Norwood August 2013

BY RENÉE PLANT

The real estate market is picking upsteam. With housing prices, resale inven-tory and interested buyers on the rise, anupward turn hasbegun in a marketthat has been dis-tressed over thepast severalyears. While thisupturn is a na-tional trend, Nor-wood is certainlyno exception tothe rule, with bid-ding wars onhomes and prop-erties spendingless time on themarket than otherc ommun i t i e sthroughout thecountry.

Since the begin-ning of 2006when homeprices peaked, themarket has seen a steady decline in theprices of homes as well as the amount ofinventory available. According to PattyMcNulty, owner and broker of McNultyRealtors in Norwood, low price tags

were dissuading sellers from listing theirhomes as recently as through last year.

“People weren’t anxious to sell lastyear because they saw the low prices as

well as the amount of foreclosures andshort sales,” she said. “The amount offoreclosures and short sales has de-creased [this year]. Homes are priced

more reasonably this time around.”

Justin Reynolds, a broker who hasbeen practicing real estate outside ofBoston for nearly 50 years, says the

housing crashthat had beenaffecting themarket wassubstantial butnot surprisingor uncommon.

“It was a na-tional drop, hesaid. “It’ssomething thatseems to cycleplus or minusevery 15 years.This timearound [thedrop] lasted alot longer.”

However, asForbes Maga-zine contribu-tor BillConerly pre-

dicted in 2012, the market was recover-ing and home sales were thought to

Vol. 4 No. 2 Free to Every Home and Business Every Month August 1, 2013

Norwood Prices, Buyers and Real Estate Inventory Increase in 2013

The Ellis Rehabilitationand Nursing Center Celebrates40 yearsBY RENÉE PLANT

When most people talk about building a business,they don’t mean literally.

However, that is exactly how The Ellis Rehabili-tation and Nursing Center came into Danielle Fed-erico’s family.

“My father was a contractor and was building thefacility for a doctor,” Federico said. “Ultimately,the doctor didn’t have the funds to buy it, so my fa-ther was left to run the center himself.”

Federico’s father, Anthony A. Franchi, openedThe Ellis Rehabilitation and Nursing Center in1973. Federico says Franchi learned the ropes ashe went and was clearly triumphant in his venture,as the facility is celebrating its 40th anniversary thisyear.

“He had no background whatsoever,” Federicosaid. “But he wore an administrative hat and raneverything. As he figured it out, he hired more peo-ple to make it successful.”

PRST STD

U.S. POSTAGEPAID

Norwood, MAPermit #7

Postal Customer

Local

[email protected]

www.gilloolyfuneralhome.com A Service Family Affiliate of AFFS and Service Corporation International206 Winter Street, Fall River, MA 02720 • 508-676-2454

GilloolyFuneral Home

126 Walpole Street, Norwood, MA 02062Phone: (781) 762-0174 • Fax: (781) 762-2818

Register for Our Next FREE

Gift of PlanningSeminar

August 10 & September 14Please RSVP to (781) 762-0174by August 8 (for 8/10) andby September 12 (for 9/14)

Frederick J. Wobrock • William G. Crowley

Pleasant St Auto1081 Pleasant St • Norwood

8

781-769-0077

825 PROVICENCE HIGHWAY, NORWOOD, MA - ROUTE 1 - THE AUTOMILEjackmaddenford.com • Call 888-836-1758 for appointment

Not to be combined with other specials or offers. Diesels, full synthetics and hybrids extra. Expires 8/31/13. Must present coupon upon arrival. Ford and Lincoln Mercury Only.

includes up to 6 quarts of oil, oil filter, free multi point inspection

OIL & FILTER CHANGE$1695

Not to be combined with other specials or offers. Expires 8/31/13. Must present coupon upon arrival.

Any Service WorkUp to $200.00 in savings!

MANAGER’S SPECIAL

20%OFF

Jack MaddenJack Madden

Jack Madden Jack Madden

REAL ESTATEcontinued on page 6

ELLIScontinued on page 9

Employees and customersfrom One Bistro and the FourPoints by Sheraton Norwood or-ganization on Route 1 showedtheir support and compassionfor the victims of the BostonMarathon bombing. From May20-26, One Bistro donated apercentage of their week's rev-enue to the One Fund Boston.From those receipts, and a littleextra kicked in from One Bistro,the fundraiser brought in$5,000.

'We were so deeply impactedby marathon Monday thateveryone wanted to do some-thing, Paul Dooley, Four Pointsby Sheraton Norwood AssistantGeneral Manager said. "We de-cided to pick a week and let ourcustomers know that we weregoing to raise money to put asidefor the Boston Fund."

An email blast was sent out tothe restaurant's regular cus-tomers approximately a week

before the promotion. Accordingto Dooley, the response was agreat endorsement of the Nor-wood community and OneBistro's commitment to assist theinnocent victims of the tragedy.

"After the email blast was sentout, customers responded imme-diately and said, WOW, we willbe in to support you," Dooleysaid.

Proceeds from the dining ben-efit are now on their way to theOne Fund Boston to help thoseseverely affected by that heart-breaking day.

Page 2 Local Town Pages www.norwoodtownnews.com August 1, 2013

Published MonthlyMailed FREE to every home

in Norwood Circulation: 15,000 households

Publisher

Chuck Tashjian

sales

Chris Robertson

Production & layout

Gorette SousaMichelle McSherry

advertising dePartment

781-762-NEWS (6397)Ad Deadline is the 15th of each month.

Localtownpages assumesno financial liability for errors

or omissions in printed advertising and reserves the right to reject advertising or

editorial submissions.

© Copyright 2013 LocalTownPages

www.oneb i s t r o . c om

Lobster Fest!1.5 lb fresh lobster stuffed with scallops,

crab and shrimp, served with PEI mussels,corn on the cob, roasted potatoes, and a

cup of New England clam chowder.

z z

25 (excluding tax and gratuity)

L I K E U S O N

FR IDAY N IGHTS

START ING JUNE 21 s t

Lobstz

er FLobst

est!er Fer Fest!z

cup of Norc

crab and shrimp, ser1.5

w England clam chowecup of Ncup of Neoes, and aed potatstob, roan on the cor

ved with PEI mussels,crab and shrimp, serer stuffed with scalresh lobst lb f lb fresh lobst

T ING JUNE 21 s tARST

Y N IGHTSFR IDA

.derder.w England clam choww England clam chowderoes, and a

ved with PEI mussels,lops, er stuffed with scal

. o neb i s t r o . c omwww

. o neb i s t r o . c om

One Bistro

Run Your

Inserts &

FlyersWith Us!

Call (508) 468-6916

August 1, 2013 Local Town Pages www.norwoodtownnews.com Page 3

• LAWNMOWERS• SNOWBLOWERS • CHAINSAWS• TRIMMERS• LEAF BLOWERS• HEDGE CLIPPERS• AUTHORIZED

WARRANTY REPAIRS• ESTIMATES GIVEN

UPON REQUEST• PICKUP/DELIVERY

AVAILABLE

• GENUINE OEM PARTSBY MTD & AYP PARTS

• ENGINES SERVICED:BRIGGS &STRATTON, KOHLER,HONDA, TECUMSEH,LCT

• FAST, RELIABLE &GUARANTEEDSERVICE

• NEXT DAY PARTSAVAILABLE

• LAWNMOWERS• SNOWBLOWERS • CHAINSAWS• TRIMMERS• LEAF BLOWERS• HEDGE CLIPPERS• AUTHORIZED

WARRANTY REPAIRS• ESTIMATES GIVEN

UPON REQUEST• PICKUP/DELIVERY

AVAILABLE

• GENUINE OEM PARTSBY MTD & AYP PARTS

• ENGINES SERVICED:BRIGGS &STRATTON, KOHLER,HONDA, TECUMSEH,LCT

• FAST, RELIABLE &GUARANTEEDSERVICE

• NEXT DAY PARTSAVAILABLE

MON – FRI: 8 -5 • SAT: 8 – 1

508.376.9093

Fax: 508.376.9094 • http://www.thegardenspotmillis.com

1420A Main Street - Millis

$10 OFFWith coupon only. Coupons may not be

combined with any other offer.Limited time only.

Any CompleteTune-Up Service

The Garden Spot

1420A Main St. Millis, MA 02054

Outdoor Power Equipment

SALES & SERVICE MON – FRI: 8 -5 SAT: 8 – 1

508.376.9093 1

! LAWNMOWERS, SNOWBLOWERS, CHAINSAWS, TRIMMERS, LEAF BLOWERS, HEDGE CLIPPERS & MORE!

! AUTHORIZED WARRANTY REPAIRS ! ESTIMATES GIVEN UPON REQUEST ! PICKUP/DELIVERY AVAILABLE ! FAST, RELIABLE, & GUARUNTEED

REPAIRS ! OEM PARTS AVAILABLE:

o MTD & AYP GENUINE PARTS o ENGINES SERVICED:

" BRIGGS & STRATTON, KOHLER, HONDA, TECUMSEH, LCT

o NEXT DAY SHIPPING AVAILABLE

1420A Main Street, Millis, MA 02054 WWW.THEGARDENSPOTMILLIS.COM

Outdoor Power Equipment

SALES & SERVICE MON – FRI: 8 -5 SAT: 8 – 1

508.376.9093 1

! LAWNMOWERS, SNOWBLOWERS, CHAINSAWS, TRIMMERS, LEAF BLOWERS, HEDGE CLIPPERS & MORE!

! AUTHORIZED WARRANTY REPAIRS ! ESTIMATES GIVEN UPON REQUEST ! PICKUP/DELIVERY AVAILABLE ! FAST, RELIABLE, & GUARUNTEED

REPAIRS ! OEM PARTS AVAILABLE:

o MTD & AYP GENUINE PARTS o ENGINES SERVICED:

" BRIGGS & STRATTON, KOHLER, HONDA, TECUMSEH, LCT

o NEXT DAY SHIPPING AVAILABLE

1420A Main Street, Millis, MA 02054 WWW.THEGARDENSPOTMILLIS.COM

OOuuttddoooorr PPoowweerr EEqquuiippmmeennttSSaalleess && SSeerrvviiccee

• Full Cars & Dot Commercial Inspection Station(All Makes, All Models, including Trailers)

• Full Line of Domestic & Foreign Auto Repair

Do It Here • Do It NowMASS STATE INSPECTION

$30 OFF

Coupons cannot be combined.

DOT Inspection

1081 Pleasant St • Norwood

Official Commercial & Diesel Station

8

$14.95Oil Change Special

(Most Cars)Coupons cannot be combined.

with Inspection

The winners have been announced for the 2013 Annual Morrill Memorial Library Essay Contest. Thecontestants were asked to describe "The Best Book Ever," and submitted their written works between May15 and June 15. The contest was divided into three sections: grades 3-5, 6-8 and 9-adult. Winners wereawarded Barnes & Noble gift cards with funds generously donated by a Boch Fund donation.

A reception will be help September 9, in the Simoni Room, where the writers will read their essays.

The talented winners of this year's contest:

Grade 3-5First Place:Vincent Carrara

second Place:Hannah Islam

third Place:Samuel White

honorable mention:Antonio Mosca, Rithika Prasad, Lindsey Wychay

Grade 6-8First Place:Alyssa Naumann

Grade 9-AdultFirst Place:Brad Cole

second Place: Daniel P.B. Smith

third Place:Deepti Kamma

honorable mention:Chloe Belanger, William Condaxis, Hannah Howard

Winners Announced for LibraryEssay Contest

Norwood residents who havefrequented the Norwood Farmer'sMarket this year may have noticeda few very engaging changes. Itcontinues to offer the finest freshproduce from local stands, but ithas also progressed into a diverseshopping market with manyleisurely options. The variety ofmeal choices have expanded andthere are now many free, yes free,

educational classes and entertain-ment the entire family can enjoy.

The evolvement of the Farmer'sMarket is credited to its hard-working committee and morespecifically, Laurie Shea, in her in-augural season as the Farmer'sMarket Manager. According toShea, this year's objective is to de-velop the Norwood Farmer's Mar-ket into a diverse family-friendly

weekly event to attract and involveresidents of all ages for a summerafternoon of fun and education. Inaddition to drawing on her vastfundraising experience, Sheaspends every week visiting mar-kets throughout the area for inspi-ration and ideas to shapeNorwood's market with food, cul-ture, workshops and local promo-tions.

"My approach is that it [market]can't be an afterthought," Sheasaid.

A few new additions to this year'smarket include, a chef's table withcooking demonstrations, fitnessclasses, music, children's storytime and demonstrations fromsome of Norwood's talented artistsand hobbyists. More free children'sevents are also being added, in-cluding a kid's area with arts andcrafts, numerous activities and facepainting and a scavenger hunt.

"When my kidswere little, I wasalways looking forfreebie things totake them to for anhour," Shea said.

Of course, thefinest in locally-grown producewill always be inabundance at theFarmer's Marketas well as manyother area specialty and home-made goods, such as seafood,bread, wine, gluten-free pasta andcheese. In fact, many shopperswho attend the market purchasetheir entire Tuesday night meal inone convenient location.

See the Norwood Farmer's Mar-ket schedule for a detailed list ofAugust and September events, butalso visit their website each weekas it updated regularly, at

www.norwoodfarmersmarket.com. Also, new vendors are contin-ually added to showcase theirwares on the Norwood Commonkeeping the purchasing and mealchoices new and exciting.

"Some come every week, butsome not there today may be therenext week," Shea said. "We arekeeping the market fresh not only

in produce but in variety."

If a resident or local business isinterested in hosting a children'sactivity, showcase their services,or host the chef's table, contactShea at 781-603-6771.

"Anyone who has the gift of gaband likes to cook are welcome,"Shea said. "It could even be mak-ing a smoothie or tossing a greatsalad."


532 Washington Street (Rt. 1A) • NorwoodDay and Evening Appointments

781-255-0300www.essentialsnorwood.com

Your retreat for body and soul

Give Yourself A Break. You Deserve It!Facials, Skin Care, Body Treatments, Nail Care, Pedicure,

Massage, Electrolysis, Waxing

$25.00Shellac Manicure

environmentally friendly nail station

With coupon only. May not be combined with any other offer.

Expires 8/31/13

$15.00OFFAny Facial

with steam extractionand finishing mask


Expires 8/31/13

$40.00Grapefruit Sparkle

Pedicureincludes treatment mask and

steamed towel wrap


Expires 8/31/13

The New Norwood Farmer's MarketMore than just a location to pick up freshproduce

View our menu at www.westwoodjade.webs.com

Honorable Mention

For Chinese Restaurant in Westwood

Readers ChoiceAward

2004, 2005 & 2006

2006

Gift CertificatesAvailable

FreeLarge order of spring rolls

or small pork fried riceWith any purchase of

$15 or more.Westwood Jade Restaurant

781-407-9229With this coupon. Coupon good after 4 pm.

Not valid with other offers. Offer expires 10/31/13.

FreeLarge Order

With any purchase of $20 or more.

Choose from: Crab Rangoon, Vegetable Lo Mein, Peking Ravioli or

Pork Fried Rice

Westwood Jade Restaurant781-407-9229

With this coupon. Coupon good after 4 pm. Not valid with other offers.

Offer expires 10/31/13.

FreeGeneral Gau’s Chickenor Sesame ChickenWith any purchase of

$30 or more.

Westwood Jade Restaurant781-407-9229

With this coupon. Coupon good after 4 pm. Not valid with other offers.

Offer expires 10/31/13.

Westwood JadeRestaurant

Open 7 days a week: Mon. - Thurs. 11am - 10pmFri. & Sat. 11am- 10:30pmSun. Noon - 10pm

WE DELIVER!$2 delivery charge(Westwood, Norwood,

Dedham)

CANTONESE & SZECHUAN CUISINE220 Providence Pike Route 1Westwood

781-407-9229fax: 781-407-9339

BYSAMANTHATINCLER

Former Norwood resident RichardMichael Barrett, better known asDicky Barrett, is the front man ofskacore band The Mighty MightyBosstones. Many not familiar withthe band's punk sounds, however,may have heard his voice on tv asthat announcer on ABC’s JimmyKimmel Live!. The singer-song-writer’s rasping tone is one of thedefining features of the Bosstones’sound. The band’s inception in 1984was headed by Barrett and brought awhole new style to the ska genre.Barrett’s creativity as a songwriterwas launched during his years atNorwood Senior High School.

Barrett was born on June 22, 1964,in Providence, RI. He and his family,his father, mother Pat, younger sisterKathy and older brother Billy, movedto Norwood in 1968. Barrett studied

at Xaverian Brothers High Schoolbefore transferring to Norwood HighSchool (NHS). Despite the fact thatBarrett has described himself in aninterview with the Norwood Tran-script and Bulletin, as “the worsttrombone player in the history ofNorwood’s band program,” it wasthere that he started exploring song-writing. With the guidance and men-torship of David Powell, an Englishteacher at NHS, Barrett experi-mented with writing, starting withpoetry and moving on to lyrics.

In 1984, Barrett and fellow band-mates Joe Gittleman, Tim Burton,Nate Albert, Josh Dalsimer, TimBridewell, and Ben Carr, formed theMighty Mighty Bosstones. Theband’s sound combined ska, a com-bination of calypso and rhythm andblues, and hardcore into the newgenre that they dubbed “skacore.” In

that same Norwood Transcript andBulletin interview, Barrett describedhimself as the “Godfather of Ska-core.” The band grew to fame far be-yond Boston's music scene withworldwide concerts and songs ap-pearing in major movies, such asClueless (1995), Chasing Amy(1997), and Step Brothers (2008).

The band has also had involvementin various social causes, such as theirappearance on the 1996 benefitalbum Safe and Sound, an event or-ganized in response to a deadly at-tack at a Brookline, MA women’shealth clinic. As a songwriter for theBosstones, Barrett has striven tobring social awareness to his lyrics.The song appearing on Safe andSound, “That’s The Impression ThatI Get,” deals with themes of facingdifficult choices and situations, andempathy for those who face them.

When The Mighty Mighty Bos-stones took a hiatus in 2003, Barrettmoved to Los Angeles and took onthe role of announcer on ABC’s late-night show Jimmy Kimmel Live!,and hosting The Mighty MorningShow on Los Angeles Indie Radio103.1. Despite this move, Barrettnever let go of his roots in Boston andNorwood. Kimmel often refers toBarrett as his “Boston expert,” andBarrett has stated “…my job is in theWest but my heart is in Massachu-setts.”

In 2007, the Bosstones reunited,and began a touring schedule, includ-ing the annual Homedown Throw-down performances in Boston andCambridge. Barrett continues to re-side in LA, and credits technologywith the band’s ability to stay to-gether. The band released their mostrecent album, “The Magic of Youth”,on December 6, 2011.


Hearing Care Center

Introducing the Latest Hearing Aid Technology from ReSound™Integrating iPhone™ and Android™ Remote Control

$200 Off Any Pair of Digital Hearing Aids••• On New Purchases Only •••

Not to be combined with any other offer – expires August 31, 2013.

~ Call NOW for a FREE CONSULTATION ~

Expert and Caring Audiologists

450 North Main Street • Cobb’s Corner • Sharon

781-784-1944www.HearingCareCenter.com

Hours 9:30am - 5:30pm • Monday through Friday

Dr. Paul MilnerPhD, CCC-A

Judy Learner NicholsMS, CCC-A

“Today’s Hearing Aids Are AboutStaying Young, Not Growing Old”

Helping PeopleHear Better andReconnect withLife Since 1989

Dr. Sergei Kochkin - Better Hearing Institute

Treat yourself to a pie that’s made the way they used to be.

Ever So Humble Pie Company, Inc. • 153 Washington Street, E. Walpolewww.eversohumble.com • 508-660-9731

Retail Store and Cafe Hours: Monday - Friday 8-6 Saturday 8-3

Notable Norwood Resident:Dicky Barrett

Dicky Barrett's Facebook pageFarmer’s Market Calendar

increase nationally as of this year.McNulty echoed this sentimentand says, while it can be difficultto predict exact figures, it was clearthe market was due for a turn-around.

“There was only one direction togo, and that was up,” she said.

According to McNulty, the num-bers have increased significantly asreflected from January 1 to July 15of 2012 in comparison to the sametimeframe in 2013. The number ofhomes sold in Norwood has risenfrom 85 to 95, with the averagesale price in 2012 at $333,309 upto $366,976 in 2013.

Real estate Web site http://mo-tovo.com shows this trend in Nor-wood is continuing on as of lastmonth. According to Motovo,“Norwood's home resale invento-ries increased, with an 11 percentincrease since June 2013. The me-dian listing price in Norwood wentup from June to July.”

McNulty says that while this is astark difference from last year, thistime of year is also the busiest withrespect to selling and buying prop-

erties, which results in greatercompetition among buyers.

“Spring is our busiest time ofyear,” she said. “A major differ-ence between this year and last isthat buyers are offering over themarket price on homes. The lastthree sales I was involved withended in bidding wars.”

According to the Web sitehttp://realestate.com, homes inNorwood are selling quickly com-pared to other communitiesthroughout the country. With re-spect to Norwood, the site states,“The median number of days ac-tive properties have been listedis 32. This is significantly shorterthan the national average.”

McNulty says while she expectsthings to slow during the holidayseason, as is the case with mostbusinesses, she sees the turn as apositive for real estate as well asfor individuals who are buying andselling.

“We are seeing a lot of first timebuyers compared to five or sixyears ago,” she said. “People aretaking advantage of the great inter-est rates, though they are begin-ning to go up. Overall, [the shift]is good for the economy.”


C

www.ecozonemobiledetailing.com

• Steam vapor cleaning witheco-friendly products

• No waiting • Save time & gas!• Safe for the environment

and your family

WE COME TO YOU!

Conscientious Car Care • Call Brien 508-505-7087

WALPOLE 421 High Plain St.Junction of Rtes 1 & 27(508) 668-1653

MEDFIELD547 Main St.Junction of Rtes 109 & 27(508) 359-4453

In StoreSpecials &

GiftCertificates

Available

Specialty Items for Any OccasionOpen Sundays

PalumboLIQUORS

Palumbo

Dog Days of August!

REAL ESTATEcontinued from page 1 An Organized Plan For Back to

School Shopping BY DEBBIE TREMBLAY, A.K.A.THE ORGANIZING GENIE

You can't miss it. Every retail es-tablishment you enter will be orhas begun pushing their big "BackTo School Sales." A statistic fromthe National Retail Federationstated that, "In summer 2010, par-ents spent over $20 billion on backto school items - and a further $33billion on back to college gear!"It's no wonder that retail establish-ments are pushing their "Back toSchool" sales early each year tocash in on this goldmine!

When such great sales abound,you need a plan of action. Here'sa quick guide to help you createan organized plan to ensure yourchild has everything they need tostart their new school year instyle.

• Most schools now provide par-ents with a list of supplies theirchildren will need for the class-room. Review the school's listand avoid purchasing dupli-cates by taking stock of last

year's supplies and immedi-ately cross of any items youwill not need. Just because it isa new year doesn’t meaneverything has to be brandnew, so utilize the items thatsurvived the last school year!Now is also a great time toevaluate what supplies you dohave and toss out broken pen-cils, dried out pens and mark-ers and broken or rippedbackpacks and lunch buckets.

• Next review your child'sschool clothes. Because chil-dren grow so fast, now is theperfect time to have your childtry on last year's school outfitsand donate worn-out or out-grown clothing and shoes.What may not fit your childany longer may be the perfectsize for another child in need.Unless your child wears aschool uniform, add whatclothing items you will needon your school supplies list.

• Now that you have created aback to school master supplylist, be sure to carry this list

with you at all times to take ad-vantage of any great bargainsyou come may come across.Weekly circulars should be-come your best friend to pin-point which establishment hasthe best deals for everythingyou need and plan your shop-ping accordingly.

• Take advantage of sales andstock up on school items yourfamily uses the most, includingnotebooks, reams of paper,glue, etc. Keep these itemsneatly stored in a box or con-tainer on a shelf in your officeor child's closet. Everythingseems to be a fraction of thecost now than it will behalfway through the schoolseason, so stock up while youcan!

• Teach your children the art oforganization by purchasing abackpack which includesmany interior organizing pock-ets. Discuss with them whatitems would fit best in eachcompartment and label themwith a sharpie.

• To make it easy for your childto locate any misplaced items,be sure to label all costlyschool supplies and clothingitems.

Avoid the last minute shoppingrush and your child's frown as youpick through leftover supplies.Grab your list today and find yourchild's favorite supplies at the bestprice, which will surely bring asmile to your child's face and yourwallet.

www.OrganizingGenie.com

Call Mr. Handyman to give yourhome the attention it deserves.

YOUR HOMEis your most valuable asset.

www.mrhandyman.com

MA HIC #146451

508-668-0098

Run Your Inserts &

Flyers With Us!

Call (508) 468-6916

BY BELLA CAGGIANO

The Norwood TONY(Ten Outstanding Nor-wood Youths) Awardswere initiated over 40years ago to recognizeexceptional Norwoodyouths in grades 10-12for their significantcontributions that in-cluded their time, effortand talent with volun-tary contributions totheir church, commu-nity and other worthycauses. To be eligible,the students must beNorwood residents butcan attend schools out-side of town. A panel offive judges, one fromthe business commu-nity, one from the townclergy, one from townofficers, one from theWomen's Communitycommittee and onefrom the Masons, re-view their individual nominationwhere they must answer five ques-tions and a 300-word essay onwhat community services meansto them.

Through blind judging, eachnominee is given a score and thetop ten result in a TONY Award.The Norwood Masons, who ac-quired the program 18 years ago,hosts an annual awards banquet inhonor of the award winners. Thisyear's banquet was held on January25. The award includes a citationfrom Governor Patrick, a plaquefrom the lodge, a $1,000 savingsbond and a gift card from Perk's

coffeehouse. Two supplementaryawards include an additional $500savings bond and a commemora-tive plaque.

Local Town Pages is proud torecognize and commend these ad-mirable young adults with a profileof each student in our monthlynewspaper. Recent Norwood HighSchool graduate Amanda Kelly isthe sixth student profile in our2013 TONY Award series.

When Norwood High School(NHS) Amanda Kelly volunteeredat Norwood Hospital during hersophomore year, it was a beneficialexperience for everyone involved.

The patients received akind, compassionateyoung woman to keepthem company and as-sist with their non-med-ical needs and Kellyreceived a great intro-duction into the healthfield, a career she willbegin pursuing at col-lege this fall.

"I want to be a doctorand maybe a pediatri-cian and wanted to gethospital experience,"Kelly said. I love thehospital environ-ment...being aroundpeople and making asmall difference. If Ibecome a doctor, I canhelp even more."

In addition to volun-teering at the hospital,Kelly has also beenvery active sharing herknowledge youngerchildren. She has tu-

tored at the Cleveland School, heralma mater, working with kidshelping in MCAS-related subjectsand at St. Timothy's church. Shealso instructed CCD classes to

kindergarten students and spent thepast two summers teaching vaca-tion bible school.

"I went to the Cleveland and Iloved to give back," Kelly said.

While juggling a hectic schedule,Kelly excelled in academics atNHS and used her great directiveskills in many of her honor andspecial interest clubs. She servedas treasurer of the National HonorSociety, the Spanish and DramaClubs and was an active partici-pant of the Drama Club since herfreshmen year. She was also amember of the Acapella Choir andJazz choir in her senior year andalso performed in four shows peryear in all four years at NHS, av-eraging a commitment of 20 hours

per week. At press time, her dramatroop was preparing a four specialshows abroad in Scotland ofSleeping Beauty & The Spinner.

"When I was younger I did the-atre camp, then took drama classesand I loved it," Kelly said.

Kelly choose a local school tocommence her college education.She will attend Northeastern in thefall and will major in biology on apre-med track.

"It has always been a school thatI wanted to go to because it is inthe center of Boston where all thegreat hospitals are and with thecoop you get to work while youare going to school," Kelly said.


Serving our customers fine Italian food for 20 years.www.pizzeriabrunos.comwww.pizzeriabrunos.com

Pizzeria Bruno’sFINE ITALIAN FOOD

FREE DELIVERYto Norwood & Westwood

TAKE OUT - EAT IN

Find us onFacebook forgreat deals!!

Enjoy the Taste of Real Home Cooking

Open Everyday: Mon - Sat 11am - 10pm • Sunday 4pm - 10 pm

Special Mon. • Tues. • Wed.

(781) 769-1454(781) 769-1454

2 Large Cheese Pizzas

• Large Cheese Pizza• Chicken Wings

• Any Salad$1495$1995+ Tax

+ Tax

Only

With coupon • Cannot be combinedwith any other offers. Limited time only.

With coupon • Cannot be combinedwith any other offers. Limited time only.

56 BROADWAY • NORWOOD56 BROADWAY • NORWOOD

CATERING SERVICE AVAILABLE

EMBRACE THE SUMMER!

COMPLIMENTARY CONSULTATION

SECOND OPINIONS WELCOME

PREFERRED PROVIDER FOR MOST INSURANCES

ELIGIBLE FOR USE WITH FLEXIBLE SPENDING

DR. JODI PARKER received her D.D.S. from Columbia University and Masters and Post graduate Orthodontic training at Loma Linda University

SUMMER PROMOTION$500 OFF*

FULL ORTHODONTIC “BRACES” or INVISALIGN TREATMENT

*OFFER VALID FOR TREATMENT STARTED WITHIN 45 DAYS OF CONSULTATION.

MUST BRING CARD TO INITIAL VISIT.

MEDFIELD ORTHODONTICSORTHODONTICS FOR CHILDREN AND ADULTS

266 MAIN STREET, BUILDING 3, SUITE 32A MEDFIELD, MA 02052

508.359.1989 · WWW.MEDFIELDBRACES.ORG

DR. JODI Ped her Deivecrolumbiaom Cfr

ersity and MasUnivosand P

Orthodontic troma Lindat LaersityUniv

ARKERDR. JODI PDR. JODI PARKER.S..Ded her D

olumbiaerstersity and Mas

etaduat grosainingOrthodontic tr

oma Lindaersity

MEDFIELD ORTHODONTICSTHODONTICS FOR

95508.3

266 MAIN S

MEDFIELD ORTHODONTICSOR CHILDREN AND ADULTHODONTICS F

2205, MA 0MEDFIELDCES..MEDFIELDBRAWW9 · W198.9

, BUILDING 3, SUITE 32ATREETTREET, BUILDING 3, SUITE 32A266 MAIN S

MEDFIELD ORTHODONTICSSTOR CHILDREN AND ADULOR CHILDREN AND ADULT

ORGCES.

, BUILDING 3, SUITE 32A

ONSULY CAROMPLIMENTOMPLIMENTAR C

COND OPINIONS WEL SEC

VIDER FOR MOPREFERRED PROINSURANCES

ELIGIBLE FOR USE WITH FLEXIBLESPENDING

TION

SUMMER PROMOAATIONTTAONSULONSULT

OMEC

TSVIDER FOR MO

ELIGIBLE FOR USE WITH FLEXIBLE

FULL OR

TED WITHIN 45 DARTSMUS

TIONSUMMER PROMO$500 OFF*

CES” or THODONTIC “BRAFULL ORTMENTALIGN TREAALIGN TREATMENTINVIS

TMENT OR TREAOR TREATMENT ALID F*OFFER V*OFFER VALID FATONSULS OF CYAAYTED WITHIN 45 D

O INITIAL VISITT BRING CARD TMUS

TION

CES” or

TION. A.O INITIAL VISIT

2013 Norwood TONY Award Recipient: Amanda Kelly

Patient Appreciation Patient Appreciation Ice Cream SocialIce Cream Social

Where: Bubbling Brook Restaurant(2 Miles East From Us in Westwood)

When: Tuesday, August 6th • 5 pm - 8 pm

Families Welcome!Redeem for Ice Cream!

See You There!

Nancy Folan, Norwood BankVice President, presented a $4,000donation on behalf of the Nor-wood Bank Charitable Foundationto Lisa Drummey, Program Direc-tor of Norwood Meals on Wheels,Inc. A volunteer appreciationluncheon was held at the EllisNursing and Rehabilitation Center

for the program’s volunteers inrecognition of their time and serv-ice.

“We are so grateful to NorwoodBank for their generous donationand for their employee volunteerprogram.” said Lisa Drummey."The donation will help our pro-

gram stay solvent and the bankvolunteer program, coordinated byNancy Folan, allows employees tovolunteer during their workday toprepare and distribute meals to ourrecipients. We can always count onNorwood Bank. Thank you somuch.”

Many volunteer packers anddrivers help to keep the program

running. For additional informa-tion on volunteer opportunities,

please contact the Norwood Mealson Wheels at 781-769-9061.

Donates $4,000 to Norwood Meals on Wheels


Norwood Bank Charitable Foundation

Pat Gover, bank volunteer, Karen Bonollo, bank volunteer, Lisa Drummey,Program Director, Maureen Cavanaugh, bank volunteer, Kathleen Fitzger-ald President Meals on Wheels, and Nancy Folan, VP/bank volunteer.

Proudly servicing Norwood, Canton and surrounding communities for over 15 years

Construction and Property Maintenance

781-828-6126www.absolutelandscaping.net

Free Estimate, Fully Insured and Licensed

GRILL ISLAND SPECIAL

$250 OFFANY GRILL ISLAND

FREE FERTILIZER(Spring, Summer & Fall Application)

$200 valueWHEN YOU SIGN UP FOR YEAR LAWN CARE PROGRAM

(Excludes herbicide & insecticide, new customers only)#N5113 #N5113

BAMSI is hiring Nurses, Nurse Managers Direct Care Staff and Management

Please apply online at www.bamsi.orgFor assistance, call

508-580-8700

Norwood Street List Books

Now AvailableThe annual 2013 Street List Book is now available in theTown Clerk's office. The cost is $5 for Norwood residents,$10 for out-of-town residents and businesses. The TownClerk's office is open Monday through Friday, 8 a.m.-4 p.m.


135 Ellis AvenueNorwood, MA 02062781-762-6880 www.TheEllis.com

100% Deficiency Free given by the MA DPH

Celebrating 40 Years in the CommunityFamily Owned Does Make A Difference

Congratulations 2013

The center is now family-owned and op-erated. In addition to this facility, the fam-ily also owns and operates the GroveManor Estates in Braintree as well as theMeadow Green Rehabilitation and Nurs-ing Center in Waltham. Each facility iswell-renowned and in 2013, the Norwoodcenter received a 100 percent deficiency-free rating from the Massachusetts De-partment of Public Health.

Like the other facilities, the 191 bed cen-ter in Norwood has been thriving sinceopening its doors and has expanded overthe years from three units to five. Thepresent units are Applewood, Birchwood,Cherrywood, Driftwood, and Elmwood.

Upon opening, the facility offered onlylong-term care, whereas now there is amixture of patients who are long-term andshort-term.

“We treat people with a range of diag-noses,” Federico said. “Some patientscome after being discharged from thehospital for continued rehabilitation be-fore going home, and others choose tostay.”

The Elmwood unit exclusively housesshort-term patients. But Federico saysthere are short-term patients in the otherunits as well, with the exception of theBirchwood unit, which is solely for pa-tients with dementia.

According to Federico, each unit has arecreational program tailored to the res-idents. Activities offered at the facilityrange from dining outings, bingo and“Choomba”, which Federoci describedas Zumba for those who are in wheel-chairs but enjoy getting exercise.

“There is also a chapel on-site whereMass is held for all denominations of re-ligion,” Federico said.

Federico also noted that the facility’sresidents have been enjoying a majorrenovation to the building’s interior, in-cluding the lobby area, Internet café anddining room.

“It’s not complete yet, but it will be byour anniversary party in September,”Federico said.

Federico says the event will give resi-dents the opportunity to celebrate withtheir families, and that the invitation alsoextends to any vendors and individualswho have been connected to the facilityover the years.

After all, Federico states, it is a senseof unity that has continued to help thecenter along for the past four decades.

“We are in a very residential area andnestled in a small community,” Federicosaid. “It is very important to us to involveour neighbors in what we do.”

ELLIScontinued from page 1

CONTRIBUTED BY PHILIP SWAN,NORWOOD FINANCIAL SERVICES ATNORWOOD BANK

How much annual income willyou need in retirement? If youaren't able to answer this ques-tion, you're not ready to make adecision about retiring. And, if it'sbeen more than a year sinceyou've thought about it, it's timeto revisit your calculations. Yourwhole retirement income planstarts with your target annual in-come, and there are a significantnumber of factors to consider;start out with a poor estimate ofyour needs, and your plan is off-track before you've even begun.

General guidelinesIt's common to discuss desiredannual retirement income as apercentage of your current in-come. Depending on who you'retalking to, that percentage couldbe anywhere from 60% to 90%,or even more, of your current in-come. The appeal of this ap-proach lies in its simplicity, andthe fact that there's a fairly com-mon-sense analysis underlying it:Your current income sustainsyour present lifestyle, so taking

that income and reducing it by aspecific percentage to reflect thefact that there will be certain ex-penses you'll no longer be liablefor (e.g., payroll taxes) will, the-oretically, allow you to sustainyour current lifestyle.

The problem with this approachis that it doesn't account for yourspecific situation. If you intend totravel extensively in retirement,for example, you might easilyneed 100% (or more) of your cur-rent income to get by. It's fine touse a percentage of your currentincome as a benchmark, but it'sworth going through all of yourcurrent expenses in detail, and re-ally thinking about how those ex-penses will change over time asyou transition into retirement.

Factors to considerIt all starts with your plans forretirement--the lifestyle that youenvision. Do you expect to travelextensively? Take up or redis-cover a hobby? Do you plan totake classes? Whatever your plan,try to assign a corresponding dol-lar cost. Other specific consider-ations include:

• Housing costs--If your mort-gage isn't already paid off, willit be paid soon? Do you planto relocate to a less (or more)expensive area? Downsize?

•Work-related expenses--You're likely to eliminatesome costs associated withyour current job (for example,commuting, clothing, drycleaning, retirement savingscontributions), in addition topayroll taxes.

•Health care--Health-carecosts can have a significantimpact on your retirement fi-nances (this can be particularlytrue in the early years if youretire before you're eligible forMedicare).

•Long-term care costs--Thepotential costs involved in anextended nursing home staycan be catastrophic.

•Entertainment--It's not un-common to see an increase ingeneral entertainment ex-penses like dining out.

•Children/parents--Are you re-sponsible financially for fam-ily members? Could thatchange in future years?

•Gifting--Do you plan onmaking gifts to family mem-bers or a favorite charity? Doyou want to ensure that fundsare left to your heirs at yourdeath?

Accounting for inflationInflation is the risk that the pur-chasing power of a dollar will de-cline over time, due to the risingcost of goods and services. If in-flation runs at its historical longterm average of about 3%, agiven sum of money will lose halfits purchasing power in 23 years.

Assuming a consistent annualinflation rate of 3%, and exclud-ing taxes and investment returnsin general, if $50,000 satisfiesyour retirement income needs inthe first year of retirement, you'llneed $51,500 of income the nextyear to meet the same incomeneeds. In 10 years, you'll needabout $67,196. In other words,all other things being equal, in-flation means that you'll needmore income each year just tokeep pace.

How much will you need toequal $50,000 in today's dollars

given 3% inflation?

Seeking the advice of a quali-fied financial professional whencontemplating retirement is al-ways a good place to start and theearlier the better !

This column is made availableby Philip Swan, Vice PresidentNorwood Financial Services atNorwood Bank; Investment Ex-ecutive Infinex Financial Group-11 Central St. Norwood, MA781-440-4234 [email protected] Prepared by Forefield

Investment and insurance prod-ucts and services are offeredthrough INFINEX INVEST-MENTS, INC. MemberFINRA/SIPC. Norwood Finan-cial Services is a trade name ofthe bank. Infinex and the bank arenot affiliated. Products and serv-ices made available through In-finex are not insured by the FDICor any other agency of the UnitedStates and are not deposits or ob-ligations of nor guaranteed or in-sured by any bank or bankaffiliate. These products are sub-ject to investment risk, includingthe possible loss of value.


THE LOCK CLINIC433 Walpole St., Norwood

781-769-6641Your Security Solution Center

www.LockClinic.com

REMOTE STARTERS - GPS - AUDIO FLIP DOWNS

Remote Starters....... Starting at $200Alarms....... Starting at $149

Alarm/Remote Starters....... Starting at $299Keyless Entry....... Starting at $109

Keep cool with a

remote starterfrom

THE LOCK CLINIC!

• Commercial• Automotive• Residential

• Auto Transponder Keys• Disney Keys - Happy Keys• Medeco High Security• Schlage Primus Keyway• Utility Keys

Gift Certificates

Gift Certificates

How Much Annual Retirement Income Will You Need?

New England

Ballistic ServicesInc.

Instant cash paid for your valuable firearms.Call today for a confidential consultation

508-381-0230 • www.neballistic.com

Our main goal has and will always be to provide the

highest quality veterinary care,boarding, & grooming services

for your pets. 20 Earls Way, Franklin MA 02038

508-528-1135

Run Your Inserts & FlyersWith Us!

Call(508) 468-6916

The Thrift Shop, located at1091 Washington Street, Nor-wood, will continue its summerschedule through August. Thestore will be closed Thursday af-ternoons. The retail hours, oper-ated by the Women’s CommunityCommittee (WCC), a non-profit,all volunteer, organization, are:Wednesdays, 6-8 p.m., Thursdays

9:30 a.m.-12:30 p.m., and Satur-days, 9:30 a.m.-12:30 p.m. Dona-tions of clean, saleable clothingand small household goods areaccepted during retail hours andalso on Mondays and Wednes-

days, 9:30-11 a.m. The statedgoal of the WCC is to extend ahelping hand. All proceeds fromthe Thrift Shop are used to sup-port local charities and civicgroups.


Repointing and rebuilding• Chimney• Stonewall• Walkways• Sump Pump Installation• Steps• Brick• Patios

Luis Arango 857 753 6732

FREE ESTIMATES LOW PRICE

Cash and Checks Onlywww.VintageThymes.com - Like us on Facebook

ONE DAY ONLY CLEARANCE SALE!!

August 9

“Back In Thyme” MarketSeptember 13, 14, 15

Next Market Dates

Open the 2nd Weekend of each monthFriday and Saturday 9-6, Sunday 12-5

Vintage and Antique One-of-a-Kind FindsMonthly Market

Vintage Thymes

61 ENDICOTT ST. BLDG. 24 NORWOOD, MALOOK FOR OUR REDDOORS

Visit State Parks for Free

Now in its third year, Norwood invites its residents to exploreover 449,000 acres of land throughout the state. You can re-serve a park pass up to one week in advance and take advan-tage of this great opportunity to explore any of the parks underthe Massachusetts Department of Conservation and Recre-ation. A $5 deposit will be refunded when the pass is returnedby 8:30 a.m. the following day. For a listing of participatingparks, visit www.mass.gov/dcr/northeast.htm.

Norwood Thrift Shop's SummerHours


Birthday Parties Available For All Ages!

All New: Yoga and Fitness Classes

Sports fun for kids ages 3 to 6!At Mini Athletes we get the little ones off the sofaand onto the playing field as children learn to play adifferent sport each week.

Fall Sessions begin in September

$25.00 off for new customers (good through September 9th)

(See Website for details)

Remember last summer, whenyour modest little vegetablepatch produced enough squashand tomatoes to feed the entireneighborhood – and then some?

Or last week, when the super-market had a buy-one-get-one-free special on strawberries orsalad greens – but you knewyour family could never finishoff that much food before itspoiled?

The Norwood Food Pantry hasa solution for both these dilem-mas. Bring some of that deli-cious fresh produce in anySaturday morning, and share itwith your neighbors in need!

“We love to be able to distrib-ute fresh fruit and vegetables tothe families who come to us,”says Ruth Taeger, the pantry’sExecutive Director. “It’s sotasty...and so good for you. Par-ents, especially, are always ex-

cited to have something like anorange or a small bunch ofgrapes to give their kids. It’s areal treat – and one they mightnot otherwise be able to afford,because they’re struggling to getby on such limited budgets.”

Volunteer Millie Farrell, whohas been in charge of the pro-duce table for the past threeyears, echoes these sentiments.“People are incredibly grateful,”she says. “They just can’t be-lieve we have fresh fruit andvegetables for them. And ourdonors are so generous,” shecontinues. “One regular comesin almost every week with wa-termelons or bananas or someother wonderful thing he’s justpicked up that morning on hisway to the pantry. And it’s alltop quality – because he says hewon’t buy anything to give toothers that he wouldn’t put onhis own table.”

Friends of the pantry withbackyard gardens often arrivewith bags of mouth-wateringfresh tomatoes or multiple headsof cabbage or bunches of lettuce.And one donor occasionallyshows up with two or threepineapples or an armful of veg-etables she’s gotten free with thegold coins they hand out at oneof the local grocery chains.

“Whatever we have usuallygoes out within minutes after itcomes in,” Taeger elaborates.“And that’s a good thing, be-cause we have only one distribu-tion day a week and limitedrefrigerator space for perish-ables.”

Thanks to its dedicated team ofvolunteer drivers, the pantry isable to pick up free producefrom the Greater Boston FoodBank once a month. This timeof year, the haul usually includesitems like onions, carrots, andpotatoes, which are easy to store.Later, in the summer and earlyfall, there might be apples,squash, or melons for a changeof pace.

What’s more, many vendors atthe Norwood Farmers Market –including Silverbrook Farm,Langwater Farm, Ward’s BerryFarm, Hearth Artisan Bread, andthe Foxborough Cheese Com-pany – coordinate to make gen-erous weekly donations of localproduce and other fresh foodduring the summer.

The Endean Community Gar-den of Norwood is also support-ing the food pantry byencouraging its gardeners to do-nate produce that will not beneeded at home. “We’ve got avery diverse group that growsjust about everything from beansand corn to eggplant and zuc-chini,” says Susan Clare, whoserves as director of both thegarden and Together Yes. “Andthey’re exceptionally commu-nity-spirited, so I’m confidentthey’ll be enthusiastic aboutsharing the fruits of their laborsto help their hungry neighbors.”

If you’d like to share some ofyour own harvest – or use someof those money-saving buy-one-get-one-free supermarket deals

to do a good deed – all you needdo is drop your contribution offat the Norwood Food Pantry, lo-cated at the rear of Grace Epis-copal Church, 150 ChapelStreet. The pantry is open fordonations Saturday morningsfrom 7:30 a.m. to 11:00 a.m.But to make sure fresh producecan be distributed before clos-ing, the earlier you can come,the better! The pantry also asksthat you not put any perishablefood in the donation bins in thelibrary and local supermarkets,as there is a danger that it mightspoil before it can be collected.

“Sitting down to a meal that in-cludes fresh fruit and vegetablesis one of the great pleasures of aNew England summer,” Taegerconcludes. And all of us at thefood pantry want to thank all ofyou who make it possible for ourclients. Whether you grow yourdonation from seed or buy it atthe grocery store, you’re makinga huge difference in the lives ofhundreds of Norwood families –and one that is deeply and sin-cerely appreciated.”

Norwood Food PantryTakes a Fresh Approach to Summer!


HOURSMON - WED: 9am-6pm • THURS: 9am-7pm

FRI & SAT: 9am-5pm • SUN: 12pm-5pm

Sign Up for Our Newsletter or Follow Us

PoirierSales @PoirierSales

Poiriersales.com

AND MANY MORE!

15% OFFPARTS

Limit one per customer.Cannot be combined

with other offers. In store purchases only.

Coupon must be presented at purchase.

10% OFF SERVICE CALL

Limit one per customer.Cannot be combined

with other offers. In store purchases only.

Coupon must be presented at purchase.

The Whole Store is ON SALE

Select Floor Models Up To 30% OffWhile Supplies Last

All Major Brands On SaleAugust 10th & 11th10:00 AM to 6:00 PM

We will be firing up the BBQ! So stop by for some great deals and good food.

1015 Washington St., Norwood • 781-769-2446

Come Visit Us Tax Free Weekend August 10th & 11th

800-633-PIPEwww.rodenhiser.com

*Not valid on trip or diagnostic fees. This offer expires August 31, 2013. Offer code OT-A-50 N

$50 OFFYour next plumbing or heating repair*

PLUMBING & HEATING

Clip and save this coupon

Visit our website formore coupons and

special offers on heatingsystem installations.

Although there is still at least amonth of summer left, fall plansand schedules have alreadybegun. The beautiful NorwoodTheatre has already launched aninitial schedule for its secondyear since its massive restorationand the lineup looks fabulous!

As of press time, the electrify-ing Ultrasonic Rock Orchestrawill launch the 2013 season witha thrilling performance of classic

rock from renowned artists, suchas The Beatles, The Who, DavidBowie, Led Zeppelin and Queen.A Celine Dion tribute featuringGina Dimia will follow up laterin the month and The Corvetteswill sing the great music of the1950's Doo Wop era on Septem-ber 28.

The month of October servesup an eclectic blend of showsbeginning with Dancing with the

AABA Stars benefit and laterwith comedian Don Gavin, TheBroadway Boys, The GerwickPuppeteers in "Inside theHaunted House," singer/song-writer and soul legend GraysonHugh with Polly Messer and aVincent Price Film Festival thatleads into November.

The British Invasion Tribute,Sister Robert Anne's CabaretClass, Draw the Line Aerosmith

tribute band, family music fromDebbie and Friends and Orna-ment, an 11-piece rock orchestrawill take the stage in November.

December acts listed are acomedy night with Paul D'An-gelo and a Holiday Variety Showwith ventriloquist Brian Tiernanand The North Shore AcappellaGroup.

This list is just a glimpse of the

various artists that will be per-forming at Norwood's belovedtheatre. Acts will continue to beadded so visit their website reg-ularly for up-to-date informationand schedule. Tickets for theabove performances are cur-rently on sale. The NorwoodTheatre is located at 109 CentralSt. Their website address is:www.norwoodstage.org.

The Shows Will Go On!

We publish the 1st of every month.

Advertisement and editorial deadline is the

15th of each [email protected]

The Norwood Scholarship Foun-dation (NSF) recently announcedthe scholarship recipients for the2013-2014 academic year. TheNSF awarded 72 scholarships to-taling $45,250, to 41 Norwood res-idents following a rigorousapplication and selection process.

Since 1985, the NSF hasawarded more than $1.3 million infinancial aid to more than 1,100Norwood students to pursue post-secondary cultural, vocational andprofessional education.

The Norwood Scholarship Foun-dation provides scholarships fromdonations of families in memory ofloved ones and from communitybusinesses and individuals whorecognize the value of helping thestudents of Norwood achieve theireducational goals.

The Norwood Scholarship Foun-dation is a volunteer non-profit or-ganization.

The 2013 Norwood ScholarshipFoundation recipients are as fol-lows:

Ibraam Agaby (Ken Nolet Me-morial Scholarship),

Brendan Alteri (Domenic J. FruciMemorial Scholarship and RogerH. Woodworth Memorial Scholar-ship),

• Ryan Begley ( Norwood Fire-fighter’s Scholarship),

• Gerard Bernazzani (Frank andElizabeth Simoni FoundationScholarship),

• Kathryn Bernazzani (NorwoodFirefighter's Scholarship),

• Samrana Bertrand (Roger H.Woodworth, and C. MertonPlimpton Memorial Scholar-ships),

•Alexandra Carey (Pride in Nor-wood Schools Scolarship),

•Joshua Cooper (Peter Catanese,and Anne Sansone MemorialScholarships, and DavidSpiegel Family Scholarship),

•Aidan Cullinane (MichelleKennedy Memorial Scholar-ship),

•Joshua Dyson (Paul J. and Anna

E. Despinosa Memorial Schol-arship),

•Thomas Eckardt (Daniel J.Sugrue, and George Stas-tavickas Memorial Scholar-ships),

• George Elias (Richard andDiane Carlson, and Kenneth J.DeCosta Memorial Scholar-ships),

• Courtney Fernandes ( Daniel P.McKenna Memorial Scholar-ship),

• William Gearty (Ronald W. Ne-nart Memorial Scholarship, andthe Women's Community Com-mittee Scholarship),

• Michael Goodwin (Ken NoletMemorial Scholarship),

• Hayley Gundlach (Francis X.Sheehan, Kimbery Kinter, andDan Norwood MemorialScholarships),

• Ngoc Trinh Huynh (OrientLodge Scholarship, and RobertE. Hemman Memorial Scholar-ship),

• Ashely Jean (Norwood Coop-

erative Bank Scholarship),

• Christopher Kelleher (NewelW. and Clara B. Tibbetts, Mar-garet Lazzara Cookman, andAnn Morse Sabatino MemorialScholarships),

• Ty-Lucas Kelley (William J.Chandler, Ruth A. Cutler, andSylvia Mackie MemorialScholarships),

• Amanda Kelly (Norwood Co-operative Bank Scholarship),

• Harriet Kiwanuka (Eileen P.Lydon Memorial Scholarship),

• Jana Madanick-Weiss (Frankand Elizabeth Simoni Founda-tion Scholarship),

• Kaitlin McCarthy (George H.Lambert, Daniel P. McKenna,and Louis P. Balboni MemorialScholarships),

• Bradford McIssac (James andJosephine Murray, and JamesBriody Memorial Scholar-ships),

• Colleen Morris (John J. and Ce-celia M. Murphy, and Joseph T.Falcone Memorial Scholar-ships),

• Eric Muller (Anthony SansoneMemorial Scholarship, NorthWalpole Fish and Game, andHenry O. Peabody SchoolScholarships),

• Rachel Obeid (Ethyl KondyMendeloff, and Joshua Rich-wine Memorial Scholarships),

• Caroline O’Day (Ken NoletMemorial Scholarship),

• Kathleen O’Day (Daniel P.McKenna Memorial Scholar-ship),

• Nichole Prescott (GwenndolynAnn Brennick, and MaryDrummey Memorial Scholar-ships),

• Shannon Peterson (RunenbergLodge Scholarship, AllisonWhite Memorial Scholarship,and Joseph A. Brancato Memo-rial Scholarship),

• Gregory Petrucci (Bruce Nel-son Memorial Scholarship),

• Jennifer Rossman (Women'sCommunity Committee Schol-arship),

• Courtney Schick ( DebonnairesScholarship, Alice CarboneMemorial Scholarship, andMay Nelson Memorial Schol-arship),

• Daniel Tatar (Carla’s Restau-rant Scholarship),

• Matthew Thibeau (Ken NoletteMemorial Scholarship),

• Heather Tyler (GwenndolynAnn Brennick Memorial Schol-arship, and National Associa-tion of Mail CarriersScholarship),

• Rachel Wood (MarilynSaltzberg Memorial Scholar-ship),

• Rebecca Wood (Carol HanfMemorial Scholarship),

• Robert Wood (Daniel J. ReenMemorial Scholarship, andRose A. Jordano MemorialScholarship).

For information about scholar-ship opportunities for the 2014-2015 academic year, contact TheNorwood Scholarship Foundationat P.O. Box 112, Norwood MA02062.

Pictured left to right: Norm Hanf,Ashley Hanf, Rebecca Wood, andAlyson Hanf awarding the CarolHanf Memorial Scholarship toNorwood resident Rebecca Woodwho will be studying early child-hood education at UMass Boston.


Personalized Service for You and Your VehicleMERCEDES - BENZ • BMW • MINI

445 Walpole Street, Norwood, MA 02062 • 781-762-0013

We specialize in Mercedes-Benz, BMW and other European models

www.revolutionautomotiveservices.com • [email protected] Dealership Alternative - Special: 10% off your 1st Service

Norwood Scholarship Foundation Announces Scholarship Recipients for 2013-2014 Academic Year


Visit Our Factory & Factory OutletS o l i d C h e r r y F u r n i t u r e

131 Morse Street | Foxboro | 508-543-9417Hours: Monday - Thursday: 7a.m. - 4p.m., Friday: 7a.m. - 3p.m., Saturday & Sunday: CLOSED

$50 offany purchasefrom $500 to $999

Woodforms131 Morse Street • Foxboro • 508-543-9417

With this coupon. Not valid with other offers or prior purchases. Offer expires 8/31/13.

$200 offany purchaseover $2000Woodforms

131 Morse Street • Foxboro • 508-543-9417With this coupon. Not valid with other offers or

prior purchases. Offer expires 8/31/13.

$100 offany purchasefrom $1000 to $1999

Woodforms131 Morse Street • Foxboro • 508-543-9417

With this coupon. Not valid with other offers or prior purchases. Offer expires 8/31/13.

Don’t Forget TAX FREEWeekend in August!

August 10th - 11th Open • Sat. 10-4, Sun. 11-3

SOKOS PIZZACalzones - Pizzas - Subs - Spaghetti - Syrians - Salads

781-769-3738

514 Washington Street, Norwood, MA 02062(781) 769-3738 or (781) 769-3739

Monday - Thursday 11am-10pm • Friday & Saturday 11am-11pm • Sunday 11am-9pm

Free Delive

ry

Minimum Order: Norwood - $10.00 Westwood - $14.00We accept Major Credit Cards

$1.00 OFFSmall Pizza

$2.00 OFFLarge Pizza

Pick up only with coupon. Pick up only with coupon.

Senior Care of Norwood

Laurie Blake from Home Instead Senior Care of Norwood offers an icecream social to the seniors from the Walpole Senior Center on duringJuly's grueling summer heat wave. Walpole seniors were invited to theBoyden Elementary School while renovations are performed at the Wal-pole Senior Center. Volunteers from the Walpole Park and Recreation andJackie Blake, a student from the King Philip High School, in Wrenthamjumped in to help serve.

Sixteen year-old Norwood res-ident Steve Marmanidis took firstplace in his division (16-18 yearolds. weight class 77kg), at theBaystate Games, that were heldon July 7, at UMass Boston. Hestarted training for Olympicweightlifting merely a year agoat his uncle's gym and was toldhis flexibility and age made hima natural for the sport. In only hissecond official meet, the youngathlete took the Gold, snatching143 and 198 pounds for the 'cleanand jerk.' Marmanidis trains twoto three times per week learningRussian techniques with his per-sonal trainer, Nikita Durnev, atthe Norwood OlympicWeightlifting Training Center,1080 Pleasant St., Norwood.Marmanidis is a junior at BlueHills Technical School, in Can-ton and is studying Engineering.

Norwood Resident Takes First atBaystate Games

Please Visit Our Websitewww.localtownpages.com

BY KRISTENALBERINO

August 7 is National LighthouseDay. The day honors and com-memorates lighthouses, which forcenturies have served as beaconsof light to guide ships safelythrough dark and uncertain waters.

August 21 is National Senior Cit-izen Day, which recognizes thecontributions senior citizens makein communities across the nation.

Social Security offers a brightbeacon of light for seniors andyounger captains who navigate thewaters of retirement planning. Infact, we have a few lighthousesthat can illuminate the way to ahappy retirement.

lighthouse one: The Retire-ment Estimator is an easy way toget an instant, personalized esti-mate of your future Social Securitybenefits. Just enter some basic in-formation and the Estimator willuse information on your Social Se-curity record, along with what youinput, to give you a benefit esti-

mate on the spot. You also can ex-periment with different scenarios,such as changing your future earn-ings and retirement date. Check itout in English at www.socialsecu-rity.gov/estimator or in Spanish atwww.segurosocial.gov/calculador.

lighthouse two: my SocialSecurity is an online account thatallows you quick access to yourpersonal Social Security infor-mation. During your workingyears, once you create your on-line account, you can use my So-cial Security to view your SocialSecurity Statement to check yourearnings record and see esti-mates of the future retirement,disability, and survivor benefitsyou and your family may re-ceive. If you already receive So-cial Security benefits, you cansign into your account to view,save, and print your benefit veri-fication letter, check your benefitpayment information, and whennecessary, change your addressand phone number in our

records. Youalso can start

or change your direct deposit in-formation. Check it out atwww.socialsecurity.gov/myac-count.

lighthouse three: The onlineBenefit Application is the mostconvenient way to apply for SocialSecurity retirement and spouse’sbenefits. You can apply from thecomfort of your home — it’s fast,easy, and secure. It’s so easy, infact, it can take you as little as 15minutes to apply online. In mostcases, once your application issubmitted electronically, you’redone. There are no forms to signand usually no documentation isrequired. Social Security willprocess your application and con-tact you if any further informationis needed. Join the millions thathave already applied online. Try itout when you’re ready to retire orjust want to learn more at www.so-cialsecurity.gov/pgm/retirement.htm.

You’ll find a host of other light-houses at www.socialsecurity.govto ensure your retirement plansdon’t go off course. For example,we offer an online library of topi-cal publications you can read orlisten to, and hundreds of fre-quently asked questions.

Whether you’re a new captainlearning how to navigate the wa-ters of financial planning, or a saltyseadog ready for retirement, Social

Security’s online lighthouses arehere to make sure you don’t crashon the jagged sea rocks of procras-tination or shallow straights ofpoor planning. The beacon is guid-ing you to www.socialsecurity.gov.

Spouses Have a SignificantBenefit Social Security can be an impor-tant financial asset for marriedcouples when the time comes toapply for retirement benefits. Inmany cases, one spouse may haveearned significantly more than theother, or have worked for a longerspan of years. Or it could be thatone spouse stayed home to do thework of raising the children or car-ing for elderly family memberswhile the other focused on a ca-reer.

Regardless of your situation, So-cial Security will look at all possi-bilities to make sure both spousesreceive the maximum benefit pos-sible.

Even if you have not paid SocialSecurity taxes, it’s likely you’ll beeligible to receive benefits on yourspouse’s record. If you did workand pay into Social Security, wewill check eligibility based on yourwork record and your spouse’s tosee which amount is higher.

You can apply for spouses bene-fits the same way that you applyfor benefits on your own record.You can apply for reduced benefitsas early as age 62, or for 100 per-cent of your full retirement bene-fits at your “full retirement age. ”You can find your full retirementage, based on your birth year, at

www.socialsecurity.gov/pubs/ageincrease.htm.

The benefit amount you can re-ceive as a spouse, if you havereached your full retirement age,can be as much as one half of yourspouse’s full benefit. If you opt forearly retirement, your benefit maybe as little as a third of yourspouse’s full benefit amount.

If your spouse has alreadyreached full retirement age butcontinues to work, your spousecan apply for retirement benefitsand request to have the paymentssuspended until as late as age 70.This would allow the worker toearn delayed retirement credits thatwill mean higher payments later,but would allow you to receiveyour spouse’s benefit.

You can also apply for spousebenefits based on the earningsrecord of an ex-spouse or deceasedspouse if you were married for atleast 10 years. Spouses can con-sider a number of options and vari-ables. We make it easier tonavigate them. A good place tostart is by visiting our benefitsplanner atwww.socialsecurity.gov/planners.Take note of the “Benefits As ASpouse” section.

If you are ready to apply for ben-efits, the fastest, easiest, and mostconvenient way is to apply online!You can do so at www.socialsecu-rity.gov/applyonline.

Whether you receive benefits ona spouse’s record or your own, restassured we will make sure you getthe highest benefit we can pay you.Learn more at www.socialsecu-rity.gov.

Allow Social Security’s Lighthouse toGuide You into a Smooth RetirementSocial Security Public Affairs Specialist in Quincy, MA


617-365-5081www.emptygrilltank.com

Covering 30 Local Towns!

305 PROVIDENCE HWY, RTE. 1NORWOOD, MA 02062

• Propane tank delivery and exchange service• On site mobile BBQ grill repairs• Patio Heater Sales & Service• Exact Fit Replacement BBQ grill parts

Order online or call to scheduleyour delivery or repair

Tel: (781) 762-4440 • Dine In/Take Out550 Boston-Providence Hwy, Norwood, MA

WWW.ACAPULCOS.NETSun-Thu 11am-10pm • Fri-Sat 11am-11pm

Buy any lunch or dinner entree at regular price and receive second entree of equal or lesser value with a 50% discount.

Not to be combined with any other offer or coupon

50% off Lunch or Dinner

Expires: 8/31/13

Gift Certificates Available 32 Central Street, Holliston, MA 01746Hours: Tues - Sat 10am - 5:30pm • Sun 11am - 4pm

Now Accepting New Consignments

Owner, Andrea Sorrelle

N

Quality Women’s & Juniors ClothingHandbags • Jewelry • Accessories

High End Brands....High End Designers

JUST IN! New Styles of High End and Fashion Jewelry including Tiffany, David Yurman and More!

Last Month for 10% off any handbagExpires 8/31/13.

BY JUDY BASS

It’s no surprise that Melisa Var-itimos of Norwood has decidedon a career in the culinary world.The former host of “Oven Luv’nwith Chef Melisa,” which airedon Norwood Public Access TVfor several years (as well as onfive other local towns’ cable ac-cess TV stations), followed herpassion as a culinary arts studentat Blue Hills Regional TechnicalSchool in Canton, graduating in2012.

Today, she is eagerly learningthe fundamentals of her profes-sion at the Culinary Institute ofAmerica in Hyde Park, NY, oneof the most prestigious and se-lective schools of its kind in thenation.

As part of her intensive train-ing, Varitimos, a rising sopho-more, is working at theheadquarters of Internet searchengine Google in MountainView, CA, in an 18-week extern-ship assisting in the catering de-partment which will end Sept. 1.

It’s a great experience andchallenge for Varitimos, 18, whohas certainly proven in the pastthat she can confidently masterdemanding situations.

Her TV show was definitelyone of those. Truly an entertain-ing and informative family af-fair, “Oven Luv’n” (its motto,coined by Varitimos, was“Cooking like a pro doesn’tmean you have to be a pro”) fea-tured Varitimos doing the cook-ing, helped by her youngerbrother, Antonio, with their fa-ther, Peter, and mother, Laurie,

filming their lighthearted ex-ploits in their home’s kitchen.There was also a colorful web-site dedicated to the now-con-cluded show that quotesVaritimos prophetically sayingof her hoped-for destiny, “Any-thing is possible.”

What was especially notableabout Varitimos, however, evenat that young age, was her abilityto perform on camera with acool demeanor that belied heryears as she and Antonio pre-pared such delicacies asspaghetti with peanut currysauce, easy spinach feta treats,and Chinese stir-fry withdumplings.

In fact, the hoopla surrounding“Oven Luv’n” led to a laudatoryfeature about Varitimos and herfamily in the Boston Globe onMarch 12, 2009, which in turnled to an appearance for her onthe nationally-syndicated“Rachael Ray Show,” which isfilmed in New York.

Now, Varitimos’ life revolvesaround living in a dorm with aroommate and heading to workfor a rigorous 7 am to 4 pm dailyshift at the so-called Googleplex,home to some 8,000 to 10,000employees.

Along with approximately 20to 25 other workers in the bak-ery, Varitimos helps prepare andset out the lunch display in thebusy cafeteria. “There’s a lot todo,” she said. “I’m learning alot, like keeping quality and con-sistency while doing high-vol-ume production.”

Looking back to her Blue Hills

days, Varitimos said that her ed-ucation there was integral to thesuccess she is enjoying today,particularly the co-op job shehad at Dessert Works in West-wood, where she was taskedwith decorating and finishingpastries. That practical, hands-on experience was hugely valu-able, Varitimos said, because itgave her a preview of how hav-ing a career in the industrywould actually be.

Being at the Culinary Instituteof America is another major stepin the progression of her train-ing. With class from 1:30 to8:30 pm, (the lengthy schoolyear there lasts for 11 months)

it’s a long day of studying.

Varitimos’ next foray out of theclassroom is slated to happen inher senior year, when she’ll havean opportunity to take a three-week food, wine, and agriculturetrip.

During her leisure time, Variti-mos said she prefers hanging outwith her friends playing card orboard games or just drivingaround. It’s a necessary respitefrom the hectic schedule shekeeps which she admits is de-manding for the mind and body.

Still, nothing hinders this un-flappable dynamo, who said thatshe “can’t imagine doing any-

thing else in the world” otherthan cooking.

“You really have to love whatyou do to be able to do the job,”according to Varitimos, who alsocites respect for the food you’reworking with, dedication, pas-sion, and trusting your ability tomake the food the best you can,as critical aspects of attaininggreatness in her field.

Varitimos’ “grand goal” is tosomeday open her own bakery, asweet dream that, judging fromwhat she has accomplished al-ready and what she has on tapfor the future, will surely cometrue.


Norwood Resident Melisa Varitimos Finds the SweetTaste of Success Baking at Google

163 Main Street, Suite 1, Medway • www.localtownpages.com

Your Local Newspaper

ASHLAND • FRANKLIN • HOLLISTON • NORFOLK/WRENTHAM NORWOOD • MEDWAYMILLIS

• Local Monthly News Direct Mailed & Online• Local Coupons Online • Grocery Coupons Online

• Full Service Printing • Graphic Design

508-533-NEWS (6397)

Introducing the

First Issue

August 2013

Ashland

localtownpages

BY: COACH CHRIS MCHUGH, FITNESS COACH AND MANAGER:GET IN SHAPE FOR WOMEN, WESTWOOD

be Prepared: Making itthrough a cookout without thatbloated, almost sick feeling iseasy when you have preparedprior to arriving. A great habit toget into prior to at any party is todrink a protein shake (1 scoop ofwhey protein powder added to8oz. of water and blended). Theprotein shake will help fill youup, which will discourageovereating.

Stay Hydrated: Drinkingwater will keep you hydrated,feeling less hungry, and mostimportantly cut down on theamount of beer, wine, or spiritsthat you consume. Water is anessential component to encour-age weight loss and weightmaintenance. Make sure that youbring along a water bottle andkeep it with you at all times.Here’s a tip: add some fresh mint

leaves (3-4) or a couple of slicesto your water to give it a subtle,refreshing taste.

Control Indulgence: Accord-ing to a recently study publishedin the American Journal of Clin-ical Nutrition conducted by re-searchers from Harvard MedicalSchool and Boston Children'sHospital, eating high-glycemic(high sugar) foods as opposed toa diet higher protein and com-plex carbohydrates (vegetablesand fruits) "… may foster foodcravings with a special prefer-ence for high [glycemic load]carbohydrates, thereby propagat-ing cycles of overeating." Inother words, eating foods thatare high in sugar will createcravings that have a tendency toperpetuate the overeating cycle.The best thing that you can do iskeep this in mind when makingyour food and drink choices. Ex-amples of foods to avoid are:sodas, fruit juices, potato chips,white rolls, and ketchup.

Keep it Simple: I recommendloading your plate up with threethings: lean protein such aschicken breast, turkey breast, ora lean steak (approx. 4-6ounces), fresh or frozen vegeta-bles (1-1.5 cups), and fresh fruit(.75-1 cup). Keeping your mealsimple will ensure that you feelenergized, focused, and healthy.

Get Moving: Bring along abackyard game that keeps youmoving such as badminton orvolleyball. Just because it is aparty it doesn’t mean that youhave to stay seating, or worselaying down. Remember movingmeans burning calories!

B.Y.O.F.: Bring your own foodand drink. The single best way toensure that your friend or familygathering doesn’t cause you tofall into a downward spiral offood cravings and weight gain isto bring your own food, or evenbetter bring other food choicesfor everyone at the party. Coor-dinate with the host and askthem if they would mind if youbrought a fresh fruit salad or ahealthy salad to share with theguests.

Good luck, have fun, and don’tforget the sunscreen!

[email protected]


Living Healthy

JANE DICKERMAN, M.D.Board Certified

OPHTHALMOLOGIST

• Comprehensive Eye Exams for Adults and Children

• Evaluation & Treatmentof Medical & SurgicalEye Diseases

• Also offering BOTOX®

and Juvederm®

• Visit our Optical Shop

20/20 EYE CARE, PC

91B Central Street, Norwood, MA 02062781-501-5650

Visit Us At: www.janedickerman.com

Providing Quality Eye Carefor the Entire Family

Since 1987

Melvin J. Schwartz, M.D.Bhoomika Shah, M.D.Hemant Hora, M.D.Mary Dockery, N.P

We Accept Most Insurance Plans

Ample Free Parking

99 Access Road, Norwood MA (At Norwood Airport Business Center)

(781) 551-8002

PROVIDING PRIMARY CARE

Welcoming New PatientsHome and Assisted Living Visits also Available

Call Now To Get Started!

917 High Street, Westwood(behind Dunkin’ Donuts)

781-320-0066

AFTER

BEFORE

getinshapeforwomen.com

Julie MorrisWestwood Client, Age 26

Speech PathologistLost 25 lbs. and 6% Body Fat

Results start when you do!

Lose12-30 POUNDSIN 12 WEEKS OR LESS

How to Eat Healthy at a Cookout:

BY JOHNVACOVEC

President and Owner ofPhysical Therapy and SportsRehab, Inc.It's important to be physically ac-tive, and avoid injuries at the sametime. This is especially importantfor a 'weekend warrior'. If you aresedentary, it's extremely importantto plan ahead in order to avoid ex-ercise-related injuries. After all, thehuman body cannot go from 'inac-tive' mode to 'weekend warrior'mode in an instant.

Exercise intensity must be pro-gressive; otherwise the risk for in-jury increases. After all,professional athletes prepare formonths (sometimes years) to reacha certain level of physical perform-ance. Athletes prepare their bodiesfor months during the off-season,as they prepare their body for anintense season. Weekend warriorstend to bypass 'preparation' andjump right into intense activity.

Common injuries include jointinflammation, muscle tears, andligament sprains. Most injuries

can be treated with physical ther-apy after the acute symptoms havesubsided. In severe cases, surgerymight be needed.

Weekend Warriors - Do'sand Dont'sIt's important for weekend war-riors to be realistic. For starters,don't expect your body to adaptright away to intense activities. Ifyou have been inactive all weeklong, your body will not be pre-pared for physical challenges overthe weekend. Make sure you haveprotective gear, and stay hydrated.

Warm up and Cool DownA warm up is a simple, yet neg-lected way to avoid injuries. Eightto ten minutes of walking or lightjogging, combined with some lightstretching is a great way to prepareyour body for progressive exerciseintensity and minimize injuries.

When you're finished with youractivity, do not come to a suddenstop. Give your muscles a chanceto recover by reducing your inten-sity, but keep moving. For exam-ple, if you have been running, don't

come to a stop. Walk for the lastfew minutes. A cool down periodhelps restore blood circulation andreduce injuries.

Plan AheadBeing realistic and planningahead is important. For best results,get some regular exercise everyday. This allows your body toadapt and prepare for your favoriteweekend activities.

Message From Your PhysicalTherapistPhysical Therapy For All Ages

If you are a senior weekend war-rior, your body is more susceptibleto tears, sprains, strains, and otherinjuries. In fact, there are almost 80million 'baby boomers' in theUnited States alone. Physical ther-apy plays an important role in in-

jury prevention for weekend war-riors of all ages.

If you are one of the many week-end warriors this summer, here area few ways that a physical therapistcan help:

• Assessment of Your Body Me-chanics/Movements – Yourability to do simple things likemove, walk, sit and stand is im-portant to us. We use this insightto create an injury preventionprogram.

• Home Exercise Programs –Once we have reduced yourpain, inflammation and restoredyour muscle strength in theclinic, we'll design a personal-ized home exercise program foryou. This will help you main-tain your results in the comfortof your own home.

• Treatment Techniques - Physi-cal therapy techniques includeexercise, hot and cold packs, ul-trasound, manual therapy, andmuch more to deal with differ-ent types of injuries.

As your physical therapists, weare committed to helping you dothe things you enjoy over theweekend. Regardless of your ageand activity level, physical therapycan help prevent injuries and im-prove well-being. Call us today.We will help you make the mostout of your summer.

Go to our website atwww.ptandsr.com to learn more!Call our Norwood office (at 781-769-2040) or Norfolk location(at 508-384-7020) today to findout how to get healthier. CallToday and schedule an appoint-ment!

by Bella Caggiano

The Norfolk County Sheriff'sOffice and Fallon AmbulanceService offer a valuable and freeservice to local seniors. The 'AreYou OK' program is designed tofacilitate an independent lifestylewith the self assurance that help isonly a phone call away.

"Security and independence areimportant to senior citizens," Nor-folk County Sheriff Michael Bel-lotti said. "The 'Are You OK'program provides senior citizenswith an extra blanket of securityand helps them gain confidenceand continue to live in a lifestylethey are accustomed to. In short,this safety initiative can improvethe quality of life for many sen-iors."

Participants will receive a dailycomputerized call at the sametime every day between 6 a.m.and 12 noon, monitored by a pro-gram representative. When the

call comes in, the senior will heara recorded voice asking, 'Are youOK?' They simply need to answer'yes' and hang up or if somethingis wrong, answer 'no' and a repre-sentative will immediately pick upthe phone, assess the problem andtake appropriate action. If a phoneis not answered, a second call isplaced five minutes later and afamily member or police are noti-fied if the senior cannot bereached.

The 'Are You OK' program is agreat safety initiative and effectivefree resource for seniors and theirfamilies. It offers peace of mindwith a phone call a day, every day,and a level of security and confi-dence for a self-assured, inde-pendent lifestyle. For moreinformation on the 'Are You OK'program, call 866-900-RUOK(7865) or visit their website athttp://norfolksheriff.com/sheriff-bellotti-on-the-quot-are-you-ok-quot-program/.


Living Healthy

WESTWOOD ELECTROLYSISAND LASER HAIR REMOVAL

Registered ElectrologistsExperienced

Certified Laser Technicians

(781) 326-7111www.westwoodelectrolysis.com

Appointments 7 Days a Week

745 High Street Rte. 109(Across From Starbucks)

Established in 1997

FDA APPROVED LASER FREE

consultation and test patch

& $50OFF1st treatment

OR

ELECTROLYSIS SPECIALFREEconsultation

& $10OFF1st treatment

With this coupon. Cannot be combined with any other

offers. Expires 8-31-13

C

Free Wellness Checksfor Seniors

How to Avoid Weekend Warrior Injuries

Are you ready to get in shape but don’t know where to start? Are you afraid of injuring yourself after working so long to get well?

We can help!! Call 508-384-7020 NOW!Physical Therapy & Sports Rehab is offering a Pilates Plus Class developed & led by a licensed physical therapist.

With an emphasis on strengthening, the class focuses on posture & core muscle development.

Physical Therapy& Sp rts Rehab, Inc.

1500 Providence Highway #24A • Norwood, MA 02062(classes will be held at our Norwood admin space on Rt. 1-

between Monster Mini Golf and Building 19)

Starting the week of August 12th at our Norwood admin office.....Mon. nights 5:30-6:30 PM

4 visit package only $60!!(excludes $25 initial 15 minute screen for all new participants)

Call 508-384-7020 and register today!

NorfolkTel: 508-384-7020

NorwoodTel: 781-769-2040

Admin/BillingTel: 781-762-3239

www.ptandsr.com

- -

- -

- -

-

- - - - - -

- -

- -

- -

-

- - - - - -


These days, Americans are liv-ing longer, healthier and moreproductive lives. Thanks prima-rily to advances in medicine,healthcare, and overall quality oflife, average life expectancy hasrisen steadily and dramaticallyover the past 50 years. Forty per-cent of retirement-age men willlive to be at least 85, and fifty-three percent of women that agewill live to be at least 88. Over-all, the average life expectancy inthe United States is now 78.6years, up from 69.7 years in1960. Retirees and seniors livinglonger, healthier lives would ap-pear to be a good thing for every-one involved, right? Not so fast,my friends. Without planningproperly for it, living long intoyour “golden years” couldquickly go from somethingyou’ve dreamed about to a com-plete nightmare…particularly ifyour money dies before you do!

As we’ve discussed in previousarticles, planning for your fam-ily’s financial security is a multi-faceted endeavor. Frominvestments to insurance, theprobability that you (and yourspouse and children) are going tolive longer adds a few new wrin-kles to that planning process.Below are some suggestions formaximizing your financial secu-rity for a longer life expectancy.

Re-think “retirement”: It should

seem fairly obvious that thelonger you live in retirement, themore money you’ll need to…livein retirement! If you’re approach-ing traditional retirement age,you may want (or need!) to con-sider ways of forestalling livingoff of your retirement savings.For example, can you re-career orwork in a more limited capacityfor several years beyond tradi-tional retirement age to supple-ment your income? Can youadjust your investment strategy orportfolio to maximize those addi-tional years spent in the work-force? If you’re a youngerinvestor, can you adjust the scopeof your investment strategy, oryour career arc, or both, to takeinto account working longer intoyour “retirement” years?

Plan for the long, long haul:With the help of a certified finan-cial planner, map out a plan for aretirement period that lasts wellinto your 80s, and perhaps eveninto your 90s. Strive to under-stand the implications of long lifeexpectancy on the principal bal-ance of your nest egg; your goalshould be to formulate a planwhich allows you to live off a rea-sonable income stream for aslong as you can before spendingdown the principal balance ofyour investments. Remember thattime, in this instance, works justas easily against the value of yourportfolio as it does in favor. Al-

though we don’t mean it nega-tively in this sense…plan for the“worst-case scenario!”

Consider “longevity insurance”:Like a private pension - longevityinsurance is another option for re-tirees seeking to turn their sav-ings into a steady income streamthroughout retirement. Unlikeother strategies, annuities canoffer a guaranteed income streamthat will last as long as you andyour spouse live if set up prop-erly. With an immediate fixedannuity, you “buy it, set it andforget it.” As long as the insur-ance company remains solvent,annuity owners generally get acheck for the same amount everymonth – they can even set uppayments to last as long as theylive, so that the longer they live,the more valuable the annuity be-comes. They can also be set upto continue to pay to the surviv-ing spouse in the event of death.Consider diversifying your in-vestment strategy to includefixed-income annuities as part ofyour “worst-case scenario” plan-ning.

For more information about fi-nancial planning for longer lifeexpectancy, including informa-tion on how we address this issuethrough our investment method-ology, we invite you to visit ourblog www.atlanticcapitalman-agement.com.

William C. Newell, CertifiedFinancial Planner (CFP®), ispresident of Atlantic CapitalManagement, Inc. a regis-tered investment advisor lo-cated in Holliston, Mass.With Wall Street access andmain street values Atlantic

Capital Management hasbeen providing strategic fi-nancial planning and invest-ment management for over 25years. On the Web atwww.atlanticcapitalmanag-ment.com.

Financial Security for Longer Life Expectancy

Bill Newell

Norwood selectmen recently released the list for the 2013Andrew and Ernest J. Boch Memorial Fund Awards.

The annual donation was initially established in 1997 bylegendary car dealer Ernie Boch Sr. in honor of his father,Andrew Boch. After Sr.'s death in 2003, Boch Jr. assumedresponsibility for the distribution of funds and awards$30,000 in honor of his family members to the Town ofNorwood and local causes and non-profit organizations.

The following is a list of this year's fortunate participants:

Concerts on the Common $2,000.00

2 Bay State Animal Cooperative $300.00

3 NHS Girls Ice Hockey $500.00

4 Friends of Norwood Cheerleading $500.00

5 Women's Community Committee $1,000.00

6 Norwood Aquatics Club $500.00

7 Norwood Sportsmen's Association $1,500.00

8 Ecumenical Food Pantry $3,000.00

9 Meals on Wheels $500.00

10 Recreation Department - Dance $400.00

11 Norwood High School Gymnastics $500.00

12 American Legion Baseball $1,000.00

13 American Legion Junior Baseball $1,000.00

14 Am. Legion Baseball (Sponsor State Final) $2,000.00

15 Together Yes, Incorporated $400.00

16 United Church - Meals from the Heart $500.00

17 Norwood Italian Lodge #1235 $400.00

18 Neponset Valley Humane Society $400.00

19 Outreach Morrill Memorial Lib. $250.00

20 Norwood Football Parent Group $500.00

21 Norwood Mustang Hockey Club $500.00

22 Friends NHS Girls Soccer $500.00

23 The Abundant Table $500.00

24 Norwood Christian PreSchool $750.00

25 Friends Norwood Wrestling $500.00

26 Norwood Senior Babe Ruth $1,000.00

27 Morrill Memorial Lib. Indexing $500.00

28 Norwood Gridiron Club $1,000.00

29 Challenger Baseball $1,000.00

30 Norwood Art Association $500.00

31 NHS Fine Arts Winter Guard $200.00

32 Parents Music Assoc. $500.00

33 Norwood Share Our Book-Prescott Sch. $500.00

34 Morrill Memorial Library-Literary Lunch $400.00

35 Friends Norwood Girls Lacrosse $500.00

36 NHS Spike-Hers Club $500.00

37 Norwood Hoopster Boost-Hers $500.00

38 Conservation Commission $2,500.00

39 Jewish Family & Children $1,000.00

2013 Boch Memorial Fund Awards Announced

While there is still a lot of summer leftto be enjoyed, many parents are alreadystarting to prepare their fall schedules.Below is a listing of exactly when Nor-wood's school year begins.

Monday, August 26-30, 8:30a.m.-2 p.m.Kindergarten Registration

Willett

For new residents to Norwood or any-one who missed kindergarten registra-tion in February, you may register yourchild for kindergarten at the WillettEarly Childhood Center, 100 WestoverPkwy. All registration information isavailable at, www.norwoodma.gov,click on Schools, Norwood PublicSchools, Family Resources, Registra-tion/Enrollment.

Tuesday, August 27, 8:30-9:30a.m.Norwood High School Freshmen Orien-tation

Norwood High School Auditorium

Freshmen students and parents are in-vited to attend.

Monday, September 2School Closed

Tuesday, September 3Teacher Orientation

Students not in session

Wednesday, September 4Grades 1-12 Begin School

Preschool Parent Information Night

5:30-6 p.m.

Willett Cafeteria

Meet the preschool teachers and learnabout the preschool program.

Kindergarten Parents Information Night(M-Z))

6-6:30 p.m.

Willett Cafeteria

Join the principal, PTO parents, and arepresentative from food services to hearabout the kindergarten program.

Kindergarten Parents Information Night(A-L)

6:30-7 p.m.

Willett Cafeteria

Join the principal, PTO parents, and arepresentative from food services to hearabout the kindergarten program.

Friday, September 6Kindergarten & Preschool Orientation

Monday, September 9Kindergarten & Preschool Begin


The Beginning of School is Just Around the Corner!

Orange Leaf Frozen Yogurt isthe fastest-growing self-serveyogurt shop in New England,and this August it's coming toNorwood, Mass. CEO ReeseTravis bought the franchise in2010 with only 15 stores. In justover three short years, the fran-chise has grown to 285 storesopen with over 100 more in thepipeline.

Frozen Yogurt is a healthier al-ternative to ice cream at 45calories or less per ounce. Withover 70 flavors to choose from,store owners pick 16 at a time tocreate their own unique lineupbased on local customer de-mand. Included in those flavorsare no-sugar-added, gluten-freeand dairy-free alternatives tosatisfy everyone's sweet tooth.Customized with a generous se-lection of over 20 do-it-yourselftoppings, ranging from fruit andnuts to cereal and candy bars,customers are encouraged tocreate a froyo masterpiece as in-nocent or indulgent as theyplease.

Franchisees Mario and CherylCosta are residents of Norwoodwho decided franchising withOrange Leaf was somethingthey wanted to do after visitingthe store in Canton, Mass."Each time we were in there,whether it was snowing, rainingor a perfectly sunny day, the

store was busy with smilingfaces," said Costa. "We wantedto bring that bright, fun, friendlyatmosphere to Norwood be-cause it's a place for kids, adultsand families to hang out andenjoy great frozen yogurt. Wewere taught in training to followthe three C's: Cleanliness, Cus-tomer service and Community -and that's what we intend to do.We plan on doing communitygive-back days where a sportsteam, school or organizationcan come into our store on aMonday or Tuesday night andget back a percentage of salesfor there particular organiza-tion. It's a way for us to get in-volved and give back to ourcommunity. With three childrenin the Norwood school system,we look forward to helping theschools out as much as wecan."

The Norwood location is at 38Vanderbilt Avenue. If you're in-terested in participating in agive-back day, call the store781-762-8020 or email the own-ers [email protected] us out on Facebook@Orangeleafnorwood for peri-odic promotions.

At Orange Leaf, we don't justcall ourselves America's FrozenYogurt - we are America'sFrozen Yogurt.

Opening Soon: Orange Leaf Frozen Yogart

August 1campfire evening storytimes

morrill memorial library

7 p.m.Sing around the "campfire" andtell campfire tales. Don't forget towear your pajamas and bring yourteddy bears! Ages 3 -6 and theirfamilies. Snack provided.

national alliance for the men-

tally ill monthly meeting

Norwood Hospital, Cafeteria A7 p.m.The alliance is composed of fam-ilies who find mutual support andjoin together to advocate for theirloved ones. All families dealingwith mental illness are invited. Formore information, call Ray at 508-668-2941.

August 2Picnic storytime

Morrill Memorial Library11:30 a.m.Enjoy your lunch while listeningto stories, then join in for some out-door activities including the para-chute, bubbles, and more at theBond Street Tot Lot. Ages 3-6 andtheir families.

August 3american red cross blood

drive

Boch Honda, 279 Bos.-Prov.Hgwy., Rte. 18 a.m.-2 p.m.

August 4concert on the common

Norwood Town Common7-9 p.m.The Compaq Big Band will per-form. Rain or shine.

August 5carillon concert on the com-

mon

Tilton Memorial Carillon7-8 p.m.Gordon Slater, Ottawa, Canada,will perform.

August 6norwood Farmer's market

Norwood Town Common12-5:30 p.m.Enjoy a variety of delicious, freshlocal produce, fish, homemadebreads, wine, cheese and organicfoods. At 2 p.m., Music by MikeDelaney and cooking demonstrationwith Chef Angela Whiford-Down-ing of Lovin The Oven.

August 7children's arts & crafts

Morrill Memorial Library10 a.m.-12 noonDrop-in each week to create aunique craft. Ages 5 and older.

summer Film Fest

Morrill Memorial Library6:30 p.m.This week's film is Chicago(2002), starring Renee Zellweger,Catherine Zeta-Jones, RichardGere, and Queen Latifah. Sign upby calling the library (781-769-0200, x110 or 222) or stop by theReference or Information desk.Popcorn will be served courtesy ofthe Bellingham Regal Cinemas.

norwood summerfest

Town Common7-9 p.m.Blue Sky performs.




Norwood Town Common7-9 p.m.The Olde Kids on the Block willperform. Rain or shine.

August 12lucy the r.e.a.d. dog

Morrill Memorial Library11 a.m.Lucy is a trained companion dogwho loves to listen to children read.Bring your favorite book or borrowone from the library. For beginnerreaders and older. Registration re-quired.

carillon concert on the com-

mon

Tilton Memorial Carillon7-8 p.m.Philippe Beullens, Mechelen, Bel-gium, will perform.

August 13the music lady: carol Kings-

bury

Morrill Memorial Library10 a.m.Preschoolers can sing and danceat this entertaining show. Forpreschoolers and their families.Registration required

norwood Farmer's market

Norwood Town Common12-5:30 p.m.Enjoy a variety of delicious, freshlocal produce, fish, homemadebreads, wine, cheese and organicfoods. At 3 p.m., story time withKelly Unsworth from the MorrillMemorial Library and live music 3-5 p.m., by Barzin, Cummings andYoung.

Farmer's Friends

Morrill Memorial Library3 p.m.These storytimes, which will takeplace at the Farmers Market, will in-clude stories and activities withfarming themes. Ages 3 -6 and theirfamilies.



summer Film Fest

Morrill Memorial Library6:30 p.m.This week's film is Evita (1996)starring Madonna, Antonio Ban-deras, and Jonathan Price. Sign upby calling the library (781-769-0200, x110 or 222) or stop by theReference or Information desk.Popcorn will be served courtesy ofthe Bellingham Regal Cinemas.

norwood summerfest

Town Common7-9 p.m.Face Value performs.

children's bingo

Morrill Memorial Library7 p.m.Join in for some good 'ole fash-ioned fun. Prizes awarded! Grades:1 and older. Registration required.



August 19carillon concert on the com-

mon

Tilton Memorial Carillon7-8 p.m.Lee B. Leach, Norwood, will per-form.

August 20lego mania

Morrill Memorial Library11 a.m.On your mark, get set, BUILD!Construct your best Lego creationand bring it to the library for thisfriendly competition. Certificatesand prizes will be awarded. "Dig-ging" themes are encouraged. Ages5 and older. Registration required.

norwood Farmer's market

Norwood Town Common12-5:30 p.m.Enjoy a variety of delicious, freshlocal produce, fish, homemadebreads, wine, cheese and organicfoods. At 2 p.m., cooking demon-stration on healthy recipes by Nor-wood Hospital dietitian CaitlinMelia.



stitch therapy

Morrill Memorial Library6:30 p.m.Knitters, crocheters, cross stitchersand all others interested in needle-crafts will meet in the TrusteesMeeting Room from 6:30 - 8:30pm. The group will begin be offeredon fourth Wednesday of each monththrough September. the fourthWednesday in October. Bring yourprojects.

broadway musical on the big

screen

Morrill Memorial Library6:30 p.m.This week's film is Sweeney Todd:The Demon Barber of Fleet Street(2007), starring Johnny Depp, He-

lena Bonham Carter, and SachaBaron Cohen.Sign up by calling thelibrary (781-769-0200, x110 or222) or stop by the Reference or In-formation desk. Popcorn will beserved courtesy of the BellinghamRegal Cinemas.

norwood summerfest

Town Common7-9 p.m.Jumpin Juba performs.

August 23museum of science Presents:

dig into dinosaurs

Morrill Memorial Library10 a.m., 11 a.m.Finish up your summer readingprogram at this hands-on programand explore the world of dinosaursthrough fossils and your own miniexcavation site. (There will be 4shows offered in total on the sameday.) Ages 5 and older. Registrationrequired.

Picnic storytime


museum of science Presents:

dig into dinosaurs

Morrill Memorial Library1 p.m., 2 p.m.Finish up your summer readingprogram at this hands-on programand explore the world of di-nosaurs through fossils and yourown mini excavation site. (Therewill be 4 shows offered in total onthe same day.) Ages 5 and older.Registration required.


Norwood Town Common7-9 p.m.The Bridgewater AntiphonalBrass Society will perform. Rain orshine.

August 27norwood Farmer's market

Norwood Town Common12-5:30 p.m.Enjoy a variety of delicious, freshlocal produce, fish, homemadebreads, wine, cheese and organicfoods. From 3:30-5:30 p.m., hair artfor kids by Escada Hair & BeautySpa.

August 28norwood summerfest

Town Common7-9 p.m.Rick Barron & The Quavers per-form.


Calendar

�� %#*"��&)+(�&� ��! &�/0� (,#� ��#&� �� 1

�"'& �� .��

��&# $��#!#��'%'��)"#&!*'&��*

�'(-''��

�+*'��'% ��+)#& ))�#&�&�#�$�� (,#� )

R.J. SMITH INSURANCE AGENCY“Service Since 1961”

Auto - Home - BusinessFinancial Services


In a hard-fought final series, the Diamondbacks de-feated the Reds in a winner-take-all game three to winthe Bud Williams Division Town Championship. The D-Backs were managed by Dan Vitt and BillFitzgerald.The hustling Reds won game one of the series, and theD-Backs roared back to win the final two games behindthe pitching of 15-year-olds Josh Boyle, Javier Ro-driquez and John Stanley. The offense was led by TomDriscoll, Dan Curley, Janelle Kelleher and Mike Carr,

with great defense by the Waitekus Brothers; everyballplayer contributed to the championship.

The championship D-Backs team:

15-year-olds: Josh Boyle, Dan Curley, SeanDonoghue, DanMetayer, Javier Rodriguez, John Stanleyand Jack Waitekus

14-year-olds: Michael Carr, Tom Driscoll and JakeWilson

13-year-olds: Janelle Kelleher (the only girl in Nor-wood Babe Ruth), Josh Poirier, Ryan Stanley, BillyThomasello and Aaron Waitekus.

The D-Backs finished the season with a 14-3 record.The coaches promised to return to defend the trophy in2014.

DIAMONDBACKS - 2013 Babe Ruth League - TOWN CHAMPS!

Norwood Sports



ASHLAND • FRANKLIN • HOLLISTON • NORFOLK/WRENTHAM • NORWOOD • MEDWAYMILLIS



508-533-NEWS (6397)

Introducing the

First Issue

August 2013

Ashland

localtownpages

It wasn’t that she wanted to playthe sport because she liked it; infact, she really didn’t know thatmuch about it. All that matteredwas that her older sister was play-ing softball, so Norwood’s JillShepherd wanted to play softballtoo.

“I was in second grade when Istarted playing softball,” Shepherdsaid. “My older sister (Staceywho’s four years older) played itand I wanted to be just like her.”

Luckily for Norwood, as Shep-herd turned into a bona fide soft-ball pitcher who will take hertalents to the University of Massa-chusetts, Boston next fall. Aftergetting her start in town softball,Shepherd became serious aboutsoftball when she began playing in6th grade for the Mass. Drifters, anAAU team out of Bridgewater.She then moved onto the NorthernCrush, where she still plays today.

“When I was young, I played allover the place; caught, pitched,played shortstop, but when I began

striking everyone out my Dadthought I should take lessons,”Shepherd said. “Then in the sev-enth and eighth grade I had a hipand a knee injury. The PT mademy legs stronger. I began learningmore pitches and began to noticethat I was doing really well.”

Upon entering Norwood HighSchool, Shepherd played herfreshman year with the junior var-sity team, where she lost only twogames. As a sophomore she waselevated to the varsity squad whereshe saw time in the outfield. Itwasn’t until her junior year whenshe finally got her chance in thepitching circle, but once again hadto endure an injury, this time to hershoulder.

“There was no way I was makingthe varsity team with two amazingpitchers up there already,”

Shepherd said. “Then in my jun-ior year I had shoulder surgery andthe PT made my upper bodystronger to go with my legs. I fin-ished the year 8-2.”

This past season she was able toget through the entire season un-scathed and helped Norwood (14-6) advance into the Division 1South Tournament, where theyeventually fell to King Philip 3-1after blanking Brockton in the firstround. Shepherd and her Mustangteammates were looking forwardto the tournament rematch with theWarriors. Two years earlier, KPdefeated the Mustangs 4-2 for theDivision 1 South Championshipen route to their second straightstate championship.

“When I was a sophomore welost to KP in a crazy close game,”

Shepherd said. “When we foundout that we were playing KingPhilip this year, we were like, thisis our revenge. Unfortunately, welost 3-1, but we were pleased withour performance. It was anothercrazy close game.”

As a two-time Bay State Confer-ence All Star that averaged 6strikeouts a game, in her 14 winsthis year Norwood Coach CarolSavino was thrilled with the effortShepherd gave her in the circle thepast two seasons, despite her in-juries.

“I think the shoulder injury fromlast year was still bothering her alittle, but she pitched through it, es-pecially when our other pitcher

(Kate O’Donnell) went down withmono,” the Coach said. “If Jillcouldn’t have gone we would havehad to call up a freshman from theJV team. It was her drive and de-sire that got her through the sea-son. With that shoulder still hurting– she somehow found a way tohelp get us into the tournament.”

After having met the UMASSCoach when she was 14 and par-ticipating in some clinics with her,Shepherd realized there wasnowhere else that she wanted toplay softball in college. She’s hop-ing to make it as a pitcher for theBeacons, but wouldn’t mind play-ing the field if it came down to notplaying at all.


C Norwood Sports

Jill Shepherd - Norwood Softball

BY CHRISTOPHER TREMBLAY

What began as a chance to bearound his cousin and around thediamond with his baseball team,quickly turned into an everlastingpassion for America’s game. Nowover a decade later, Norwood’sAnthony Perriello has not onlycrafted his skills on the highschool level, but will get a chanceto play baseball on the collegiatelevel. The Norwood resident willtake his baseball skills to the dia-mond in Troy NY, where he willget to display his baseball skills forRensselaer Polytechnic Institute, aDivision 3 school playing in theLiberty League.

“I was around four or five whenI was the bat boy for my cousin’steam,” Perriello said. “From theget go it gave me a good taste forthe game and soon after I began to

follow it. I began with Norwood t-ball and grew from there.”

Early on, Perriello was differentfrom the other kids. He was con-tent to play the outfield with pride.The Norwood youngster was notinterested in playing one of theglamorous infield positions like somany of his peers. He just wantedto play the sport that felt so dear tohis heart.

“It was just one of those things,"Perriello said. "I started as an out-field and always liked the position.I tried playing the infield, but it justdidn’t feel comfortable there. Thebest fit for the team is the outfield,where I can cover a decent amountof ground and have good armstrength. I made the outfield myhome.”

While right field may be Per-riello’s home on the field, his high

school coach believes there ismore to him than just his game.

“He is a great right fielder with astrong arm,” Norwood CoachKevin Igoe said. “But what’s evenstronger is his leadership and hiswork ethic is unbelievable. Asgood as a hitter he is, that’s his sec-ond best trait; leadership is his topquality.”

During hisfreshman year atNorwood, Per-riello made thejunior varsitybaseball team,but before theseason was overhe found his wayto the varsitysquad. He origi-nally made hisway into thelineup as a DH,but eventuallyfound his spot inright field for theMustangs.

“In terms of hit-ting, I considermyself a powerhitter, Perriello

said. "I think that was the mainreason why I got the call up mid-way through my freshman sea-son."

As a sophomore in his first fullseason with the varsity team, theright fielder hit .341, improved to.350 his junior year and batted ablistering .507 this past season. Al-though he has launched a fewhomeruns over the fence in thepast, Perriello considers himself tobe one that drives the ball for av-erage.

“Hitting HR’s is great, butthey’re short lived,” he said. “Hit-ting for average shows you’re in itfor the team day in and day out. “

At 6’1” and 225 lbs, the Nor-wood outfielder swings the batwith authority, but there are thingsthat really bother his coach.

“You wouldn’t believe me if Itold you, you have to see it to be-lieve it – every one of his hits is arocket,” Igoe said. “Although heloves the sport and is a tremendousbaseball player, he does have hisflaws. His worse attribute is that heis a Yankees fan, and the only Yan-kee fan that I’ll consider talkingto.”

One of the things that makes Per-riello’s batting averages even moreimpressive is his ability do it witha wood bat compared to many oth-ers who are still using aluminumbats on the high school level.

Some years ago, the Bay StateConference decided to go withwood bats after a serious injury.When Perriello made it to highschool, he had to drop the alu-minum bat that he was used tousing the past eight years and pickup a wood bat.

“It was difficult at first becauseyou grow up using a metal bat andthen you get to the high school andyou have to change, but you getuse to it,” he said. “I feel using awood bat is more rewarding as youare actually earning your hits un-like with a metal bat where youjust have to stick it out and makecontact and you have a hit. Woodbats really stress the importance ofcontact.”

As he prepares to make the jumpto collegiate ball, the former Mus-tang is playing for the NorwoodLegion team before heading toNew York. Once he gets to RPI,he’ll participate in the school’s fallball and work out programs as hegears up for the spring season.

“It’ll be a whole new level thatI’ll need to once again adjust to,but I’ll get use to it,” Perriello said.“With a lot of hard work andpreparation I will get there, andcome spring I hope that I can se-cure a starting spot on the team.”

There haven’t been any chal-lenges in the past that have de-terred Perriello from getting wherehe wants to be, why should this beany different.


Norwood Sports

65 Cottage St. (East) Norwood 781-769-0606

JOIN A LEAGUE STARTING AFTER LABOR DAY

freegame

Norwood Sport CenterNorwood • 781-769-0606

Not valid on league play. One coupon per visit per person. No double

discounts. With this coupon. Not valid withother offers or prior purchases.

Offer expires 8-31-13.

freegamebuy one game,

get one game freeNorwood Sport CenterNorwood • 781-769-0606

Not valid on league play. One coupon per visit per person. No double

discounts. With this coupon. Not valid withother offers or prior purchases.

Offer expires 8-31-13.

buy one game, get one game free

Your local shop for all yourlandscaping and masonry supplies!

Mulch, Loam, Compost, Stone, Sand, Nursery Stock,Brick, Cobblestone, Grass Seed, Fertilizer, Bluestone,Granite, Fieldstone, Cements and so much more!

508-668-0401 or 508-660-1306www.southridgefarmnursery.com

SouthridgeFarm & Nursery

400 South StreetWalpole

4 County Street, RT 109Walpole

Anthony Perriello Norwood Baseball

AdvertiseWith Us!

Call (508) 468-6916

Look here, Belle has truly comeinto her own. Her original handi-capped owner reluctantly had tosurrender her when she wasevicted from her home. She soughtthe assistance from BSAC as “No-kill” option for Belle. Belle wasadopted in May. She Belle hasfound a new human companionwho gives her all the attention sheso deserves. She has started pianolessons and has big plans for herfuture! Thank you for adoptingBelle.

Bay State Animal Cooperative Kittens: This one group of rescued kittens

gives a whole new meaning to catswith character.

Sugar, Honey and Ice Tea, allblack kittens, were found hidingamongst wild vines growing on ahomeowner’s chimney. Mommacat surely knew how to protectthese little monkeys. After settlingin at their foster homes these 3 kit-ties have developed fun andunique characters. They havelearned to hang from woodenplanks and from the tops of theircages to entertain each other andtheir human caretakers. These funand charismatic kittens are only afew of the ones we have rescued

already during this kitten season.Sugar, Honey and Ice Tea areavailable to see at the NorwoodPetco Adoption center.

Millie:This is Millie a spayed, whiteand black female kitten about 3months old. Millie was found in ayard amongst other kittens. Threeadult stray cats gave birth to sev-eral of kittens all of which havebeen rescued. She’s full of vigorand ready for adoption at the Nor-wood Petco location.

Taking Bids now on this donatedNew Dog Care Package. It con-tains puppy pads, floor mat, dogbiscuits, poop bags and feedingbowl. We will be taking bids untilmidnight Saturday, August 17th.Please send your bids to us [email protected]

EMERGENT FOSTER CARENEEDED for several friendlyadult surrenders, kittens needingsocialization and strays that havecome to the attention of BSAC inabundance during these summermonths. Without foster we can notrescue many well deserving cats.Let us know if you can assist inthis much needed role.

Reach out to us at:[email protected]

BAY STATE ANIMAL COOP-ERATIVE is always seeking trans-porters to vet visits, trappers (noexperience necessary, we will

train) and event volunteers. Cur-rently seeking volunteers inter-ested in working with a team tobetter stream line adoptions of themany animals we have in our sys-tem. Please reach out to us at:[email protected]

Meet WonderShe needs our help

Have you ever had, or known acat that loves affection, and has abest friend who is a dog? At somepoint in our lives there has beenthat one special pet that hastouched us in a way that no otheranimal could have. Meet Wonder,a 12 year old feline. She has cap-tured her care takers heart and thatof her canine buddy Duncan. Herstory will touch many hearts.

5 years ago, Wonder lived her liferoaming a horse barn, and runningfrom the sight of human beings. Aman that visited the barn fre-quently spotted a black cat out ofthe corner of his eye one day. Ashe continued to go the barn hewould always see the cat boltingfrom him, but also noticed her am-putated tail, and a crooked spinefrom what appeared to be trauma.

This animal friendly guy hassince taken Wonder into his home.Shortly after Wonder began herstay in her new, safe, quiet home,her ailments became more evident

and she was unable to walk nor-mally. As Wonder’s fear of hu-mans disappeared her physicaldisabilities became more evident.She curls up beside her owner orin his lap, and at night sleeps at theend of the bed with her new foundcanine friend Duncan. Last No-vember, Wonder was diagnosedwith Cancer. Surgery was per-formed to remove the intestine.She was doing very well, cancerfree, until a recent set back. Shewas rushed to the vet in late Julyand has undergone lots of testingto determine what the cause of hersudden set back is. The accumu-lated vet bills exceed $1,000 dol-lars however, more diagnostic testsare needed.

BSAC will assist the caretakerwith these test expenses, howeverwe are seeking donations to helpdefer the medical costs for Won-der’s treatments and ongoing tests.If you could help in any way itwould be greatly appreciated.Thank you in advance for your do-nation!

Donations can be to: BSACWonder, and send to 47 WindsorRd., Norwood, MA 02062

CONTACT USBay State Animal Cooperative,Inc., 47 Windsor Rd., Norwood,Ma. (Corporate office only). Visitus at www.baystateanimals.org781-436-2722 voice mail email:[email protected]


PET CORNER

1159 Washington St., Norwood•www.thesoggiedoggie.com

FULL SERVICE DOG AND CAT GROOMING

Salon Hours: By Appointment Closed Sun & Mon

781-352-3509

DR. HEDLEY MARKSASHFIELD-CHEYNEVETERINARY SERVICE33 BROADWAY • NORWOOD

[email protected]

WWW.ASHFIELDVET.NET

CALL FOR APPOINTMENTS!

• GENERAL MEDICINE & SURGERY• ACUPUNCTURE • LASER THERAPY

• NOVEL NUTRITION• HOME CARE VISITS

Recent Adoption Success:

Belle

Millie

Ice Tea

Wonder


00off

305 Providence Highway, Norwood(Next to Boch HONDA)

781-762-2330 • 781-762-2331

NORWOOD BOTTLED GAS

NEED A PROPANEREFILL?

(with coupon)

3$a 20 lb Fill

SAVE$3.00!

NTN

Beat the HeatUp until I was nine years old, we lived on the thirdfloor of a triple decker in Jamaica Plain. Then, andnow, I knew one thing-heat really, truly rises.

If I remember correctly, we had approximately twofans. One was a window fan; where it went, we fol-lowed suit. It would start in the living room and bybedtime make its way into our bedroom. It didn’t coolanything at all, but boy did it make cool echoing noiseswhen you yelled into it.

I can’t forget the oscillating fan. It also weighed quitea bit. So much so, that unlike the box fan, it stayed inthe living room at least until October. Or whenever mymother got sick of looking at it.

The oscillating fan defeated the purpose of coolingdown. It moved, we moved. Based on its setting, it hadthe potential of an aerobic workout. I still detest thosefans.

There was no central air conditioning. If you wantedto cool off, you headed to the supermarket. You posedin the frozen food aisle pretending to buy popsicles ifan employee walked by, but in reality you just keptputting your head in the freezer until either frostbiteset in or you were thrown out of the store.

But the bottom line was, we survived the heat. In factthrived despite it.

When the hubby and I bought our first house, it hadno central air. We bought fans for every room (and notthe oscillating kind). At the time we were house poor.So many nights were spent sleeping in the finishedbasement with the fans blasting.

Eventually we bought an air conditioner for thekitchen window. Our house was so small that it cooledthe place quickly. When the kids came along we’d allcamp out in the living room enjoying the air condi-tioner-and each other’s company.

We moved to Norwood the year my eldest childstarted first grade. I decided to have a bunch of kiddiesover to play on the last day of school.

They were having a grand time playing outside in thesun, until one asked if he could come inside because“It was hot out and my house had air conditioning.”

I turned on the sprinkler, handed out popsicles, andwatched the clock slowly tick by- waiting patiently forthe playdate to end.

Many of our friends have central air- and no wedidn’t become friends with them for their air condi-

tioners (although there are perks).

Unfortunately for us, the house isn’t set up for centralair. So just like long ago, we have to wing it.

Remembering the long ago lesson that heat wickedlyrises –we have three air conditioners and three boxfans. When things are mildly hot, the kiddies use thefans in their respectable rooms. However, when it isstifling hot, they bond in two bedrooms using a roll-away bed. I don’t think they argue about this. And ifthey do, hubby and I have our own AC- so we don’thear it. And I’m okay with that.

About five years ago, we bought an enormous airconditioner for our first floor. Of course electricalrewiring needed to be done. The thing needed brack-ets, screws, and good healthy backs for installation.

This year, I am happy to say that our five year old ACis doing a great job chilling out the house.

Thank goodness too- I didn’t’ want to risk anothersummer of getting thrown out of Stop and Shop forstaying too long in the frozen food aisle.

Dawn C. Fitzgerald is a freelance writer. She’d loveto hear your comments at [email protected]

Out and About by dawn c. Fitzgerald


• Local Monthly News Direct Mailed & Online• Local Coupons Online

• Grocery Coupons Online• Full Service Printing

• Graphic Design

ASHLAND • FRANKLIN • HOLLISTON • NORFOLK/WRENTHAM • NORWOOD • MEDWAYMILLIS

Introducing the

First Issue

August 2013

Ashland

localtownpages


508-533-NEWS (6397)

Run Your Inserts &Flyers With Us!Call (508) 468-6916

hawley (leblanc), mar-

guerite "Peggy", 87, of wal-

pole, former lifelong resident ofNorwood, died Wednesday,July 17, after a long illness.Beloved wife of the late Neil G.Hawley, Jr. of Norwood, dearmother of Dr. Thomas Hawleyand Carol Boisen, Diane andRobert Pinette, Jr., Linda andSteve Davenport , all of Nor-wood, Dr. David Hawley andLeisa Weld of Victoria, BC,Canada, Carol and Scott Scrimaof Hollis, NH, June and RobertTodd Steinweg, of Arnold, MD,and Janet and AndrewMichienzi of Needham and sis-ter to Harold and MarianLeblanc of Palm Desert, CA,Paul and Martha Leblanc ofDennis Port, MA, Harvey andPat Leblanc of Norwood, MA.Peggy is also survived by 22grandchildren, three great-granddaughters and manynieces and nephews. She wasborn in St. John, NewBrunswick, Canada, into one ofthe first Acadian families to set-tle in North America. Shemoved as a young child to LongIsland, NY then settled in Nor-wood in her teens. Peggy lovedspending time with her family,visiting Cape Cod and Florida,eating seafood, spending timeby the ocean, taking cruises anddancing with Neil. She read twonewspapers daily. She servedfor many years as a LPN andlater as a volunteer at NorwoodHospital. Funeral services willbe held on Saturday, July 27, at10:00 AM from the GilloolyFuneral Home, 126 Walpole St.,(Rt. 1A) NORWOOD, followedby a Mass of Christian Burial at11:00 AM in St. Catherine ofSiena Church, Norwood. Burial

will follow at Highland Ceme-tery, Norwood. Relatives andfriends are kindly invited. Thefamily will receive visitors onFriday, July 26, from 5:00 PMto 7:00 PM at the funeral home.In lieu of flowers, please donateto the International Walden-strom's MacroglobulinemiaFoundation, www.iwmf.com, ora charity of your choice.

mcdonough, James

Joseph, Jr., "Jaja", 80, of

norwood, retired to Rockland,and formerly of West Roxbury,Thursday, July 18. Born inBoston, on May 23, 1933, hewas the son of the late James J.McDonough, Sr. and Rose(Sowienska) McDonough. Heserved in the U.S. Navy duringthe Korean Conflict and workedat New England Telephone forover 40 years prior to his retire-ment. He was the beloved hus-band of Maureen (O'Sullivan)for 57 years; the devoted fatherof James J. McDonough, III, ofWashington, Michael McDo-nough of Plainville, John Mc-Donough of Quincy; Nancy andher husband Larry Scarnici ofQuincy, and the late Kevin Mc-Donough; the cherished grand-father of Ji, Grace, Karen,Kevin, Sean, Lauren, Jenniferand Lorenzo; the dear brotherof Mary Buckley of Middlebor-ough, Richard McDonough ofWestwood, Daniel E. McDo-nough of Weymouth, and thelate Patricia Coyne. Funeralservices will be held on Tues-day, July 23, at 8:00 AM fromthe Gillooly Funeral Home, 126Walpole Street (Rte. 1A), NOR-WOOD, followed by a Mass ofChristian Burial at 9:00 AM atSt. Catherine of Siena Church,547 Washington St., Norwood.

Burial will follow in HighlandCemetery, Norwood. Relativesand friends are invited and maycall on Monday, July 22, from4:00-8:00 PM at the funeralhome. In lieu of flowers, dona-tions in his memory may bemade to The Wounded WarriorProject P.O. Box 758517,Topeka, KS, 66675 or atwww.woundedwarriorproject.org.

Pasco, demetra "Janet,"

97, of norwood,Thursday, July18. Born in Boston on April 22,1916, she was the daughter ofthe late Daniel Pasco and Nico-letta (Dressios). She was thedear sister of the late GeorgiaEdwards, the late Peter, Alexan-dra, George, Nicholas, John,and Charles Pasco, sister-law ofCatherine Pasco of West Rox-bury and Helen Pasco of PA, theloving aunt of her caretaker,Carol J. Edwards, with whomshe lived, Robert Pasco of W.Roxbury, David Pasco of Con-cord, Linda Hamilton of NY,Daniel Pasco of NY, GaryPasco of NY, Nicole Parrish ofWV, Gregory Pasco of VA,Loretta McCleary of PA, andJohn Pasco of AZ. An avid RedSox fan, Janet worked at Searsin Natick for many years andduring the war she worked atHolster-Cabot in Jamaica Plain.Janet's funeral will be held onWednesday, July 24, at 10:00AM from the the Gillooly Fu-neral Home, 126 Walpole St.,(Rt. 1A) NORWOOD , fol-lowed by a Funeral Service at11:00 AM in St. NectariosChurch, 39 Belgrade Ave.,Roslindale, MA. Interment willfollow in Highland Cemetery,Norwood. Visiting hours areTuesday, July 23 from 5:00 PMto 8:00 PM at the funeral home.

Memorial contributions may bemade in Janet's memory to theAlzheimer's Association,MA/NH Chapter, 311 ArsenalStreet, Watertown, MA 02472or at www.alzmass.org.

BOHAN, Mary Elizabeth"Libby" (Waldron), 92, ofBrockton, formerly of Nor-wood, passed away peacefully,Tuesday, July 16, surroundedby her family. Born in Bostonon August 21, 1920, she was thedaughter of the late Martin Wal-dron and Mary (Cunnane).Libby was the beloved wife ofMichael Bohan of Brockton,the loving mother of MarkBohan and his wife Kathleen ofMattapoisett, Michael Bohan,Jr. and his wife Anne of Har-vard, Deborah and her husbandStan Jencunas of N. Easton, andJudy Bohan of Hingham; thedear sister of the late MartinWaldron and Catherine Cooper;the cherished grandmother ofHeather Bohan Anagnos andJim Anagnos of Boston, Jen-nifer Bohan and Andrew Taubeof CA, Kerrie O'Donnell andStephane Voyer of Canada,Michael Bohan, III and IlariaLamberto of CA, and MatthewBohan of Canada, great grand-mother of Taylor Anagnos; andthe aunt to many nieces andnephews. Funeral services willbe held on Monday, July 22, at9:00 AM from the Gillooly Fu-neral Home, 126 Walpole Street(Rte. 1A), Norwood, followedby a Mass of Christian Burial at10:00 AM in St. Denis Church,157 Washington St., Westwood.Interment will follow the Massin Highland Cemetery, Nor-wood. Relatives and friends areinvited and may call on Sunday,July 21, from 4:00-8:00 PM at

the funeral home. In lieu offlowers, memorial contributionsmay be made in Mary's mem-ory to Newton Wellesley We-ston Committee for CommunityLiving, Inc., or, "NWW Com-mittee,", 1301 Centre Street,Newton, MA 02459.

BYRNE, Robert J., 78, ofMartha's Vineyard, and for-merly of Walpole and Cam-bridge, passed away Tuesday,July 16, surrounded by his fam-ily. Born in Boston on Decem-ber 25, 1934, he was the son ofthe late James Byrne and Mil-dred (Brennan). He graduatedfrom St. Mary High School andBoston College. An avid RedSox fan, he was a systems ana-lyst for NStar, formerly BostonEdison, for over 40 years untilhis retirement in 1995. He wasthe loving father of Donna andher husband Frank Whiteheadof Plainville, Katherine and herhusband, Anthony Cordray ofWest Tisbury, Lynda and herhusband Richard Hinkson, Jr. ofNorwood, and Mary Byrne andher husband Mark Hinderlie ofSomerville; the dear brother ofMargaret and her husbandThomas Fitzgerald of Reading,the late Elizabeth, James, Ed-ward, Thomas, and Jack Byrne;the cherished grandfather ofAlex, Emily, Max, Victoria,Anna and Elizabeth; the formerhusband of Frances (Ge-ogheghan) Byrne of Boston,and the uncle to many niecesand nephews. Funeral serviceswill be held on Saturday, July20, at 8:30 AM from theGillooly Funeral Home, 126Walpole Street (Rte. 1A), Nor-wood, followed by a Mass ofChristian Burial at 10:00 AM inSt. Theresa of Avila Parish, 10St. Theresa Ave., West Roxbury.Burial will be private. Relativesand friends are invited and maycall on Friday, July 19, from4:00-8:00 PM at the funeralhome. Memorial contributionsmay be made in Robert's mem-ory to the Alzheimer's Associa-tion, Massachusetts/NewHampshire, 480 Pleasant Street,Watertown, MA 02472 or atwww.alz.org.

STRESSENGER, ShirleyAnn (Cudmore) of Norwood,formerly of Sharon, passedaway on Sunday, July 14, 2013.


Obituaries

Specializing in fine monuments and mausoleums

629 South St. Wrentham • 508-384-5826 • TributeInStone.com

Mazzola’s

Norwood MonumentalWorks Inc.

943 Washington Street • Norwood • MA 02062 • www.norwoodmonumental.comEmail: [email protected]

Beloved wife of the late JohnB. Stressenger, Jr.; lovingmother of Michael Stressengerof Fitchburg, Joan Stressengerof Aurora, CO, and LeslieStressenger of Quincy; devotedsister of Iona MacDonald ofAvon, Kathryn DeMoss ofWestport, Ruth Cudmore of N.Attleboro, and the late JamesCudmore; dear aunt of PatriciaLewis of N. Dartmouth.

Shirley's funeral will be heldon Thursday, July 18th at11:00am in the Gillooly Fu-neral Home, 126 Walpole Street(Rte. 1A), Norwood. Intermentwill follow in Rock RidgeCemetery, Sharon. There willbe no public calling hours.

Memorial contributions maybe made to the American Can-cer Society, 30 Speen Street,Framingham, MA 01701.

SPRAGUE, Leonard M., Jr.Following years of treatmentfor diabetes Len succumbed tothe ravages of the disease onSaturday July 13, 2013.

Len was the husband of thelate Marion (Flaherty). He issurvived by two daughters,Susan M. of New York City,and Mary Jane Bradley and herhusband John of Ashburnham,MA; two grand-daughters,Megan Bradley-Liles and herhusband Joshua, and MaeveBradley; a great grand-daugh-ter, Marion Lucille Liles, andan extended family of belovednieces and nephews. He wasalso the brother of the lateEleanor Connolly and Vir-ginia McGrath.

A Marine Corps Veteran,Len survived some of themost intense battles of the pa-cific campaign. After partici-pating in the JapaneseSurrender Ceremony aboardthe U.S.S. Missouri and thevictory parade in New YorkCity, he was honorably dis-charged in November 1945.

Len returned to employmentat the then New England Tele-phone Company in December1945. After many years offrustrating efforts, he led asuccessful campaign to affili-ate his fellow employees withthe I.B.E.W. in 1970.

He is a charter member ofthe I.B.E.W. Local 2222 and

served as their first businessmanager. Len retired fromAT&T in 1988 after 45 years ofservice.

Following a Mass of Resur-rection at Saint TimothyChurch on Nichols Street inNorwood on Wednesday morn-ing, July 17, at 10 o'clock; Lenwill be laid to rest beside hisbeloved Marion in HighlandCemetery.

LUNDIN, John "Jack" P.,71, of Norwood, suddenly, July10, at his home in Norwood.Born in Worcester on March17, 1942, the son of the lateViola (Miller) Lundin, he grad-uated from Auburn HighSchool with the class of 1960.He served in the U.S. MarineCorps and was a member of theTeamsters Union for manyyears. Jack was the belovedhusband of the late Julia(Finnegan), the loving father ofChristopher Lundin of Foxboro,Michael Lundin and his wifeLaney, and Chloe Lundin, all ofNorwood, the dear brother ofRobert Boudreau of Shrews-bury, the cherished grandfatherof Sadie and Genevieve Lundin,and the uncle of several niecesand nephews. Funeral serviceswill be held on Tuesday, July16, at 9:00 AM from theGillooly Funeral Home, 126Walpole Street (Rte. 1A), Nor-wood, followed by a Mass ofChristian Burial to be cele-brated on at 10:00 AM at St.Timothy Church, 650 NicholsSt., Norwood. Burial will fol-

low in Highland Cemetery,Norwood. Relatives and friendsmay call on Monday, July 15,from 4:00 to 8:00 PM at the fu-neral home. Memorial contribu-tions may be made in Jack'smemory to the Jimmy Fund,Dana-Farber Cancer Institute,P.O. Box 849168, Boston, MA02284-9168 or at www.jimmy-fund.org.

O'NEILL, Mary E. (Curry),92, passed away peacefully,Tuesday, July 9, at the SunriseAssisted Living of Norwoodsurrounded by her family. Bornin Wellesley on July 12, 1920,she was the daughter of the lateThomas E. Curry and Rose E.(McMahan) and the belovedwife of the late Charles E.O'Neill. Mary worked as an ad-ministrative assistant in thePhysics Department of Welles-ley College during WWII,where some of the physicistsworked on the Manhattan Proj-ect. Primarily a homemaker,she also volunteered as Secre-tary for the Northeast Region ofthe National Association of Re-tired Federal Employees, work-ing with her husband, who wasan officer. Mary was the lovingmother of William O'Neill andhis wife, Margaret, of Merri-mack, NH, Joseph O'Neill andhis wife, Faye, of Amherst, NH,Richard O'Neill and his wife,Betsy, of Jaffrey, NH, Mary andher late husband, Walter Can-tarow, of Norwood, and PaulO'Neill and his wife, Christine,of Bridgewater; the dear sister

of Phil Curry of Marbleheadand the late Thomas "Bud"Curry; the cherished grand-mother of Rebecca Burstein,Bridget O'Neill and her hus-band, Clif Morlan, Kelly,Katherine, and KimberlyO'Neill, Joshua Cucinotta andhis wife, Trisha, Jeremy Can-tarow and his wife Melissa,Madelyn Cantarow, EdwinPerry and his wife, Kristen,Daniel Perry , Joshua Perry andhis wife Adriana, Michael Dun-ham and his wife, Rachel, andthe late Frankie Dunham, and17 great-grandchildren; and theaunt to several nieces andnephews. Funeral services willbe held on Monday, July 15, at9:00 AM from the Gillooly Fu-neral Home, 126 Walpole Street(Rte. 1A), Norwood, followedby a Mass of Christian Burial at10:00 AM in St. Denis Church,157 Washington St., Westwood.Interment will follow the Massin Mt. Calvary, Cemetery,Roslindale. Relatives andfriends are invited and may callon Sunday, July 14, from 2:00-6:00 PM at the funeral home. Inlieu of flowers, memorial con-tributions may be made inMary's memory to Compas-sionate Care Hospice, 800 W.Cummings Park, Ste 3400,Woburn, MA 01801 or to theAmerican Heart Association,P.O. Box 417005, Boston, MA.02241-7005 or atwww.heart.org. or to Sunrise ofNorwood Activities Dept., 86Saunders Road, Norwood, MA02062.

ZAJAC, Frederick A., age82, of Franklin, former long-time resident of Norwood,passed away peacefully athome, surrounded by his fam-ily, on July 1, 2013.

Mr. Zajac was a veteran of theKorean War, serving in the U.S.Navy.

Beloved husband of Mona(Crowley) Zajac; loving fatherof Cathleen Pellegrine and herhusband William of Norwood,Frederick A. Zajac, Jr. and hiswife Barbara of Medfield, Jan-ice Ciannavei and her husbandPeter of Wrentham, andMichelle Breen and her hus-band Lawrence of Franklin;cherished grandfather ofMichael, David, Monica, Julie,Marissa, Matthew, Abigail,Meghan, and Patrick; proudgreat-grandfather of Isabellaand Anthony. He is also sur-vived by many loving niecesand nephews.

Funeral services will be heldon Saturday, July 6th at 9:00amfrom the Gillooly FuneralHome, 126 Walpole Street (Rte.1A), Norwood, followed by aMass of Christian Burial at10:00am in St. Timothy's

Church, 650 Nichols Street,Norwood. Interment will followthe Mass in Highland Ceme-tery, Norwood. Relatives andfriends are invited and may callon Friday, July 5th from 4:00-8:00pm at the funeral home.


Kraw - KornackFuneral Home1248 Washington StreetNorwood, MA 02062

www.kraw-kornackfuneralhome.com781-762-0482

Serving the families of Nowood and the surrounding communities with thoughtful care for over 60 years.

Complete Funeral and Cremation Services.Pre-Need Funerals and Funeral Trusts Arranged.

Call anytime for an appointment.Wheelchair Ramp and Handicap accessible.

All Veteran Services available.

FAMILY OWNED AND OPERATED.JOHN P. KORNACK ------ DIRECTORS ------ GEORGE KORNACK

Obituaries


Norwood Single Family Homes Currently on the Real Estate MarketStatus Address Town Description DOM List PriceACT 308 Lenox st U:308 Norwood, MA 4 room, 2 bed, 2f 0h bath Cottage x4 79 $165,000ACT Truman Realty (617) 924-6000 List Agent: Michael Truman ACT 365 Nahatan St Norwood, MA 10 room, 4 bed, 1f 0h bath Colonial 1582 $249,900 ACT Keller Williams Realty Boston South West (781) 251-2101 List Agent: Joseph DelaneyACT 123 Neponset St Norwood, MA 7 room, 3 bed, 1f 1h bath Cape x13 91 $299,900ACT Coldwell Banker Residential Brokerage - Dedham (781) 326-2300 List Agent: Anne Fahy ACT 67 Tremont Street Norwood, MA 6 room, 3 bed, 2f 0h bath Colonial x11 25 $299,900ACT Century 21 American Properties (508) 668-8800 Ext. 43 List Agent: Janet Robinson ACT 65 Hillshire Ln Norwood, MA 5 room, 3 bed, 1f 0h bath Ranch x16 55 $305,000ACT Prudential Page Realty (508) 359-2331 List Agent: Henry F. McNealy ACT 115 GARFIELD AVENUE Norwood, MA 5 room, 3 bed, 1f 0h bath Cape x15 61 $309,000ACT Camber Real Estate, Inc. (781) 828-2398 List Agent: Evan Gavrilles ACT 17 Sunset Ave Norwood, MA 6 room, 3 bed, 2f 0h bath Cape x12 5 $309,000 ACT Partners Realty Advisors, Inc (508) 653-2400 List Agent: Varghese Francis ACT 15 Pellana Rd Norwood, MA 6 room, 3 bed, 1f 0h bath Ranch x20 9 $315,000ACT Success! Real Estate (781) 848-9064 List Agent: Kathleen Sullivan ACT 87 Cameron Rd Norwood, MA 6 room, 3 bed, 1f 0h bath Ranch x10 124 $315,000ACT Stonehurst Real Estate Group (781) 549-7511 List Agent: Silvia Sandoval ACT 26 Andrews Street Norwood, MA 6 room, 3 bed, 1f 0h bath Cape x5 13 $329,000ACT Hammond Residential R. E. (617) 731-4644 List Agent: Bridget Walsh Graham ACT 55 Brookfield Rd Norwood, MA 6 room, 3 bed, 1f 1h bath Colonial x18 12 $329,900ACT Coldwell Banker Residential Brokerage - Dedham (781) 326-2300 List Agent: Anne Fahy ACT 144 Arnold Road Norwood, MA 7 room, 4 bed, 1f 0h bath Cape x16 98 $329,900ACT Christopher P. Olson (774) 215-1000 List Agent: Christopher Olson ACT 67 ADAMS STREET Norwood, MA 6 room, 3 bed, 1f 0h bath Colonial x16 26 $339,000ACT Camber Real Estate, Inc. (781) 828-2398 List Agent: Anthony Camarra ACT 11 McKinley Norwood, MA 8 room, 3 bed, 1f 1h bath Cape x23 66 $349,900ACT Prudential Prime Properties (508) 747-1047 List Agent: Charles McIsaac ACT 69 HICKORY Road Norwood, MA 8 room, 3 bed, 2f 0h bath Ranch x30 94 $369,900ACT Conway - West Roxbury (617) 469-9200 List Agent: Richard Carlo ACT 29 3rd Norwood, MA 8 room, 5 bed, 2f 0h bath Bungalow x23 86 $369,900ACT Keller Williams Realty Boston South West (781) 251-2101 List Agent: Jane Cowperthwaite ACT 48 Hampden Dr Norwood, MA 8 room, 4 bed, 2f 0h bath Raised Ranch x10 90 $379,900ACT RE/MAX Executive Realty (508) 359-1100 Ext. 5012 List Agent: The Results Team ACT 49 Winfield St Norwood, MA 6 room, 3 bed, 2f 0h bath Colonial x15 16 $379,900ACT LeRoux Realty Group (508) 847-2321 List Agent: Dennis Leroux ACT 190 Vernon Street Norwood, MA 6 room, 3 bed, 2f 0h bath Colonial x13 53 $389,900ACT Norfolk Realty (781) 975-0717 List Agent: Arthur Stratford ACT 90 Bond Street Norwood, MA 6 room, 3 bed, 1f 0h bath Ranch x13 7 $397,500ACT RE/MAX Real Estate Center (781) 762-1945 List Agent: Carolyn Griffin ACT 133 Devon Rd Norwood, MA 9 room, 4 bed, 2f 0h bath Split Entry x12 177 $419,000ACT Keller Williams Realty Boston South West (781) 251-2101 List Agent: Ann Wood ACT 21 Eisenhower Rd Norwood, MA 7 room, 5 bed, 1f 2h bath Colonial x18 269 $419,000ACT William Raveis Delta REALTORS ® (508) 359-7351 List Agent: Kimberly Brady ACT 55 Countryside Ln Norwood, MA 8 room, 3 bed, 1f 1h bath Raised Ranch x30 90 $419,900ACT RE/MAX Real Estate Center (781) 762-1945 List Agent: Julie Gross ACT 55 Lane Dr Norwood, MA 8 room, 3 bed, 2f 0h bath Ranch x21 23 $424,500ACT ERA Key Realty Services-Bay State Group (508) 376-8200 List Agent: Eugene Capozzoli ACT 24 Cleveland Norwood, MA 7 room, 3 bed, 2f 0h bath Colonial x21 72 $429,900ACT RE/MAX Real Estate Center (508) 668-4634 List Agent: Robert Hardiman ACT 28 Hemlock Street Norwood, MA 8 room, 4 bed, 1f 1h bath Split Entry x12 50 $439,000ACT Coldwell Banker Residential Brokerage - Westwood (781) 320-0550 List Agent: Valerie Smith ACT 68 Garfield Ave Norwood, MA 7 room, 4 bed, 2f 0h bath Cape x14 48 $449,900ACT Property Navigator (508) 851-0605 List Agent: Maurice Fraone ACT 9 Chatham Rd Norwood, MA 9 room, 5 bed, 3f 0h bath Raised Ranch x22 15 $449,900ACT William Raveis R. E. & Home Services (617) 731-7737 List Agent: Andrew Lau ACT 66 FISHER STREET Norwood, MA 9 room, 3 bed, 2f 1h bath Ranch x19 35 $449,900ACT RE/MAX Real Estate Center (508) 668-4634 List Agent: Fran Mcdavitt ACT 62 Walpole St Norwood, MA 18 room, 4 bed, 1f 2h bath Other (See Remarks) x20 6 $449,900ACT RE/MAX Real Estate Center (781) 762-1945 List Agent: Julie Gross ACT 3 Chatham Rd Norwood, MA 8 room, 4 bed, 1f 1h bath Colonial x24 41 $484,500ACT Coldwell Banker Residential Brokerage - Westwood (781) 320-0550 List Agent: Charlene Lyons ACT 16 Ash Rd Norwood, MA 8 room, 4 bed, 2f 0h bath Cape x17 9 $519,000ACT F.A. Realty Associates (617) 391-7437 List Agent: Lewis Fojtik ACT 48 Pine St Norwood, MA 10 room, 4 bed, 3f 0h bath Raised Ranch x21 43 $524,900ACT McNulty REALTORS� (781) 769-0961 List Agent: Thomas Scott ACT 417 Washington Street Norwood, MA 13 room, 6 bed, 3f 0h bath Antique x12 34 $529,900ACT ERA Key Realty Services-Bay State Group (508) 376-8200 List Agent: Lisa DeMaio ACT 55 Anne Rd. Norwood, MA 8 room, 4 bed, 2f 1h bath Garrison x20 62 $534,900ACT RE/MAX Real Estate Center (781) 762-1945 List Agent: Paul Keady ACT 83 Saunders Rd Norwood, MA 8 room, 4 bed, 1f 2h bath Colonial x19 35 $539,000ACT McNulty REALTORS� (781) 769-0961 Ext. 119 List Agent: William Plasko ACT 36 Berwick Street Norwood, MA 8 room, 4 bed, 2f 0h bath Colonial x28 6 $549,900ACT Coldwell Banker Residential Brokerage - Dedham (781) 326-2300 List Agent: Mary Henderson ACT 325 Union St Norwood, MA 12 room, 4 bed, 4f 0h bath Contemporary x23 360 $550,000ACT RE/MAX Landmark, REALTORS� (781) 320-0020 List Agent: Jim Kazakoff ACT 12 Independence Way Norwood, MA 7 room, 4 bed, 4f 0h bath Raised Ranch x21 48 $579,000ACT Keller Williams Realty - Foxboro/North Attleboro (508) 695-4545 List Agent: Mark Maher ACT Lot 1, Ellis Avenue Norwood, MA 8 room, 4 bed, 2f 1h bath Colonial x5 44 $589,900ACT Keller Williams Realty (781) 828-4900 Ext. 236 List Agent: The Harris Team ACT Lot 2, Maxwell Avenue Norwood, MA 8 room, 4 bed, 2f 1h bath Colonial x16 37 $600,000ACT Keller Williams Realty (781) 828-4900 Ext. 236 List Agent: The Harris Team ACT 90 Wilson Street Norwood, MA 10 room, 4 bed, 2f 1h bath Colonial x24 145 $639,900ACT RE/MAX Real Estate Center (781) 762-1945 List Agent: Julie Gross ACT 25 Albemarle Rd Norwood, MA 8 room, 3 bed, 2f 1h bath Colonial x28 35 $650,000ACT Boston Connect Real Estate (781) 826-7300 List Agent: Martin Barrett ACT 733 Neponset Street Norwood, MA 13 room, 4 bed, 3f 1h bath Colonial x30 55 $750,000ACT RE/MAX Real Estate Center (781) 762-1945 List Agent: Julie Gross

Single Family Listings: 44 Avg. Liv.Area SqFt: 1,882.05 Avg. List$: $430,095 Avg. List$/SqFt: $244 Avg. DOM: 98.43 Information gathered from Multiple Listing Service


home M A R K E T P L A C E

Call Christina Robertson

508-468-6916

To Advertise Your Listings!

M McNulty Realtors

Best of Norwood 2009, 2010, 2011, 2012 & 2013by: US Commerce Association

Steve CallahanMcNulty Realtors781-704-5356eMail: [email protected]

McNulty Realtors168 Nahatan Street • Norwood, MA 02062

781-769-0961 ext. 103

Working to make your dreams a reality.

Are You Looking to Buy or Sell??Call Julie DiSangro Gross at RE/MAX Real Estate Center 781-769-0400.

Julie is Norwood's number 1 sales agent this year and these are only some of the properties that makes her top!

47 E. Vernon Street$250,000

62 Walpole Street$449,900

55 Countryside Lane$419,900

90 Wilson Street$639,900

733 Neponset Street$750,000

32 Jacobsen Drive$316,000

SOLD

125 Devon Road$385,000

SOLD

17 Birch Road$365,500

SOLD

82 Arnold Road$440,000

SOLD

46 Mill Pond Lane$580,000

SOLD

19 Langdon Road$900,000

460 Pleasant Street$327,000

SOLD

16 Saunders Road$350,000

SALE PENDING

59 Countryside Lane$420,000

SOLD

SALE PENDING

SALE PENDING


No curveballs, trick pitches, or

slow stuff.

A U T O | H O M E | B U S I N E S S

Prou

dly p

artn

erin

g with

MAP

FRE |

Com

mer

ce In

sura

nce

1500 P R O V I D E N C E H I G H W A Y N O R W O O D M A 02062 | 781.762.2300 | ambrosegrant .com

Ambrose GrantI N S U R A N C E A G E N C Y , L L C

JUST HONEST, DEPENDABLE, PROMPT SERVICE. For 40 years, we’ve been offering our

customers straight talk and full circle protection with our lineup of home, auto,

and business insurance. As a preferred provider of MAPFRE|Commerce Insurance,

the largest private passenger automobile insurer in Massachusetts, our customers

benefi t from great discounts on auto insurance plus the highest rated

claims service in Massachusetts. In addition, MAPFRE|Commerce gives us the

resources, technology and fi nancial strength to serve you better. Talk to us at

Ambrose & Grant. Where taking care of people and saving them money is the

name of the game.

JUST HONEST, DEPENDABLE, PROMPT SERVICE. For 40 years, we’ve been offering our

customers straight talk and full circle protection with our lineup of home, auto,

and business insurance. As a preferred provider of MAPFRE|Commerce Insurance,

the largest private passenger automobile insurer in Massachusetts, our customers

benefi t from great discounts on auto insurance plus the highest rated

claims service in Massachusetts. In addition, MAPFRE|Commerce gives us the

resources, technology and fi nancial strength to serve you better. Talk to us at

Ambrose & Grant. Where taking care of people and saving them money is the

name of the game.



ASHLAND • FRANKLIN • HOLLISTON • NORFOLK/WRENTHAM NORWOOD • MEDWAYMILLIS



508-533-NEWS (6397)

Introducing the

First Issue

August 2013

Ashland

localtownpages

Run Your Inserts & Flyers

With Us!Call

(508) 468-6916

We publish the 1st of every month. Advertisement and

editorial

deadline is the 15th of

each [email protected]

Documents

Norwood August 2013