, diabetes, reproductive functions and pregnancy, among other issues. Studies at California’s Preven-tive Medicine Research Institute have tracked amelioration of heart disease. A growing body of research is validat-ing yoga’s benefits for cancer patients, including at the University of Texas M.D. Anderson Cancer Center. A small study at Norway’s University of Oslo suggests that yoga even alters gene expression, indicating it may induce health benefits on a molecular level.

Cultural Challenges“For yoga to be effective, a regular practice must be implemented, which is challenging in a culture where people can’t sit for long without an electronic device. It’s more than just popping pills,” says Narayanan. McCall says, “Even if people can commit to just a few min-utes of yoga practice a day, if they keep it up the benefits can be enormous.” “There are no sales reps telling doctors to use yoga

therapy like there are for pharmaceuticals,” remarks Narayanan, and until yoga is funded by health insur-ance, it will be challenging to gain full acceptance in mainstream medicine. Another barrier is certification standards. The International Association of Yoga Therapists (iayt.org) and the Council for Yoga Accreditation Inter-national (cyai.org) are both beginning to offer certifica-tions for therapy training

programs and therapists. Narayanan is hopeful that certification could lead to yoga being covered by insurance. Medical school curricula have started shifting to embrace complemen-tary approaches to wellness, with many textbooks now including information on mind/body therapies. The Principles and Practices of Yoga in Healthcare, co-edited by Sat Bir Khalsa, Lorenzo Cohen, McCall and Shirley Telles and due out in 2016, is the first professional-level, medical textbook on yoga therapy. “Yoga has been proven to treat many conditions, yet yoga teachers don’t treat conditions, we treat individ-uals,” says McCall. “Yoga therapy is not a one-size-fits-all prescription because different bodies and minds, with differ-ent abilities and weaknesses, require individualized approaches.” While medical research is working to grant yoga more legitimacy among doctors, policymakers and the public,

McCall says, “I believe these studies are systematically underestimating how powerful yoga can be. Sci-ence may tell us that it decreases systolic blood pressure and corti-sol secretion and increases lung

capacity and serotonin levels, but that doesn’t begin to capture the totality of what yoga is.”

Meredith Montgomery, a registered yoga teacher, publishes Natural Awakenings of

Mobile/Baldwin, AL (Healthy

LivingHealthy Planet.com).

Any physical exercise done with breath awareness becomes yoga; anything done without the breath is just a physical practice.

~Rajan Narayaran

When Yoga Can Help

4 Addictions4 Anxiety spectrum disorders4 Back pain4 Cancer4 Depression4 Diabetes4 Endocrine issues4 Heart disease 4 Hypertension4 Mental health conditions4 Metabolic syndrome4 Musculoskeletal and neuromuscular complaints4 Neurological and immune disorders 4 Pregnancy issues4 Premenstrual syndrome, perimenopausal symptoms4 Respiratory issues4 Weight management

September is National Yoga Month

Angels, Aura Sprays, Books, Candles, Cards, CDs, Christian and Jewish Gist Items, Classes,

Crystals, Essential Oils, Fair Trade Items, Incense,

Intuitive Readings, Jewelry, Journals, Oracle Cards,

Sacred Image Cards, Singing Bowls, Wind Chimes, Word Stones

A Specialty Gist Shop

203-453-4000Strawberry Hill Plaza 1250 Boston Post Rd

Guilford, CT 06437

www.enchantedguilfordct.com

Spiritual and Specialty Gists


It is common today for many people to use yoga as an exercise and as part of their workout program. There is

no doubt there are great benefits to be gained from very active “yang” styles of yoga like Vinyasa and Ashtanga. However, a gentler, more flexible and perhaps more complete yogic system is sometimes needed as you feel the effects of chronic stress, incur injuries or simply experience the process of aging. Enter the history of Yin Yoga; it is a soft style of yoga derived from the Taoist Yoga practice with relaxed postures done mostly on the floor. “Yin Yoga is based on the Taoist concept of yin and yang—Yin can be described as stable, immobile—passive, downward moving,” states the “Slow Down with Yin Yoga” article published in Yoga Journal in October 2008. In comparison to a Yin Yoga class, a Taoist Yoga practice includes development of

both yin and yang energies. In the Taoist system, gentle postures are preceded and followed by much more vigorous sequences to super-charge one’s vital energy, or “Qi.” There are sequences to activate and circulate Qi within all the major meridians, or energy pathways, in the body. Eventually, in Taoist practice, these active “yang” sequences, together with relaxed “yin” postures, are believed to balance both types of energies, creating a more unified whole. Additionally, Taoist yin-style postures are unique because they each represent an elemental energy of water, wood, fire, metal or earth. The postures are performed in sequences that mimic the natural cycle of these five elements in nature; it is a true reflection of the Taoist ideal where the microcosm is contained in the macrocosm. The five elements of Taoist Yoga, rather than serving as

diagnostic tools (as they are used in acupuncture and traditional Chinese medicine), instead generate posture sequences that constitute a holistic method of caring for one’s health. Along with breathwork, medita-tion and vigorous yang-style sequences, the postures of Taoist Yoga can be thought of as an original preventative healthcare system, one which entices all five elements into harmony. Martial arts master Paulie Zink may have been the first in the United States to apply this technique in the 1980s when he taught his student, Paul Grilley, a type of Taoist Yoga with longer-held postures. To Grilley, these postures seemed like the yin answer to the more active yang styles of yoga. According to YinYoga.com author and teacher Bernie Clark, “He [Grilley] started offering this ‘all-yin’ practice to his Hatha Yoga students, and they

The Tao D

of Yin Yoga

“If Yin Yoga is the child, Tao Yoga is the mother.”

~ Taoist Master Hyunmoon Kim

by christine ucich


One World for Personal Growth, Natural Healing, Taoist Yoga Meditation

CERTIFICATE PROGRAMSTao Yoga Assistant Instructor Breathwork Integration Coach

One World Wellness & Yoga 967 North High St. East Haven CT LEARN MORE AND APPLY www.oneworld-wellness.com

Do you want to learn to share healing breathwork and mindful yoga with others?

Help Build Tao Yoga’s Next Generation of Exceptional Teachers

too began to resonate with the prac-tice.” Moving forward into the 1990s, Grilley’s student, Sarah Powers, coined the name “Yin Yoga” to replace the title Taoist Yoga, the style that was that was originally practiced and taught by Zink. Before the 1980s, the origins of Taoist yoga are a matter of some debate. Some claim it is a form of Taoist Qigong, while others think it is a modi-fication of Indian yoga practices. Louis Komjathy, Ph.D., professor of religious studies at Boston University, “believes the term Taoist Yoga to be a misnomer, because there is no yoga to be found in Taoist philosophy.” Alternatively, there are many accounts of solitary wander-ing Taoist sages in ancient times who were adept at martial arts and breath cultivation practices known as inter-nal alchemy. The practice of Taoism itself can be classified into four main categories: folk, religious, philosophi-cal and mountain Taoism. Mountain Taoist sages are sometimes associated with the sacred mountain ranges where they dwelled. Taoist hermits, as well as Buddhist monks and Shamans, can still be found today practicing meditative arts in the temples and remote caves of mountains in both China and Korea. Some Korean Taoist hermit practices are “yogas” and are actually referred to as dan-tien ho hup practices which involve postures, breathwork and meditation. While some of the postures

are exactly the same as many Yin Yoga postures, the breathwork in Taoist Yoga, however, is primary. In Korean Taoist Yoga, the developing stages of practice are identified by the strength and depth of a practitioner’s breathing. Other qualities similar to Yin Yoga include postures with longer hold times of about 1-3 minutes, very relaxed poses for beginners, and an emphasis on deep breathing. One style of Taoist Yoga, named SunDo, translates to “refining Qi energy through breathwork.” It is a practice which dates back thousands of years to hermits practicing in the mountains, passing on their lineage from teacher to student. One SunDo master emerged from his secluded life in the Korean mountains in the late 1960s, and began to teach the practice in society. His sanctioned adepts then traveled the globe teaching the practice, one of whom is Taoist Master Hyunmoon Kim. Upon arriving here in the U.S., Master Kim founded one of the first SunDo Taoist Yoga centers here in Connecticut. The year was 1979. Although the origin of the exact style of Taoist Yoga taught by Paulie Zink re-mains a mystery, it is the practice from which modern Yin Yoga was derived. However, just as total yogic health is not always gained through yang styles alone, it would be a mistake to be-lieve it can be gained only through yin

practice. Once a part is removed from the whole, the part itself, in many ways, may become inadequate. This year, One World Wellness & Yoga opened its doors to feature basic through advanced classes in Taoist Yoga. The center is currently accept-ing students for the Tao Yoga Teacher Training Program certified by SunDo International. Beginning in October, the training focuses on postures, breath-work, anatomy/physiology, meditation, chakras, energy anatomy and Tao Yoga for special needs. The program also offers two days of traditional Chinese medicine studies with a licensed acupuncturist covering topics such as meridian theory, primary acupressure points, and causes/disruptions of Qi imbalance. Tao Yoga teacher training prepares current or future yoga teachers to attain assistant instructor status at One World Wellness & Yoga and/or a certificate as a breathwork integration coach to facilitate healing breath sessions with students or clients. To enter the Tao Yoga Training Program, visit OneWorld-Wellness.com to download an application or call 203-998-5688 for more information. One World Wellness & Yoga is located at 967 North High St., East Haven, CT. See ad below.


wisewords

Alexandra Paul on Vegan ActivismHer Kind Lifestyle Honors

All Living Thingsby gerry Strauss

It may seem odd that one of the most intensely dedicated

public activists is also known for starring in one of TV’s most superficial shows of the 1990s, but Alexandra Paul overturns stereotypes. Behind that signature Baywatch one-piece that kept David Hasselhoff on his toes beats the heart of a true soldier for animal rights and population stabilization. At 52 years young, she is extremely fit and knowledgeable about the vegan lifestyle that got her there.

What is your philosophy of life? Be kind. Being kind is different from being nice. I spent my teens and 20s anxious to be nice, and all it gave me was a boatload of acquaintances and an inauthentic self. Nice aims to be popular. Kindness is about doing the right thing: justice, fairness, patience, respect. Kind-ness is at the heart of why I’m a vegan, and why I’ve been arrested 16 times for civil disobedience supporting peace, equal rights and the environment. Being kind to myself inspires me to exercise and live healthfully. How has activism forged your identity and inspired others?I’ve been an activist since I was 7, when I wrote to President Nixon asking him to stop pollution. As a dedicated citizen, my mom boycotted companies that acted against her ethics. Growing up with such a role model, trying to

make the world better came naturally. Walking my talk is a challenge I face daily as I choose what to buy, what to eat and how to be, and I also think it is the most effective way to encour-age change in others. What drives your commitment to a vegan diet?

I became a vegetarian when I was 14, after reading Frances Moore Lappé’s Diet for a Small Planet, which taught me how eating meat was destructive to the planet. A couple of years later, I did a book report on Peter Singer’s Animal Liberation and learned the ethical rea-sons against eating animals. I stopped using cosmetics tested on animals when I was a teen and stopped wear-ing leather, wool and silk in my 20s. I finally gave up eating dairy in my late 40s, and I wish I’d done it earlier. Although I did it to benefit ani-mals, being vegan has enriched my life and changed the way I look at the world. The only way there will be enough food and water for Earth’s expected 10 billion people in 35 years is if humankind stops raising animals for food, so my veganism is helping the planet, as well as my own health.

Which other aspects of your diet and lifestyle do you credit for looking and feeling vital?My husband Ian and I go to bed early and generally get up with the sun.

phot

o by

Den

ice

Duf

f

ANSONIANATURECENTER

104 acres of wooded hillsand grassy fields,

miles of nature trails,streams, a two-acre pond,

wet meadows, upland swamp, butterfly& hummingbird garden,

woodland wildflower and fern garden,

community gardening,childrens’ playscape,

visitor center,animals & nature exhibits,

classes and more!

(203) 736-1053AnsoniaNatureCenter.org


I’ve never consumed coffee, soda or alcohol, only water and protein shakes. I believe being a vegetarian, and now a vegan, has given me tons of energy. I also prioritize making time for my workout routine, and that helps me feel good every day. I didn’t always have this seren-ity with my lifestyle and health. For a dozen years, until my late 20s, I struggled with bulimia. Becoming vegan improved my relationship with food, aligning my diet with my values, and I have never been more at peace with myself.

Why do you enjoy working out?For me, being active is fun—not only because I feel good moving my body, but because I am also outside with friends, reading on a stationary bike or listening to favorite podcasts while stretching. Six days a week, I do an hour of cardio; either swimming or the station-ary bike. Every other day I practice yoga for at least 45 minutes to ensure that my back stays pain-free. Once a week, I go hiking for two hours with friends, chat-ting the whole time, which all makes it worth getting up at 4:30 a.m. I walk whenever I’m on a conference call, either outside or at my tread desk, a simple treadmill under a standing desk; I’m walking on it when I’m reading or answering emails, too. It’s the best pres-ent I ever gave myself. Like everyone, sometimes I don’t particularly feel like working out, but all these factors make it easier to start, and once I start, I’m always glad to be exercising.

Gerry Strauss is a freelance writer in Hamilton, NJ. Connect at [email protected].

Angel Card Readings

Real peace is always unshakable... Bliss is unchanged by gain or loss.

~Yogi Bhajan

The Natural Choice – The Breiner Whole-Body Health Center Naturopathic Physicians Offering the Best in Holistic Healing

Drs. Adam Breiner, Elena Sokolova, and David Brady

Get your health back in balance naturally with proven treatments & therapies.

FREE CDs on our approach to Lyme Disease

Watch our therapy videos on our website!

in Fairfield, CTWholeBodyMed.com • 203-371-8258

Mercury-free for over 30 years, Dr. Breiner is a pioneer and recognized authority

Mark A. Breiner, DDS, FAGD, FIAOMTSpeaker and best-selling author of Whole-Body Dentistry®

Whole-Body Dentistry® provides comprehensive oral health care using traditional and holistic approaches. We understand the “mouth-body connection.”

The Natural Choice – The Breiner Whole-Body Health Center Optimize Your Smile and Your Health!

WholeBodyDentistry.com • 203-371-0300501 Kings Highway East, Suite 108, Fairfield, CT 06825


naturalpet

Key colorful foods, packed with nu-trients, protect against eye problems ranging from progressive retinal atrophy

and uveitis to cataracts and glaucoma. Here are 10 foods that are highly regarded in helping prevent and defend against vision problems. Their eye-worthy nutrients include anthocyanins, beta-carotene, carotenoids, glutathione, lycopene, omega-3 essential fatty acids, phytonutrients—and the special partnership of lutein and zeaxanthin, sometimes referred to as “sunscreen for the eyes”. An easy way to serve these power-packed foods is as a mash. Simply combine a few cups of fruits and vegetables in a food processor with a half-cup of filtered water and blend as a raw pet meal topper. For a cooked topper, chop the fruits and vegetables and place in a medium sized sauce pan with the filtered water and a couple tablespoons of first-pressed olive oil. Simmer gently, cool and serve. Maybe top it all off with a fish or egg. Blueberries contain two eye-healthy carotenoids: lutein and zeaxanthin. They also deliver anthocyanins, eye-nourish-ing phytonutrients known to support night vision, according to a study published in the Journal of Biomedicine and Bio-technology. University of Oklahoma research suggests that flavonoids like the rutin, resveratrol and quercetin in blue-berries may help prevent retinal atrophy. Their selenium and zinc components also support vision, according to a study from the National Eye Institute. Eating blueberries has even been associated with the reduction of eye fatigue, according to The Journal of Agriculture and Food Chemistry. Broccoli’s anti-cancer benefits are well known, but it’s also recognized as one of the best vegetables for eye health. A good source of lutein and zeaxanthin, it’s also packed with beta-carotene. Don’t leave the leaves behind, because they contain even more beta-carotene than the stems and florets. Researchers at Johns Hopkins School of Medicine have found that broccoli and broccoli sprouts protect the retina from free radical damage, which may be due to a compound called sulphoraphane that boosts the body’s defense against free radicals.

EYE HEALTH FOR DOGS10 Foods to Keep Canine Vision Sharpby Audi Donamor

Custom printing ...... it’s all in the details

594 Blakeslee Blvd. Dr. West Lehighton, PA 18235800-443-0377 www.tnprinting.com

facebook.com/NaturalNewHavenPage

Become our fan!

ravenswingyoga.com203-488-YOGA (9642)

19 South main Street, Branford, CT

A Community Alive with Yoga

at RAVEN’S WING YOGA

Diverse, Experienced, ExceptionalTeachers

Yoga Classes & Workshops, Meditation, Live Music


Carrots come in 100 varieties, from deep purple and white to brilliant orange. Each is a storehouse of nutrient power, providing vitamin A, beta-carotene, vitamins C, D, E and K, and riboflavin, niacin, calcium, potassium, phospho-rus, sodium, iron, magnesium, manganese, sulphur, copper and iodine. The adage that carrots are good for the eyes is true. They even contain lycopene and lutein, phytonutrients that protect from UVB radiation and free radical damage. Cold-water fish such as salmon, tuna, cod, haddock and sardines are rich in omega-3s, especially EPA and DHA, which are widely known to be important to cellular health. DHA makes up 30 percent of the fatty acids that comprise the retina. The particularly high levels of omega-3s in sardines add further protection to retinal health, according to researchers at the London School of Hygiene and Tropical Medicine. Eggs are rich in cysteine and sulphur, two components of glutathione. Cataract Health News reports that sulphur-containing compounds have been found to protect eyes from cataract formation. Egg yolks contain lutein, and a University of Massachusetts study has found that eating an egg a day raised levels of lutein and zeaxanthin in the blood; at the same time, blood serum lipids and lipoprotein cholesterol concentrations remained stable. Garlic. Researchers at the University of Oregon sug-gest that sulphur-rich garlic is important for the production of glutathione, a protein that acts as an antioxidant for the eye’s lens, and can be instrumental in the prevention of some visual problems. Kale is an excellent source of lutein and zeaxanthin. The American Optometric Association says these special antioxidants act like “internal sunglasses.” Add beta- carotene to the mix and kale serves as a preferred foil to oxidative stress. Pumpkin’s orange color is a sure sign that it’s packed with carotenoids like beta-carotene, which help neutralize free radicals. Its lutein and zeaxanthin generally promote eye health and further protect against retinal degeneration. Even pumpkin seeds carry several benefits, including omega-3s, zinc and phytosterols to enhance a dog’s immune response. Sweet potatoes are loaded with both beta-carotene and anthocyanins, the latter high in antioxidant and anti-inflammatory properties. Tomatoes are famous for their lycopene, a carotenoid and phytonutrient found in red produce. This powerful antioxidant

helps protect against sun damage and retinal degeneration and has been well

documented as effective in cancer prevention. Pro-cessed tomato prod-ucts contain higher levels of lycopene than the raw fruit.

Audi Donamor regularly contributes to Animal Wellness Magazine (Animal WellnessMagazine.com), from which this was adapted and used with permission.

Make vision and diet part of annual exams by a local vet.

Final Journey, LLC(Pet Euthanasia Service)

Kristen Klie, D.V.M.and Associates

(203) 645-5570www.finaljourneyllc.com

Where Middle Schoolers Thrive!

203-433-4658 Branford CTExperiential.org

THINKING ABOUT MIDDLE SCHOOL?

Connecticut Experiential Learning Center

REGISTER NOW for2015-16 Academic YearExceptional education for 5th-8th grade studentsEngaging curriculum, real-world and hands-on learning within a safe and nurturing setting

PATTI HARTMANI-ACT CERTIFIED HYDROTHERAPIST

NATIONAL BOARD [email protected]

203-500-0005

CT Colon Hydrotherapy

ColonicsinCT.com

35 Boston StreetGuilford, CT 06437


calendarofevents

THURSDAY, SEPTEMBER 3New Haven Community Circle Dance – 7:30pm-9:30pm. Move in the footsteps of our ancestors as we enjoy traditional dances from many cultures, as well as contemporary pieces choreographed in the spirit of ancient folk dance. All dances are taught and no experience is necessary. Suggested donation $8. Location: Friends Meetinghouse, 225 East Grand Ave, New Haven. 203-467-1069.

FRIDAY, SEPTEMBER 4Nature’s Child: Incredible Insects –10:30am. Join naturalist Wendy to discover the critters who live in our park’s beautiful yellow flowers. You’ll be amazed to find how many tiny creatures live on our goldenrod. Tuition: $6 per family ($4 for Ansonia residents or current FANCI members). Ansonia Nature Ctr, 10 Deerfield Rd, Ansonia. Preregister: 203-736-1053.

SATURDAY, SEPTEMBER 5Dream Catchers Class at KanduBeads – 11am-12pm. Free with $15 purchase. Learn to make a dream catcher using natural materials, beads and recycled Sari cloth ribbon! Bring a friend! New location: 116 Elm Street Cheshire. 203-439-8689. KanduBeads.com.

Forrest Yoga Monthly Intensive Class w/Heidi Sormaz – 4:00pm-5:45pm. Each Forrest Yoga Intensive class is designed and sequenced with a specific focus area in order to help move your practice to the next level. Levels 2/3 class. $19 or Fresh class card. Fresh Yoga, 49 Orange St, New Haven. [email protected].

Drumming The Sound Of Ascension – 7pm. As-trological Drum Circle with power point presenta-tion with Mark Zarrillo and Gloria Amendola. Blood Moon prophecy and opening of portal allow us to drum in planetary ascension and receive influx of light. $25. Avant Garde, 328 East Main St, Branford. RSVP: 203-481-8443. [email protected].

SUNDAY, SEPTEMBER 6Yoga by the River – 9:15am-11am. Take a leisurely hike in Farm River State Park in East Haven, explore its guided nature trail with ospreys, salt marshes and river views. Practice yin yoga... stretch and relax! Bring a mat or blanket. Register for meeting loca-tion. Free. OneWorld-Wellness.com.

MONDAY, SEPTEMBER 7Experiencing Back Pain? Come in for a free Back Consultation w/PT Services of Guilford – Stop back pain NOW! Come visit for a FREE consultation. Find pain relief without medication! PT Services of Guilford, 500 East Main St, Ste 310, Branford. 203-315-7727.

TUESDAY, SEPTEMBER 8Information Sessions – 6pm–7:00pm. (& Thurs-day, September 17th, 5pm–6:30pm). The Gradu-ate Institute, 171 Amity Road, Bethany. Call: 203-874-4252, email [email protected] or visit Learn.edu/events.

Beyond Angelspeake™ Class w/RMT, Holistic Coach Diane Esposito – 6:30-8:30pm. Ask em-powering questions, awaken to signs, and receive loving messages/guidance from angels, guides, loved ones. Develop intuitive senses. $33/class and materials. Wallingford. Register: 203-913-3869. PersonalHarmonyandHealth.com.

Free Presentation – Positive Psychology: Emo-tional Wellbeing and Happiness with Dr. Enrico Cheli and Cristina Antoniazzi – 7pm–8:30pm. The Graduate Institute, 171 Amity Road, Bethany. Call 203-874-4252, email [email protected] or visit Learn.edu/events.

THURSDAY, SEPTEMBER 10Yoga Rhythms w/ Nancy Melillo & Mark Zarrillo – 6:30pm-8pm. Live drumming combined with a flowing yoga practice that links you to your breath, challenges you to open yourself up to your full creative potential and if the spirit moves you... to dance! $25. Fresh Yoga, 319 Peck St, New Haven. [email protected].

Holistic Chamber of Commerce – Business Education Topic: Bookkeeping Options of Small Business – 6:30–8:30pm. The Graduate Institute, 171 Amity Road, Bethany. Call 203-874-4252, email [email protected] or visit Learn.edu/events.

FRIDAY, SEPTEMBER 11Sound Healing Experience – 7pm-8pm. Come feel the penetrating power of vibration! Using Tibetan bowls, drums, and her training as a healer, Branwen will create a safe resonant heart space for you to relax into your true being. $15. 41 Village Ln, Bethany. Register at 203-393-1717. Earthdancing.com.

Holographic Sound Healing w/Randeane Tetu – 7:30pm-8:30pm. Vibrational sound assists the body’s natural healing ability, nourishes emotional self and nurtures the soul’s highest purpose. Release old patterning/balance energy/stimulate healing. $15. Enchanted, 1250 Boston Post Rd, Guilford. 203-453-4000.

SATURDAY, SEPTEMBER 12Reiki I Certification w/RMT, Holistic Coach Diane Esposito – 9am-3pm (or 9/15 & 9/18 – 6pm-9pm). Provides empowering foundation for self-healing, support for personal challenges/goals/relationships and treating others. Wallingford. $150 Pre-Class Consult/Register: 203-913-3869. PersonalHarmonyandHealth.com.

Monthly Power Yoga w/ Peg Oliviera – 10am-11:30am. Join Peg monthly for a challenging power vinyasa yoga class that offers the right balance of sweat and soul. $19 drop in or Fresh class card. Fresh Yoga, 319 Peck St, New Haven. [email protected].

Akashic Records Class W/Rosa Chyan – 10am-4:30pm. (Sept 12 & 13) Learn to access the Akashic Records. Gain insights and healing. Con-nect to the wisdom of your soul. Manifest your Life Purposes. $175. BodyWorks, 93 Waterbury Rd, Prospect. Must register: 203-228-1777 or [email protected].

FREE Reiki Clinic with Anita Jones, RMT – 11am-3pm. Enjoy a 10-15 min. session of Reiki, and learn about healing energy. Thyme and Season, 3040 Whitney Ave, Hamden. Information: 203-415-4791.

SUNDAY, SEPTEMBER 13FREE Yoga Week at Your Community Yoga Center – Begins: Sun. 9/13 through: Sat. 9/19! For NEW Students and Current Students Bringing New Students. 39 Putnam Ave. Hamden. 203-287-2277. YourCommunityYoga.com.

Monthly Restorative Yoga w/Ellen Lenson – 9:30am-11am. Begin your week with a nurturing 90-minute restorative practice. Let go of the stress from the previous week. $19 drop in or Fresh class card. Fresh Yoga, 319 Peck St, New Haven. [email protected].

Hidden Acres Farm In Naugatuck: Respite Ranch Rejuvenation Workshop – 9:30am-2:30pm. Life can be stressful–give yourself a day to unwind with Hidden Acres therapy horses and staff as they guide you through a day of relaxing activi-ties. Horse experience is not required–all activities take place without riding. Cost $99/person. Space is limited. Call: 203-516-8380 for a registration form or email [email protected].

Lost and Found Hike at the Ansonia Nature Center – 1pm. (sharp!) Discover some of the Nature Center’s hidden secrets. Did you know our property has two natural springs? Join Rangers Martin and Daniel to learn how to use a compass and a map to find these hidden gems. For children and adults. Bring your own compass or borrow one of ours! Free. Ansonia Nature Ctr, 10 Deerfield Rd, Ansonia. Preregister: 203-736-1053.

Mastering the Art of Self-Expression – 1pm-3pm. Reclaim your refrigerator art while exploring your internal terrain in this fun and enlightening adult creative journaling workshop facilitated by Art-ist and Life Coach Laura Thoma. $45. Bird Nest Gallery Guilford. 203-689-5745. LauraThoma.com.

Usui Holy Fire Reiki I with Anita Jones, RMT – 1pm-6pm. Learn about Reiki energy, its history, and how to use it for yourself and others. Attunement given. Certificate and manual included. Hamden. $125. Info/Registration: 203-415-4791.

Art of Transfiguration – 7:30pm. Randeane guides us in meditation with channeled chant and Quartz Crystal Bowls under celestial illuminated ceiling to connect to higher self and release energies that do not serve us. $15. Avant Garde, 328 East Main St, Branford. Information and RSVP: 203-481-8443 or [email protected].

MONDAY, SEPTEMBER 14Free Manual Therapy Therapeutic Consulta-tion – Had physical therapy w/o relief? Try manual therapy, hands-on treatment. 40 minutes one-on-one w/staff. Feel better. Experience the difference! Call for FREE consultation. PT Services of Guilford, 500 East Main St, Ste 310. Branford. 203-315-7727.

Intro to Forrest Yoga w/ Heidi Sormaz: 4-Week Series – 6pm-7:15pm. (Mondays, 9/14-10/5). This is the perfect class for a student who is either new to yoga, looking to return to the basics, or just interested in Forrest Yoga. $60. Fresh Yoga, 319 Peck St, New Haven. [email protected].


WEDNESDAY, SEPTEMBER 167 Week Chakra class – Each week we will delve into the front and back of each chakra: elements, crystals, functions, psychological, physical associa-tions with each chakra will be discussed, meditation to clear each chakra. $135. 36 Cheshire Rd, Wall-ingford. 203-265-2927. [email protected].

Information Session for Educators – 4pm–6pm. The Graduate Institute, 171 Amity Road, Bethany. Call 203-874-4252, email [email protected] or visit Learn.edu/events.

Healthy Happy Hour! – 6:30pm-7:30pm. Come learn about the amazing Vegan, Organic, NonGMO, Green SuperFood 10 DAY TRANSFORMATION CLEANSE! Lose 5-20lbs, Detoxify, Break Food Addictions, Boost Energy, Improve Digestion, Sleep Better. Free samples! Free event. Guilford. Information/RSVP call Joy Nagle: 203-257-3654.

Guided Mindful Healing Meditation & EFT w/ RMT/Holistic Coach Diane Esposito – 6:30pm-8:30pm (& Tues. 9/22). Engage in [+] Energy insights and create lasting, healthy transforma-tions. $25. Wallingford. Register: 203.913.3869 or PersonalHarmonyandHealth.com.

A Circle of Women – 7pm-9pm. Join in sacred space to discover and strengthen your authentic self, celebrate “womens’ ways,” live in rhythm with the seasons. Conscious transition into Autumn. This is what you have been looking for! Healing the world one woman at a time. $25. Central Wallingford. Call Susan to reserve space: 203-645-1230.

THURSDAY, SEPTEMBER 17Fall Term Junior Rangers – (Registration begins 3:30pm. Class runs Thursdays through November 5). Calling all kids 11 to 14 years old who want to work with animals, garden, help maintain our trails, and help with special events. This is the op-portunity to help the Nature Center in our 8-week after-school program. Parental permission required. Class size is limited and fills up fast! Free. Ansonia Nature Ctr, 10 Deerfield Rd, Ansonia. Preregister: 203-736-1053.

Informat ion Sess ion for Educators – 4pm–6pm. Keigwin Middle School, 99 Spruce Street, Middletown. Cal l 203-874-4252, email : [email protected] or visit Learn.edu/events.

Theta Healing Gifts for a Sensitive Soul w/ Tami Reagor – 7pm-8:30pm. Do feel overwhelmed by the world around you? Everything affects you on a deep emotional level. Know this—There is nothing wrong with you. You are perfect as is, but you have a gift —you are an empath. Learn about how to protect yourself from the negative forces, use your empathic skills for the good of the world. $20. Enchanted, 1250 Boston Post Rd, Guilford. 203-453-4000. EnchantedGuilfordct.com.

FRIDAY, SEPTEMBER 18Ignite Your Spirit Therapy Healing w/ Sierra North – 4pm-7pm. Ignite your Spirit Therapy is no touch energy healing originating from Australia and works through the etheric body to affect the mental, emotional, and physical wellbeing. It deeply cleanses and clears all debris, old thoughts and pat-terns, negative emotions, and negative vibrations from the chakras. 1-hour sessions $108. Enchanted, 1250 Boston Post Rd, Guilford. 203-453-4000. EnchantedGuilfordct.com.

Yoga & A Movie – 6:30pm-9pm. After a 45 minute Tao/Yin Yoga class, enjoy the film, Journey of the Universe, about the profound role humans play in the intricate web of life on Earth. Free but please register to attend. OneWorld-Wellness.com.

Healing Crystal Journey w/ Sierra North – 7pm-8:30pm. We will be connecting deeply with the heal-ing energy of crystals. Through meditation we will experience the healing energies of seven crystals on our chakras and connect with a crystal through a shamanic journey, providing you your own per-sonal connection with that crystal and how it works with you. $20. Enchanted, 1250 Boston Post Rd, Guilford. 203-453-4000. EnchantedGuilfordct.com.

SATURDAY, SEPTEMBER 19Reiki II Cert. w/RMT, Holistic Coach Diane Esposito – 9am-3pm or two 1/2-Days/Eves. Receive empowering keys to mental-emotional clarity, balance; support for empathic chal-lenges/relationship healing. Wallingford. $175. Pre-Class Consult/Register: 203-913-3869. PersonalHarmonyandHealth.com.

Healthy Happy Hour! – 10am-11am. Come learn about the amazing Vegan, Organic, NonGMO, Green SuperFood 10 DAY TRANSFORMATION CLEANSE! Lose 5-20lbs, Detoxify, Break Food Addictions, Boost Energy, Improve Digestion, Sleep Better. Free samples! Free event. Guilford. Information/RSVP call Joy Nagle: 203-257-3654.

Rowanwood Farm Llama Hiking Adventure – 10:30am. Experience an unforgettable hike with Rowanwood Farms’ gentle mini llamas through the breathtaking trails at McLaughlin Vineyards in Sandy Hook and the trail through the Bald Eagle Sanctuary. After the hike, relax, visit the gift shop, and sample wines. Space is limited. Fee $20/person. Ansonia Nature Ctr, 10 Deerfield Rd, Ansonia. Preregister: 203-736-1053.

Crystal Tassel Necklace Class at KanduBeads – 11am-12pm. Free with $15 purchase. Learn to use a Natural Quartz Crystal to make a stylish crystal fringe necklace. The Watch Factory Shoppes, 116 Elm St, Cheshire. Bring a Friend! 203-439-8689. KanduBeads.com.

Japanese Kumihimo Bracelet Class at KanduBeads – 1pm-4pm. Learn the ancient art of Kumihimo Braiding with Beads to make bracelets at KanduBeads Jewelry and Bead Store. $30. New Location: The Watch Factory Shoppes, 116 Elm St, Cheshire. 203-439-8689. KanduBeads.com.

Intergalactic Meditation Ensemble – 7:30pm. Music for relaxation to transcend space and time as your are transported to realms beyond. Series of Guided meditations with stellar music LIVE BAND. $20. Avant Garde, 328 East Main St, Branford. Information and RSVP: 203-481-8443 or [email protected].

SUNDAY, SEPTEMBER 20Akashic Records Consultation W/Rosa Chyan at the Holistic Fair – 12pm-4pm. Gain insights and healing. Connect to the wisdom of your soul. Live a peaceful and effective life. Cost $25/20 minutes. THE LOOP, 161-B Woodford Ave, Plainville. Appointment: 203-228-1777 or [email protected].

Usui Holy Fire Reiki II with Anita Jones, RMT – 1pm-6pm. Increase your knowledge of Reiki and energy. Learn the basic Reiki symbols and distant healing. Attunement given. Certificate and manual included. Hamden. $150. Info/Registration: 203-415-4791.

MONDAY, SEPTEMBER 21PT Services of Guilford Offers Free Hand Pain Screening – Hands always aching? Want to find relief without injections or medications? Come in for a FREE hand pain screening. Feel better! 500 East Main St, Ste. 310. Branford. 203-315-7727.

Fall Equinox w/Gayle Franceschetti – 6:30pm-8:30pm. Tap into autumn’s new energies-facilitate purifying one’s life, planting new seeds and endeav-ors, develop new values and make new decisions and goals. $20. 36 Cheshire Rd, Wallingford. 203-265-2927. [email protected]. Return2Love.net.

TUESDAY, SEPTEMBER 22Group Past Life Regression – 6:30-8-30pm. Discover reasons for current fears, recurring dreams or personality tendencies. Attendees explore past lives, learn reasons for repeat patterns or why they were born to a certain family. $20. Wallingford. Call Gayle: 203-265-2927. [email protected].

THURSDAY, SEPTEMBER 24Develop Your Intuition 5 Classes w/Gayle Franceschetti – 6:30pm-8:30pm. Tap onto your innate ability of “knowing.” Through meditation, sharing and experiential exercises master tech-niques of accessing creativity and intuition. Series $97. 36 Cheshire Rd, Wallingford. 203-265-2927. [email protected].

NEW AGE & CRAFTS EXPOCome experience

a day of spiritual & creativeenlightenment!

SUNDAY, OCT 1810am-5pm

Two Rooms of Dynamic Speakers and Guided Meditations,

Angel, Tarot & Intuitive Readers,Aura Photos, Reiki and Crystals,

Handcrafted Jewelry, Soaps,Candles, and...

Crowne Plaza Hotel1284 Strongtown Road

Southbury, CTI-84, Exit 16, Rt 188

$6 Admission

Information: [email protected]

203-733-6560

markyourcalendar


FRIDAY, SEPTEMBER 25Autumnal Equinox Drumming Circle – 7pm. Join our drumming circle with Ranger Dawn. For adults and children 12 years and older. Welcome and celebrate our most colorful season! Free, but bring a canned food item for our local homeless shelter. We’ll gather at Pavilion #2. Ansonia Nature Ctr, 10 Deerfield Rd, Ansonia. Preregister: 203-736-1053.

Sound Healing Experience – 7pm-8pm. Come feel the penetrating power of vibration! Using Tibetan bowls, drums, and her training as a healer, Branwen will create a safe resonant heart space for you to relax into your true being. $15. 41 Village Ln, Bethany. Register at 203-393-1717. Earthdancing.com.

Full Moon Gong Relaxation w/ Barbara Cox and Steve Chillemi – 7pm-9pm. Experi-ence live gong sound healing tones, yoga set, meditation to put mind/body at ease. $22 / $60/3 sessions. 39 Putnam Ave. Hamden. 203-287-2277. YourCommunityYoga.com.

SATURDAY, SEPTEMBER 26Moving From Your Center – 9am-10am. 5-week series Gentle exercise class that is rooted in Chi Kung and Feldenkrais movements. Movements done in Standing, kneeling and lying down. $50 Holistic Therapies Classroom, 15 South Elm St, Wallingford. Contact Carol: 203-415-8666 or [email protected].

Akashic Records Consultation w/Rosa Chyan at ProHealing Festival – 9am-1pm. Do you WONDER why th ings happen? Do you SEEK a peaceful, happy, and effective LIFE? Cost $40 for 30 minutes. Walnut Hill Park New Britain. Appointment: 203-228-1777 or [email protected].

Text: Reiki III ART Cert. w/RMT Holistic Coach Diane Esposito – 9am-3pm or two 1/2-Days or Eves. Promote/Deepen personal and client lasting, healthy transformations Advanced Techniques w/Crystal/Stone healing and manifesting grids. $200. Wallingford. Pre-Class Consult/Register: 203-913-3869. PersonalHarmonyandHealth.com.

Healthy Happy Hour! – 10am-11am. Come learn about the amazing Vegan, Organic, NonGMO, Green SuperFood 10 DAY TRANSFORMATION CLEANSE! Lose 5-20lbs, Detoxify, Break Food Addictions, Boost Energy, Improve Digestion, Sleep Better. Free samples! Free event. Guilford. Information/RSVP call Joy Nagle: 203-257-3654.

I n f o r m a t i o n S e s s i o n s : C a l l - i n – 10:30am – 11:30am. The Graduate Institute, 171 Amity Road, Bethany. Cal l Cal l - in Number: 712-432-1690, Access Code #583832, email [email protected] or visit Learn.edu/events. Festive Fall Earrings Class at Kandu-Beads – 11am-12pm Free with $15 purchase. Learn to make a festive pair of Fall themed Earrings! KanduBeads New Location: The Watch Factory Shoppes, 116 Elm St, Cheshire. 203-439-8689. KanduBeads.com.

FREE Reiki Clinic with Anita Jones, RMT – 11am-3pm. Enjoy a 10-15 min. session of Reiki, and learn about healing energy. Thyme and Season, 3040 Whitney Ave, Hamden. Information 203-415-4791.

Goddess, Tarot, Rune & Past Life Readings w/Lisa Morrison – 12pm-4pm. Lisa believes that readings should be a balance of humor, healing and inspiration. Her goal is to help restore balance and encourage wholeness of self. $1/min. Enchanted, 1250 Boston Post Rd, Guilford. 203-453-4000.

Birds on the Move – 2pm. Come for afternoon birding with Ranger Jessica for this fun, informa-tive program. She will concentrate on the end-of-summer journeys taken by our “flying friends” to faraway places each year. Find out who’s going and who’s staying put! Free. Ansonia Nature Ctr, 10 Deerfield Rd, Ansonia. Preregister: 203-736-1053.

Airbrushed Effect Polymer Pendant Class at KanduBeads – 2pm-5pm. Learn to use Polymer Clay to create an Airbrushed Effect Polymer Pendant at KanduBeads Jewelry and Bead store. $60. New Location: 116 Elm St, Cheshire. 203-439-8689. KanduBeads.com.

Hidden Acres Farm in Naugatuck: Journey Into Awareness Workshop for Health, Counseling and Equine Professionals – 2pm-6pm. Discover why equine facilitated learning is gaining popularity as a unique and effective approach to helping individual with emotional challenges such as trauma, anxiety and depression. Developing self-awareness through experiential learning. Four NESW approved CEUs for SW and other professionals. $99/person. Space limited. Call: 203-516-8380 for registration form or email [email protected].

Anatomy of the Spine – 3pm-5:30pm. Learn about the physical mechanics and explore the energetic awakening of the spine through discussion, postures and breathwork with emphasis on maintaining good spinal health. $20. Register early, space is limited. OneWorld-Wellness.com.

Reiki I w/Gayle Franceschetti – 6:30pm-8:30pm. Reiki is the science and art of activat-ing, directing and applying natural, universal life energy, to promote energy balancing, healing and wholeness. Materials/certificate included. $125. 36 Cheshire Rd, Wallingford. 203-265-2927. [email protected].

Full Harvest Moon Hike – 7pm. Join our rangers to hike the Nature Center trails as the big moon rises. Enjoy some marshmallows over the campfire to con-clude our program. Each child must be accompanied by an adult. Number of participants is limited. Fee: $1/person. Ansonia Nature Ctr, 10 Deerfield Rd, Ansonia. Preregistration required: 203-736-1053.

Explore Past Lives with Lisa Morrison – 7pm-8:30pm. Discover how Past Life Regression is used to identify, release and heal imbalances from within. Several attendees will experience a regression. A forum-style event. $20. Enchanted 1250 Boston Post Rd, Guilford. Information call: 203-453-4000. EnchantedGuilfordct.com.

SUNDAY, SEPTEMBER 27Usui Holy Fire Advanced Reiki with Anita Jones – 1pm-6pm. Deepen your Reiki knowledge. Learn meditations and techniques for enhancing Reiki energy. Attunement given. Certificate and manual included. Hamden. $250. Information/Registration: 203-415-4791.

Full Harmonic Sound Immersion w/ Priscilla – 7pm. Healing Meditation to clear, balance, em-power, awaken. Find true self as you are surrounded in love and light with guided meditation, gongs and bowls under illuminated celestial ceiling. $15. Avant Garde, 328 East Main St, Branford. Information/RSVP: 203-481-8443. AvantGardect.com.

MONDAY, SEPTEMBER 28 Free Shoulder Consultation at PT Services of Guilford – Why suffer with shoulder pain when something can be done about it? Come see staff for a FREE shoulder consultation. Find pain relief without medication! PT Services of Guilford, 500 East Main St, Ste 310. Branford. 203-315-7727.

Essentials of Tao Yoga – 7pm-9pm. Held at New Haven’s Elm City Wellness, this is an intro to Tao Yoga postures and breathwork for students or potential instructors. $20. Fee can also be applied to optional class series in Oct & Nov. Advanced registration is a must. OneWorld-Wellness.com.

TUESDAY, SEPTEMBER 29Access Your Akashic Records w/Rosa Chyan – 2:30pm-4:30pm. What are the Akashic Records? What information do they contain? Who is work-ing with you? Learn how you can access your own Records. Cost $40/$30 pre-paid. Reaching The Harmony Within, Prospect. Register: 203-228-1777 or [email protected].

Full Moon Meditation w/Gayle Franceschetti – 6:30pm-8:30pm. Align w/new energies of full moon. Opportunities for allowing spiritual ener-gies to reach human hearts and minds. Tap into this vast pool of energy. $20. 36 Cheshire Rd, Walling-ford. 203-265-2927. [email protected]. Return2Love.net.

WEDNESDAY, SEPTEMBER 30Special Writing Workshop with Randeane Tetu – 7:30pm-8:30pm. This special writing workshop is appropriate for all levels-beginner to advanced. Learn techniques to put your word into a story or poem memoir. As author Randeane Tetu guides you to meet your writing selves and writing guides. Please bring pen and paper. $20. Enchanted, 1250 Boston Post Rd, Guilford. 203-453-4000.

MONDAY, OCTOBER 5Free Foot Screening at PT Services of Guilford – Call today to find out more about Anodyne Therapy for foot pain. Increase circulation, reduce pain and stiffness. Feel better! PT Services of Guilford, 500 East Main St, Ste 310. Branford. 203-315-7727.

MONDAY, OCTOBER 12DiCello & Mangione Talk & Book Signing Event: Daughters, Dads and the Path Through Grief: Tales from Italian America – 7pm. Donna DiCello PsyD and Lorraine Mangione PhD will be speaking to the Saint Clare Ladies Guild at 234 Coe Avenue in East Haven. Free. Contact Sandy: 203-468-6277.


healthbriefsglobalbriefsecotipsgreenlivinghealingwayshealthykids

consciouseatingwisewordsfitbodyinspirationnaturalpet

departments themes

JANUARY whole systems health plus: energy boosters

FEBRUARY enlightened relationships plus: healing grief

MARCH animal rights plus: new healthy cuisine

APRIL nature’s wisdom plus: healthy home

MAY breast health plus: natural birth

JUNE healing addiction plus: balanced man

JULY food democracy plus: inspired living

AUGUST parenting with presence plus: creativity

SEPTEMBER agelessness plus: yoga benefits

OCTOBER working together plus: natural antidepressants

NOVEMBER true wealth plus: beauty

DECEMBER prayer & meditation plus: holiday themes

2015


sunday

Readings with Fannie – 11am-3pm. Certified Crys-tal Healer, Reiki Practitioner and for contacting our Spirit Guides, the Book of Life and Astral Traveling. Assists you in connecting to the deep inner being of your soul. Assists/connects with your higher self and acts as a catalyst to bring forth what is for your highest good (ie. connecting you with a loved one or just clearing your field). Enchanted, 1250 Boston Post Rd, Guilford. 203-453-4000.

mondayEnjoy a $10 discount on all 90-Minute Services! – Every Monday is Customer Appreciation Day at Massage Savvy and their “75 Gets You 90” pro-motion means all 90-min services are billed at the 75-minute price. Guests will experience all of the benefits of a 90-minute service AND a $10 discount! To book your 90-minute service, call 203-453-8667, click MassageSavvyCT.com, or visit their expanded location at 2470 Boston Post Road in Guilford.

Readings w/ Jennifer Jean: Usui Reiki Master Teacher, Certified Angel Card Reader (TM), Trained in Anglespeake ™ – 11am-3pm. Enjoys leading guided meditations to help others to heal and communicate with the angels, performs build-ing cleansings and clears spiritual attachments, plus as a toxicologist (MA) she works with a natural wellness pharmaceutical. $1/minute. Enchanted, 1250 Boston Post Rd, Guilford. 203-453-4000. EnchantedGuilfordct.com.

Pilates/Barre Community Class – 8am. This class is a mix between pilates moves to strengthen core muscles and the Barre technique to sculpt and lean our arms and legs. Discount price of $10.00 cash/check or $12.00 credit card. Kneading Hands Yoga & Massage, 760 Main St S, Unit F, Southbury. 203-267-4417. KneadingHands.net.

Yoga with Marlene – 10:30am/7:15pm. (classes also offered Tues. 9:30am/6:30pm, Wed. 6:30pm, Thurs.10am/6:30pm, & Fri. 9:30am). Yoga classes for all ages and problems in a serene atmosphere with emphasis on stress-management. 1221 Village Walk, Guilford. Info: 203-453-5360.

Astrological Readings w Lou Valentino – 4pm-7pm. (9/14 & 9/21). Have you ever wondered what your astrological chart says about your personality, vocation, relationships and future? Lou Valentino has been doing astrology readings for over 20 years; former astrological writer for Wisdom magazine for 8 years. 30-min readings. $1/min. Enchanted,1250 Boston Post Rd, Guilford. 203-453-4000.

Iyengar Yoga Leve l I – 6pm. (S ta r t s September 8). Refine and deepen your understand-ing of yoga and yourself through optimal alignment practice. Individual attention given. Yoga in Middle-town, 438 Main St, Middletown. 860-347-YOGA (9642). YogaInMiddletown.com.

Qigong for Health – 7pm-8pm. Learn a practice that invigorates the internal energy, relieves stress, tones and stretches the muscles and connects the mind and body. $15/class. Tranquil Mountain Inter-nal Arts. Location: Shoreline Center for Wholistic Health, 35 Boston St, Guilford. Info: 860-301-6433. tmiarts.com.

tuesday

Reiki Readings Tarot Card Tuesday Event – 9:30am-7:30pm. (Jan 6, 13, 20 & 27). Have a God-dess Tarot Card reading with Chrystyne McGrath. Chrystyne is a Psychic/Trance Medium, Reiki Master and Dowser. She uses the Goddess Tarot Card deck at this event. Limited spaces left, 30 minute reading for $25. Health Options Wellness Center, 133 State St, Guilford. For availability, call 203-415-0704 or email [email protected].

Readings w/ Susan Margaret – 11am-2pm (& Sat 9/19, 11am-3pm). Susan is a medium (messages from those that have crossed over) who has been giving readings for 44 years. She has given read-ings with the Astrological Society of CT for over 20 yrs. Susan uses classic playing cards, reads palms, and uses basic astrology. $1/minute. Enchanted, 1250 Boston Post Rd, Guilford, 203-453-4000. EnchantedGuilfordCT.com.

Awareness Through Movement Basics: Feldenkrais 101 – 12pm-1pm. Relearn the sim-plicity of authentic moving and transcend your personal patterns of limitation. $13. Drop-in. Ho-listic Therapies Classroom, 15 South Elm St, Wall-ingford. Contact Carol Meade: 203-415-8666 or [email protected].

Healthy-Steps, The Lebed Method – 3:45pm-4:45pm. w/Susan Sandel. Gentle therapeutic exercise/mvmnt prog. Helpful for breast cancer survivors/chronic health conditions. Free. Sponsor: Middlesex Hosp. Ctr. for Survivorship and Integra-tive Medicine, Madison. Details: 203-457-1656.

Free weekly Tuesday Meditation classes – 6:30pm-7:30pm. Open to all and fully accessible. Instruction provided for beginners. No reservations necessary. Walk-ins welcome. Program offered in cooperation with New Haven Shambhala Center. New Haven Free Public Library. 133 Elm St, New Haven. 203-946-8130 x200.

Free Reiki Sessions: The Universal Reiki Plan – 7:30pm-8:30pm. (& 8:30pm-9:30pm Thurs). Reiki teachers Jeannette and Jim of ReikiOver-tones and students offer free Reiki sessions. Appt. only. Love offering appreciated. 95 Harris St, Fairfield. Details: Jim and Jeannette 203-254-3958. [email protected].

wednesday

Wellness Wednesdays – Pamper your self with a Spa Aromatherapy Facial with Alberto ($35). Also shop our eco-friendly, fair trade boutique. Receive 10% off with this ad. Avant Garde Holistic Center Salon Spa Boutique (Body Mind & Soul Experi-ence), 328 E Main St, Branford. 203-481-8443. AvantGardeCT.com.

Yoga on the Ropes – 9am-10am. With Iyengar Teacher Training Graduate. Experience asana practice in new and liberating ways with the use of wall ropes. The practice is focused, but also playful. Yoga in Middletown, 438 Main St, Middletown. 860-347-YOGA (9642). YogaInMiddletown.com.

Readings and/or Crystal Chakra Balancing w/Deborah – 12pm-3pm. RMT, IET (Integrated Energy Therapy), Hypnotherapist, EFT and Quan-tum Touch Practitioner. Offers Tarot card, Tea Leaf and Couples Readings, House Blessings and Clearings, Reiki, Crystal Chakra Balancing, Hyp-nosis Therapy Specializing in Addictions, Phobias and Past Life Regression. $1/min. Enchanted, 1250 Boston Post Rd, Guilford. 203-453-4000.

Emei Wujigong Qigong Group Practice – 12pm-1pm. Experience a qigong form for rebalancing and strengthening body, mind and spirit. For all abilities and levels of health. Schedule Available online. 1st class free (reg. $5). Holistic Therapies Classroom, 15 South Elm St, Wallingford. Info: EmeiQigongChan.com.

Weekly Wednesday Library Yoga Classes at New Haven Free Public Library – 1pm-2pm. $5, payable to instructor. Bring your own mat. Various instructors. 133 Elm St, New Haven. 203-946-7091.

Stony Creek Yoga for Stress Relief – 5:45pm-7pm. Classes taught by Gina Macdonald MA, LPC. Will emphasize the breath with flowing movement. $10/session. Walk-ins welcome. Willoughby Wal-lace Library. 146 Thimble Island Rd, Stony Creek. Contact Gina: 203-710-6665.

Yoga with Marlene – 6:30pm. (classes also offered Mon. 10:30am/7:15pm, Tues. 9:30am/6:30pm, Thurs.10am/6:30pm, & Fri. 9:30am). Yoga classes for all ages and problems in a serene atmosphere with emphasis on stress-management. 1221 Village Walk, Guilford. Info: 203-453-5360.

thursdayThe Milford Chamber’s ‘Health & Wellness Council’ – 8:30am-9:30am. (2nd Thurs. monthly). Group is comprised of businesses in the health and wellness industry. 5 Broad St, Milford. 203-878-0681. [email protected], Milfordct.com.

ongoingevents


Readings w/ Sean David – 11am-4pm. A natural intuitive and empath, my focus as a reader is to help individuals to connect to the healing energies that lie within, and to assist in aligning with their internal guidance. Through establishing an empathic con-nection, I can help you embrace the ‘lesson in the mess’, and focus on the clearer path that is already within you. Lecturas psíquicas disponibles en Es-pañol. $1/min. Enchanted, 1250 Boston Post Rd, Guilford. 203-453-4000. EnchantedGuilfordCt.com.

Awareness Through Movement: 20 Feldenkrais Themes – 12pm-1pm. In this class we will be ex-ploring 20 ATM lessons throughout the year. Focus is on moving naturally with a sense of ease and play-fulness. $13. Drop-in. Holistic Therapies Classroom, 15 South Elm St, Wallingford. Contact Carol Meade: 203-415-8666 or [email protected].

Healthy-Steps, The Lebed Method w/Susan San-del – 3pm-4pm. Gentle therapeutic exercise/mvmnt prog. Helpful for breast cancer survivors/chronic health conditions. Free. Sponsor: Middlesex Hosp. Ctr. for Survivorship and Integrative Medicine. Middletown. Details: 203-457-1656.

Iyengar Yoga: Introductory Series Including Ropes Yoga – 6pm-7:15pm (Starts September 10). Ideal for those new to Iyengar yoga, those with spine and scoliosis concerns and those who wish to refine their practice. Yoga in Middletown, 438 Main St, Middletown. 860-347-YOGA (9642). YogaInMiddletown.com.

Emei Wujigong Qigong Group Practice – 6:30pm-7:30pm. (Every Thurs. except the 1st Thurs. of month). Experience a qigong form for rebalancing and strengthening body, mind and spirit. For all abilities and levels of health. Schedule Available online. 1st class free (reg. $5). Holistic Therapies Classroom, 15 South Elm St, Wallingford. Info: EmeiQigongChan.com.

Feng Shui for the Chakras w/RMT-Holistic Coach Diane Esposito – 6:30pm-8:30pm. Release/refresh/ focus and flow w/[+]Energy Crystals, EFT-Emotional Freedom Technique and Guided Imagery for in depth connection w/Chakras $247/4 Classes. Pre-class consult /register: 203-913-3869. PersonalHarmonyandHealth.com.

Qigong Group Healing & Silent Meditation – 6:30pm-8pm. (1st Thurs. of the month). All levels of health addressed. No experience necessary. Fee: donation. Holistic Therapies Classroom, 15 South Elm St, Wallingford. Contact Pat for more informa-tion if this is 1st attendance: 203-500-6492.

fridayIntroduction to Meditation – 8am-8:45am (Classes continue from 9/11 through 11/20 with no classes on 9/25, 10/16 or 10/23)). Learn and practice basic meditation techniques or share your own practice in this open meditation circle. Free for JCC members. Guest rates apply for non-members. JCC of GNH, 360 Amity Rd, Woodbridge. Susan Donovan: 203-387-2522 x265. [email protected].

Yoga with Marlene – 9:30am. (classes also offered Mon. 10:30am/7:15pm, Tues. 9:30am/6:30pm, Wed. 6:30pm, & Thurs.10am/6:30pm). Yoga classes for all ages and problems in a serene atmosphere with emphasis on stress-management. 1221 Village Walk, Guilford. Info: 203-453-5360.

Broadway Open Markets – 11am-2pm. (Sept 4, Sept 11, Sept 18 & Sept 25). Fruits and vegetables, gourmet foods, honey and maple syrup. Ve n d o r i n f o r m a t i o n : 2 0 3 - 8 5 6 - 8 5 3 4 . BroadwayOpenMarkets.com.

Intuitive Readings w/Susane Grasso – 11am-3pm (& Sat 9/12, 11am-3pm). Usui and Karuna Reiki Master and Clairvoyant Susane sees auras/mirrors of soul/emotions and physical being. Now also a certified Doreen Virtue Angel Reader. $1/min. Enchanted, 1250 Boston Post Rd, Guilford. 203-453-4000. EnchantedGuilfordct.com.

saturdayAkashic Record or Angelic Reading w/RMT, Diane Esposito – By Appt. 7 Days/week. Phone/In-Person. Ask empowering questions, awaken to signs, receive loving messages/guidance from angels, guides, loved ones. Develop spiritual senses. Wallingford. Register: 203-913-3869. PersonalHarmonyandHealth.com.

Tao Yoga – 8:30am-9:45am. Beginner-intermediate level yoga, meditation and breathwork. $16 drop-in or choose a monthly class package. One World Wellness Yoga Collective, 967 North High St, East Haven. OneWorld-Wellness.com/membership.html.

Free Jewelry Making Classes Every Saturday with $15 Purchase at KanduBeads – 11am-12pm. Learn a basic jewelry making technique every Saturday. Bring a friend! New location: The Watch Factory Shoppes, 116 Elm St, Cheshire. 203-439-8689. Kandubeads.com.

Pre & Post Natal Yoga – 11am-12:30pm. (Starts September 12). Students practice poses and move-ments that appropriately stretch and strengthen the body while preparing for, or recovering from, delivery physically and psychologically. Yoga in Middletown, 438 Main St, Middletown. 860-347-YOGA (9642). YogaInMiddletown.com.

ReikiShare: The Universal Reiki Plan – 11am-1:30pm. Pre-register to share Reiki and join in a FREE workshop to make it a Reiki day! The 3rd Sat. of every month. Free (“love offering”). Bloodroot Rest. 85 Ferris St, Bridgeport. Res-ervation only. Jim or Jeannette: 203-254-3958. [email protected].

Stony Creek Yoga for Stress Relief – 5:45pm-7pm. Classes taught by Gina Macdonald MA, LPC. Will emphasize the breath with flowing movement. $10/session. Walk-ins welcome. Willoughby Wal-lace Library. 146 Thimble Island Rd, Stony Creek. Contact Gina: 203-710-6665.

has been ranked in the best 50 in its size class among 200 companies named in the Franchise Business Review’s 2015 Top Franchises Report. The healthy living magazine was one of five franchise companies cited as best-in-class in the advertising and sales category. To select the top franchises across industries and performance categories, the organization surveyed more than 28,500 franchisees.

Franchise Business Review, headquartered in Portsmouth, New Hampshire, is a national franchise market research firm that performs independent surveys of franchisee satisfaction and franchise buyer experiences. 2015 marked its 10th annual Top Franchises Report.

For more information visit our website:

NaturalAwakeningsMag.com/mymagazine

or call 239-530-1377


Tur� Your Passion Into a Business

Own a Natural Awakenings MagazineOur publishers ranked us among the highest

in franchise satisfaction for our Training, Support, Core Values and Integrity!

For more information, visit our website NaturalAwakeningsMag.com/mymagazine

or call 239-530-1377

Natural Awakenings is now expanding into new markets across the U.S. Contact us about starting a magazine in a community of your choice or acquiring an existing pub-lication for sale highlighted in red below.Natural Awakenings publishes in over 95 markets across the U.S. and Puerto Rico. • Huntsville, AL• Mobile/Baldwin, AL*• Phoenix, AZ*• Tucson, AZ• East Bay Area, CA• San Diego, CA• Denver/Boulder, CO• Fairfi eld County, CT• Hartford, CT• New Haven/

Middlesex, CT• Washington, DC• Daytona/Volusia/

Flagler, FL• NW FL Emerald

Coast• Ft. Lauderdale, FL• Jacksonville/

St. Augustine, FL• Melbourne/Vero, FL• Miami & the

Florida Keys• Naples/Ft. Myers, FL• North Central FL*• Orlando, FL• Palm Beach, FL• Peace River, FL• Sarasota, FL• Tampa/St. Pete., FL• FL’s Treasure Coast• Atlanta, GA• Hawaiian Islands• Chicago, IL• Chicago Western

Suburbs, IL• Indianapolis, IN• Baton Rouge, LA• Lafayette, LA• New Orleans, LA• Portland, ME• Boston, MA• Ann Arbor, MI• East Michigan• Wayne County, MI• Western MI*• Minneapolis/

St. Paul, MN• Charlotte, NC*• Lake Norman, NC*• Triangle, NC• Central, NJ• Hudson County, NJ• Mercer County, NJ

• Monmouth/Ocean, NJ

• North NJ• North Central NJ• South NJ• Santa Fe/Abq., NM• Las Vegas, NV• Albany, NY• Buffalo, NY• Central NY• Long Island, NY• Manhattan, NY*• Queens, NY• Rochester, NY• Rockland/

Orange, NY• Westchester/

Putnam Co’s., NY• Central OH• Cincinnati, OH*• Toledo, OH• Oklahoma City, OK• Portland, OR*• Bucks/Montgomery

Counties, PA• Harrisburg/York, PA• Lancaster, PA• Lehigh Valley, PA• Pocono, PA/

Warren Co., NJ• Scranton/

Wilkes-Barre, PA• Rhode Island• Charleston, SC*• Columbia, SC• Grand Strand, SC*• Greenville, SC• Chattanooga, TN• Knoxville, TN*• Memphis, TN• Austin, TX• Dallas Metroplex, TX• Dallas/FW Metro N• Houston, TX• San Antonio, TX*• SE Texas• Richmond, VA• VA’s Blue Ridge• Seattle, WA• Madison, WI• Milwaukee, WI• Puerto Rico

Natural Awakenings recently won the prestigious FBR50 Franchise Satisfaction Award from Franchise Business Review. To learn more, visit FranchiseBusinessReview.com

• Meaningful New Career

• Low Initial Investment

• Proven Business System

• Home-Based Business

• Exceptional Franchise Support & Training

As a Natural Awakenings publisher, you can enjoy learning about healthy and joyous living while working from your home and earn a good income doing something you love!

No publishing experience is necessary. You’ll work for yourself but not by yourself. We offer a complete training and support system that allows you to successfully publish your own magazine.

Training, Support, Core Values and Integrity!

As a Natural Awakenings publisher, No publishing experience is necessary.

“I am impressed by the range of support provided to franchi-sees; it seems all the bases are more than covered to provide an owner the ability to be successful. Together with my experience, drive and desire to make a difference, it feels like a good fit.”

~ Holly Baker, Tucson, AZ

“Each month, the content is enriching, beneficial and very often profound. We are a source of true enrichment and nourishment for so many. We are bringing light and understanding to millions of people.”

~ Craig Heim, Upstate NY

“There’s such strength in this business model: exceptional content from the corporation paired with eyes and ears on the ground here locally. We rock!“

~ Tracy Garland, Virginia’s Blue Ridge

* Existing magazines for sale


ADVERTORIAL

Stick with Natural IodineNot All Supplements are the Same

A Few Drops Can Change Your Life!

You could feel better, lose weight or increase energy and mental clarity with a few drops of Natural Awakenings DETOXIFIED IODINE daily in water or topically on the skin. The supplementation of iodine, an essential component of the thyroid, has been reported to give relief from:

• Depression• Weight Gain• Fibromyalgia• Low Energy• Hypothyroidism• Hyperthyroidism• Radiation• Bacteria• Viruses

Order today, available only atShopNaturalAwakenings.com

or call: 888-822-0246

$19.99 plus $5 shipping • 1 btl. = 6-8 week suply

Like us on Facebook at Natural Awakenings Webstore

RadiationAlmost everyone is routinely exposed

to iodine-depleting radiation

Low-Sodium DietsOveruse of zero-nutrient salt substitutes

in foods leads to iodine depletion

BromineA toxic chemical found in baked goodsoverrides iodine's ability to aid thyroid

Iodine-Depleted SoilPoor farming techniques have led to

declined levels of iodine in soil

Iodized Table SaltIodized salt may slowly lose its iodine

content by exposure to air

The Hidden DeficiencyHaving the proper amount of iodine in our system at all times is critical to overall health, yet the American Journal of Clinical Nutrition fi nds that iodine defi ciency is increasing drastically in light of an increasingly anemic national diet of unpronounceable additives and secret, unlabeled ingredients. This defi cit now affects nearly three-quarters of the population.

Causes of Iodine Deficiency

A Growing EpidemicSymptoms range from extreme fatigue and weight gain to depression, carpal tunnel syndrome, high blood pressure, fi brocystic breasts and skin and hair problems. This lack of essential iodine can also cause infertility, joint pain, heart disease and stroke. Low iodine levels also have been associated with breast and thyroid cancers; and in children, intellectual disability, deafness, attention defi cient and hyperactivity disorder (ADHD) and impaired growth, according to studies by Boston University and the French National Academy of Medicine.

What to DoThe easy solution is taking the right kind of iodine in the right dosage to rebalance thyroid function and restore health to the whole body.

SatisfiedCustomers

I feel much more energetic, my thoughts are extremely clear, and my entire body feels more in balance. Natural Awakenings Detoxifi ed Iodine is the only change in my daily routine over the last 45 days. The way I feel today is better than at any point in my life that I can remember.

~ James

I’ve been taking this product for over a year and no single supplement, diet or approach (I have tried lots) has had as great an impact as this. I have my energy back, my metabolism is back on track and my mind is clear and the depression has lifted. I love this product and wish more people knew about it. I think many of us are defi cient in iodine and it can bring balance to the body. Thank you, thank you Natural Awakenings for offering it!

~ Pamela

Proper iodine supplementation with a high-quality product like Natural Awakenings Detoxifi ed Iodine can prevent harm

by protecting the thyroid and other endocrine glands and restoring proper hormone production.

{ }


classifiedsFee for classifieds is $25 for up to 300 characters & spaces and 15 cents per extra character & space. Submit online at NaturalNewHaven.com. Deadline is the 10th of the month.

ALS SUPPORT

THE ALS ASSOCIATION CONNECTICUT CHAPTER – Leading the fight to treat & cure ALS through research & advocacy while em-powering people w/Lou Gehrig’s Disease & their families to live fuller lives w/compas-sionate care & support. 4 Oxford Road, Unit D4. Milford. 203-874-5050. WebCT.alsa.org.

BUSINESS OPPORTUNITY

CAREER OPPORTUNITY IN PRESTIGIOUS SALON – For as little as $65 per week, you can own your own business, make your own hours, keep 100% of your sales in an established state of the art salon & spa. Fear no more of opening your own salon due to the costly start-up expenses. Do not wait to move on this opportunity. Call 203-980-3163.

START A CAREER YOU CAN BE PASSIONATE ABOUT – Publish your own Natural Awakenings magazine. Home based business complete with comprehensive training and support system. New franchises are available or purchase a magazine that is currently publishing. Call 239-530-1377 or visit NaturalAwakeningsmag.com/mymagazine.

HELP WANTED

W E L L N E S S PRACTITIONERS AND MASSAGE THERAPISTS – Opportunity to work in the shoreline’s most prestigious wellness center and spa. Make your own hours, be your own boss and keep 100% of your sales without the costly start up expenses. For as little as $65 per week, this opportunity will not last long. Call 203-980-3163.

HYPNOSIS/LIFE COACHING

HYPNOSIS THERAPY CENTER – Providing the help you need to Relax & Resolve: stress, anger, anxiety, emotional issues, bad habits or the past. Life Coaching for personal & professional development. Psychic Readings for insights or Music Therapy to re-balance the mind & body. Madison. 203-245-6927.

OFFICE SPACE FOR RENT

OFFICE SPACE AMITY – Dynamic, integra-tive practice expanding, currently ND, LMT, Bowen Reiki. Looking for like-minded practitioners. Newly renovated well lit w/ground level entrance, views of West Rock. Easy access to Routes 15, 69, 63 Whalley Ave. Searching for Integrative Medicine, NP, CNM, DO, PA or MSW, etc. Please contact clinic director Dr. Lou Cofrancesco. [email protected].

SHARED OFFICE SPACE – In a Professional Building located in Southbury, CT. Available Monday, Wednesday and Friday. $350 per month all utilities includes. Please call Heidi at 203-733-1805 for details.

S MA LL CON FER EN C E/WOR KSHOP SPACE AVAILABLE – Perfect for 10 people and under. Located in a professional building in Southbury, CT. Easy on/off to I 84. Call Heidi at 203-733-1805 for details.

SPREAD YOUR WINGS

ADD A REJUVENATION STUDIO to your EXISTING beauty, fitness, or health/wellness busi-ness. – Bring in new customers, gain revenue from several sources, and your customers will love it! For more information, call: 864-569-8631.

WEIGHT LOSS

DETOX YOUR SYSTEM AND TURN YOUR BODY INTO A FAT BURNING MACHINE. –The 10-Day Transformation Cleanse is the fastest, simplest, healthiest weight loss program on the planet. Lose 5-20lbs in just 10 days with this vegan, organic, non-GMO, green super food cleanse. Free one-on-one coaching and group support. Contact Joy to save $50 now with special gift code. Independent Distributor/Trans-formation Coach: Joy Nagle. 203-257-3654. [email protected]. Mypurium.com/joyousom.

WOMEN WALKING PARTNERS

CONNECT WITH THE “GET OUTSIDE AND WALK” MOVEMENT OF WOMEN WALKING PARTNERS – Find the walk-ing partners. Be a walking partner. Join us. [email protected]. WomenWalking .net.

To advertise or participate in our next issue, call 203-988-1808

Together We Can Make A Difference

JOIN US! How does your product, service

or project support our local or global community?

Be a part of our special Working Together October Issue


communityresourceguideConnecting you to the leaders in natural healthcare and green living in our community. To find out how you can be included in the Community Resource Guide visit our website NaturalNewHaven.com and click our Advertise menu.

ALLERGY

ADvANcED ALLErgY rELiEF oF ctAnne Mitchell, NDNorth Haven and West Hartford Offices203-239-3400aarct.com

Do you have asthma, hay fever, sinusitis, excema or other allergy symptoms? Are you careful about what you eat because of food allergies or intolerances?

At Advanced Allergy Relief, we offer a safe, rapid elimination of allergic reactions. No medication, No Needles, Child friendly, Effective.

ALTERNATIVE HEALING ARTS

PErSoNALhArMoNYANDhEALth.coMWallingford, CT203-913-3869

Improve your quality of life w/empowering guidance & support. Move to the Heart of Healing w/Diane Esposito, RMT/Holistic Coach/author of Play, Heal, Love! The Art of Creating

Healthy Relationships. Be inspired; create habits & boundaries that heal w/in-person or phone Readings, Reiki, Reflexology, EFT, Angelspeake, Meditation. See ad on page 23.

rEAchiNg thE hArMoNY withiNRosa [email protected]

Do you WONDER why things happen? Do you SEEK a peace-ful, happy & effective LIFE? Gain insights and healing and connect to the wisdom of your soul with Akashic Records

Class/Consultation. Healing Touch energy therapy, Arcturian Healing, and Meridian therapy balance your mind, body, and spirit. See ad on page 23.

APPLIED KINESIOLOGY

kEviN hEALY, Dc Madison, CT203-245-9317 [email protected]

Applied Kinesiology is neuro-logical evaluation to find dys-function. It addresses problems instead of chasing pains. Dr. Healy tests if a therapy benefits the dysfunction and finds imme-

diate answers about which result in the most im-provement. Chiropractic, craniosacral, myofascial, and acupressure are among the therapies Dr. Healy uses. No single cure exists since disease (which includes a state of dysfunction) typically involves many areas of the body. The goal of any therapy-physical, chemical, or emotional-is to improve function, and a combination of therapies has the best results. See ad on page 32.

BREAST THERMOGRAPHY

XtorAYS.coMDigital Infrared Thermal Imaging Suzanne Pyle, MS, CTT 866-XtoRays • 203-331-2878

Get peace of mind with safe (no radiation), FDA-approved b rea s t c ance r s c r een ing . 8 years earlier detection vs mam-mography. Cert if ied DITI thermographer Coveniently located throughout CT.

EDUCATION

coNNEcticut EXPEriENtiAL LEArNiNg cENtEr (cELc) MiDDLE SchooL28 School Street, Branford, CT 06405 203-433-4658 [email protected] http://CTEXperiential.org

CT Experiential Learning Center (CELC) of Branford is a dynamic middle school that provides small classes and combines exceptional academics with hands-on and real-world

learning experiences to fit the academic, social, and developmental needs of the 5th–8th grade student. Contact us to schedule a visit or for more information at: [email protected] or call 203-433-4658. See ad on page 33.

thE grADuAtE iNStitutE (tgi) Accredited, Non-profit Graduate School offering holistic programs in contemporary and emerging fields 203-874-4252 Learn.edu

The Graduate Institute offers holistic master’s degrees and certificate programs for adult learn-ers. Programs include Integrative Health and

Healing, Ecotherapy and Cultural Sustainabil-ity, Writing and Oral Tradition, Organizational Leadership, Integrative Health Coaching and Patient Navigation, and more. See ad on page 11.

HAIR RESTORATION

JADAk hAir rEStorAtioNAgnieshka Jadak102 Wall Street, Madison, CT203-859-0605JadakHairRestoration.com

Non-surgical hair replacement is wonderful option for those who s u f f e r f r o m s i g n i f i c a n t hair loss and would like to regain the appearance of having a full head of hair without surgery or a

wig. We have some incredible hair systems that are attached to the head and they can be treated as your own hair. With our restoration system you can look the way you have always wanted. See ad on page 13 and profile on page 21.

HEMORRHOID TREATMENT

A LiFE cENtEr 2 Broadway, North Haven, CT203-239-3400 [email protected] TheLifeCenterofct.com

GOT HEMORRHOIDS? Now there is an easy non-surgical treatment that eliminates bleed-ing, pain, and swelling of hemor-rhoids. It is quick, painless, and effective. There is no need to suffer any longer. Covered by

most insurances. Call The Life Center for RELIEF. See ad on page 3.


HOLISTIC DENTIST

MArk A. brEiNEr, DDS, FiAoMt501 Kings Highway East, Suite 108Fairfield, CT 203-371-0300 WholeBodyDentistry.com

Dr. Mark A. Breiner is a pioneer and recognized authority in the field of holistic dentistry. With over 30 years of experience, he is a sought after speaker and lecturer. His popular consumer

book, Whole-Body Dentistry, has been sold world-wide. See ad on page 31.

HOLISTIC CENTER

AvANt gArDE328 East Main StreetBranford, CT203-481-8443 AvantGardeCT.com

Body, mind and soul experience to honor all aspects of one’s being, in a Mediterranean

retreat ambience. Ayurveda; Reiki; Hypnotherapy; Psychic Medium; Shamanic Practices; Sacred Geometry; Heartmath; Kirtan; Yoga; Meditations; Crystal Bowl Healing; Harmonic Gong Immersion; and Inspirational Movies. Fair trade, eco-friendly, metaphysical, jewelry, gifts, hand-made items, crystals, décor, natural hair/skincare. Hair artistry, color, hilite, curly hair experts, spa facials, micro-derms and massage. See ad on page 9 and profile on page 21.

HOLISTIC PSYCHIATRY

FAMiLY PSYchiAtric SErvicES, LLc1 Evergreen Avenue, Suite 34Hamden, CT 06473203-747-5282FamilyPsychiatricServices.com

Offers a holistic approach to mental health. Practice offers alternatives to traditional psychiatric treatments, utiliz-ing nutritional and naturalistic

means to achieve well-being.

HOLISTIC THERAPIST

EArth DANcEBranwen OShea-Refai, LCSWBethany, CT203-393-1717 EarthDancing.com

Branwen, a LCSW, Kundalini Yoga Teacher, Sound Healer, Healing Touch Practioner, and Intuitive has 17 years experience as a holistic counselor. Utilizing Yoga, Talk Therapy, Sound

Healing, Meditation, and Energetic Wellness. Treat-ing trauma, anxiety, depression, grief, eating disor-ders, pain, and stress in children and adults.

HYPNOSIS/REIKI

coNNEcticut hYPNoSiSHeidi Vollmer, M.Ed, CHSouthbury, CT203-733-1805CTHypnosis.com

We use hypnosis, NLP, past life regression and Reiki to help you with weight loss, freedom from smoking and stress reduction. Now taking the first step toward a healthy life is effortless with

our free initial screening and affordable payment plans designed to fit any budget. Ask us how to become a hypnotist yourself.

MENTAL HEALTHCOUNSELING

ANNAhAvEN bEhAviorAL hEALth SErvicES, LLc Anna Martin, BSW, MSW, LCSW 410 State St, North Haven, CT203-606-2071 CounselingWithAnnaMartin.com

It’s time to enjoy your life! YOU deserve to be happy. AHBHS helps with depression, anxiety, PTSD, OCD, Obesity, agarophobia,

domestic violence, ADD, ADHD and anger management. Phone, internet, skype and office sessions. Evening and weekend hours are available. Most insurance accepted, including Med-icaid, Medicare and Husky.

NATUROPATHIC PHYSICIANS

whoLE-boDY MEDiciNE, LLcAdam Breiner, ND, DirectorElena Sokolova, MD, NDDavid Brady, ND, CCN, DACBN 501 Kings Highway East, Suite 108 Fairfield, CT 203-371-8258 WholeBodyMed.com

Using state-of-the-art science combined with centuries-old healing modalities, our caring naturopathic doctors correct underlying imbalances and ad-dress issues which may interfere with the body’s abilityto heal itself. Treatment protocols or therapies include: Abdominal Manual Therapy, Acupuncture, Allergy Desensitization, Chi-nese Medicine, Colonics and other Detoxification Protocols, Electro-Dermal Screening, En-ergy Medicine, FDA-cleared Phototherapy, Functional Medi-cine, Herbal Medicine, Home-opathy, Hormonal Balancing, Hyperbaric Oxygen Therapy, Metabolic Typing, Nutritional

Assessment, Real-Time EEG Neurofeedback, and other therapies. See ad on page 31.

ORGANIC HAIR SALON

orgANic hAir SALoNEverlastings, by Arlene Bouley The Carriage House At The Gate House West 2614 Boston Post Rd, Guilford, CT 203-458-1298 EverlastingsSalon.com

Everlastings is a full-service hair salon & spa whose passion and mission is to provide healthier, more natural organic alternatives to salon services. All products are chemical-free. You will leave

feeling fulfilled, refreshed and cared for. See ad on page 33.


SELF DEVELOPMENT

ShAroN riNALDo, MACertified LifeLift Coach 203-494-7110 [email protected]

Certified LifeLift coach and Reiki Master Sharon Rinaldo facilitates Life Enhancement Groups, does individual, group and grief counseling, and is a Justice of the Peace/Ordained Minister. She

helps plan and officiate unique, personalized wedding ceremonies for all genders and faiths. See ad on page 23.

WEIGHT LOSS

A LiFE cENtErDr. Jenna Henderson 2 Broadway, North Haven, CT 1007 Farmington Ave, Suite 7A, West Hartford, CT203-239-3400 [email protected] TheLifeCenterofct.com

Medically supervised weight loss program. Get off the dieting merry-go-round and FINALLY achieve your ide-al weight. We offer a whole foods diet, individualized nutri-tion, emotional eating support, meal planning and weight loss

coaching. COVERED BY MOST INSURANCES . See ad on page 3.

YOGA

rAvEN’S wiNg YogA19 South Main St. Branford, CT203-488-9642RavensWingYoga.com

Rooted in the sacred teachings of yoga, Raven’s Wing is an inviting & safe place for all who desire pos i t i ve change . Gen t l e , beginner, moderate and vigorous classes offered, as well as month-

ly workshops, kirtan and seasonal celebrations. Ayurveda and private instruction also offered. See ad on page 32.

Natural Awakenings online magazine

A green way to read

• Click weblinks

• Find local businesses and events

• Join our growing social network

Archive issues

dating back to 2008

also available online

NaturalNewHaven.com


MEET OUR NAN PROVIDERS in New Haven and Middlesex Counties

AMSTON A PLACE OF HEALING Kelly Ann Matuskiewicz 203-747-8444 KellyAnnCory.com

ANSONIA MY HEALTH 1ST URGENT CARE 203-751-9875 MyHealth1stUrgentCare.com

BETHANYS.M. Cooper Photographic Artist 203-393-9545 SMCooper.com

DURHAM CASHMAN NUTRITION Natalie Cashman 860-398-4621 CashmanNutrition.com

DURHAM NATUROPATHIC HEALTH & WELLNESS CENTER Jason Belejack, N.D. 203-824-7428 DurhamNaturopathichealth.com

DANCING WITH ANGELS LIFE COACHING Diana R. Carr 860-349-9542 DianaCarr.wordpress.com

EAST HADDAMCT FARM FRESH EXPRESS, LLC 860-873-8760 CTFFE.com

EAST HAVENATLAS CHIROPRACTIC Adam Church, D.C. 203-466-1111 Dr.Church.com

EMPOWER MASSAGE Christopher Chialastri, LMT#005812 Home Visits for Massage Therapy 203-430-3163 EmpowerMassage.abmp.com

ESSEXDOROTHY MARTIN-NEVILLE, PhD Psychotherapy-Adults in Transition Emotional & Spiritual Aspects in Health Care 860-461-7569 DrDorothyct.com

GUILFORDEVERLASTINGSORGANIC SALON & SPA 203-458-1298 EverlastingsSalon.com

MASSAGE SAVVY 203-453-8667 MassageSavvyCT.com

HAMDENCOLOR ESSENCE Joan S. Gilbert 828-551-0420 [email protected]

HAMDEN continued COLOR ESSENCE Joan S. Gilbert 828-551-0420 [email protected]

DENNY CHIROPRACTIC & ACUPUNCTURE Eileen Denny, D.C. 203-407-8468 DennyWellness.com

JUNE CAN CHANNEL June Can, Reiki Master Practitioner International Channel & Medium 203-230-1197 http://junecanchannel.blogspot.com

LISA LAUGHLIN, N.D 475-227-2773 NaturopathicWellnessLLC.com

NATURAL FAMILY HEALTH Wendy Leigh White, N.D. Jasmine Manning, N.D. 203-281-5900 NaturalFamilyHealth.net

TAKE SHAPE FOR LIFE Marni Esposito 203-430-1009 YouCanLiveHealthyNow.tsfl.com

THE TAX GUY Thomas Fortuna 203-684-3512 TheTaxGuy.us

TRANQUIL HEALING REIKI, LLC Anita Jones, RMT 203-415-4791 TranquilHealingReiki.com

Calling All Holistic and Green Businesses!Interested in becoming a NAN Provider?Information: 203-988-1808 [email protected]

NaturalAwakeningsNetwork.com


MADISONCOASTAL CHIROPRACTIC AND WELLNESS Keith Mirante, D.C. 203-245-8217 DrMirante.com

MIDDLEFIELDMARY ELLEN MONEYMAKER HYPNOTIST 860-349-7039 SolutionsByHypnosis.com

MIDDLETOWNCONNECTICUT YOGA CENTER 860-986-2017 CTYogaCenter.com

YOGA IN MIDDLETOWN 860-347-YOGA (9642) YogainMiddletown.com

MILFORDCHIROPRACTIC & WELLNESS CENTER OF MILFORD Elizabeth Rumley, D.C. 203-713-8600 CWCofMilford.com

HEALTHY FOODS PLUS Natural/Organic Foods/Gluten-Free Vitamins/Supplements/Beauty Aids 203-882-9011

IMPRESSIONS SERVICES Raymond Daneault 800-217-1963 ImpressionsClean.com

JOANN DUNSING HYPNOSIS Joann Dunsing 203-907-7710 JoannDunsing.com LYNN LYONS Wt. Release/Loss/HypnoBirthing 203-415-8567 LynnALyons.com

MY HEALTH 1ST URGENT CARE 203-693-3676 MyHealth1stUrgentCare.com

MARCY DOLAN, N.D. Milford, CT 475-282-4112 [email protected]

PATTY SCHEIN Holistic Counseling 203-878-3140 PattyScheinLMFT.com

PRISCO CONSULTING Priscilla Lynn 203-530-0103 PriscoPR.com

MILFORD continued

ROI MARKETING OF NEW ENGLAND Bob Kademian 866-306-9799 [email protected]

TINA KADISH Life and Health Mentor 203-610-7477 LifeisIdeal.com

NEW HAVENTHE SERENE SPOT Anaika Ocasio 203-400-1293 TheSereneSpot.com

NORTH HAVENADVANCED PHYSICAL MEDICINE CHIROPRACTIC AND WELLNESS CENTER Candice Pollack, D.C. 203-691-5581 Apmct.com INNER HARMONY HOLISTIC WELLNESS Karen Obier, Reflexologist 203-645-2188 InnerHarmonyHolisticWellness.abmp.com

STEAMATIC OF CT Vincent Farricielli 203-985-8000 SteamaticCT.com

ORANGE ADVANCED SPINE & SPORT David Durso, D.C. 203-553-9300 AdvancedSpineAndSport.com

PORTLAND STAIRWAY 2 HEAVEN Holistic Center 860-770-2126 Stairway2Heaven.net

TRUMBULL SERENITY BODY WELLNESS Rosa Cervoni, LMT #003111 Reflexologist/Reiki Practitioner 203-929-1002 SerenityBodyWellness.com

WALLINGFORDL.O.V.E. Lghtworker of Vibrational Energy LLC Gayle Franceschetti 203-265-2927 Return2Love.net

PERSONAL HARMONY AND HEALTH, LLC Diane Esposito, RMT/Holistic Coach 203-913-3869 PersonalHarmonyAndHealth.com

WATERBURY

CHASE PARKWAY PODIATRIC GROUP, LLC Sports Medicine Dr. Joel Segalman, M.D. 203-270-6724 DrSegalman.com

WEB-BASED BUSINESSESGREEN & GLOBAL MEDIA, LLC KellyAnn Carpenter 203-533-9823 GreenandGlobalMedia.com

LGN CONSULTING Lisa Nastu 203-301-4109 LGNConsulting.com

LIFETIME HEALTH Venice Walters 203-507-0889 YORHealth.com/LifetimeHealth1

LIVER MEDIC 800-387-2278 LiverMedic.com

SUCCESS MARKETING, LLC Michael Guerin 888-542-2936 BestWebPresence.com

ZAHAVAH RAW BEAUTY Aadil Al-Alim & Faith Bredwood 203-389-0089 Zahavah.co

WEST HAVEN RUBINO CHIROPRACTIC CENTER Robert Rubino, D.C. 203-933-9404 RubinoBackCare.com

WOODBRIDGE

THRIVE CHIROPRACTIC AND WELLNESS Katey Hauser, D.C. 203-387-5015 WOODBURYALISON BIRKS, MS, RH (AHG), CNS New Morning Market 203-263-4868 NewMorn.com


f r e s h y o g a

Advanced Teacher Training with Ana Forrest

Forrest Yoga AdvancedTeacher Training

November 12th - 20th7:00 AM - 5:15 PM

Tuition: $2000Erector Square Location

319 Peck St New Haven 203 776 - 9642 (YOGA) www.freshyoga.com

The Forrest Yoga Advanced Teacher Training is a 9-day teacher training that allows teachers from other yoga schools and lineages to join the Forrest Yoga education program to learn and understand the art of sequencing, to practice and teach intermediate and advanced asana for different levels and to prioritize the needs of students with special needs and injuries.

Ana Forrest has been changing people’s lives for 40 years. Internationally recognized as a pioneer in yoga & emotional healing, Ana created Forrest Yoga while working through her own healing from her life’s trauma and experience. With thousands of practitioners around the world, Forrest Yoga is renowned as an intensely physical, internally focused practice that emphasizes how to carry a transformative experience off the mat and into daily life.

Documents

Natural Awakenings New Haven & Middlesex SEPT 2015