Upload
mirtomi
View
244
Download
0
Embed Size (px)
Citation preview
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 1/148
istique
M
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 2/148
Q Rich vibrant colorQ Durable prints without glassQ
Waterproof Q 4 different finishes availableQ Rounded cornersQ Sizes from 5x7 to 20x30Q Various wall
hanging andeasel-back optionsavailable
Inks are infused directly into speciallycoated aluminum sheets, using hightemperature and pressure. Yourimages take on a bright, vibrant,luminescent quality when printed onmetal through this process.
Meridian’s Metal Prints have to beseen to be appreciated, examplesshown in a magazine ad or on thewebsite just can’t do them justice.
P h
o t o
b y
R e x
K e s
l e r
P h o t o b y W aw r o P h o t o g r a p h y
P h
o t o
b y
R e x
K e s
l e r
Lab corrected photographic prints onKodak ® Endura Premier® professionalpaper. Kodak Premier Metallic paperalso available.
MeridianPro keeps adding coolnew specialty products, perfect fosenior packages or sport and evepromotions.
LAB CORRECTED
8X10 ONLY
$1.49
What do you call a professional lab that offers photographerslab corrected color at the same price as uncorrected, on over eighty
print sizes as well hundreds of other photo products?
“My new lab.”
This is only a small sample, Meridianoffers over 80 print sizes, withpanoramic sizes up to 120 inches.That’s correct, true photographicprints, lab corrected, as large asten (10) feet long.
Your choice of “Lab Corrected” or“No Correction” at the same price.
8 wallets 1.754 x 6 .295 x 7 .99
8 x 10 1.4910 x 10 2.49
11 x 14 3.9916 x 20 13.5020 x 24 19.9920 x 30 24.9930 x 40 49.99
Great Prints. Great Prices. Easy Ordering. It’s that Simple.
No application process to wait for. Go to our website, sign-up,download our free ordering software and begin ordering today.
www.meridianpro.com | 800-544-1370
METAL PRINTS SPECIALTY PRODUCTS
PHOTOFLIP FLOPS
DOUBLESIDED
WALLETS
iPHONECASES
KEYCHAINSDOG TAGS
TICKETSDRINKWARE
MEMORYMATES
TRADERSBUTTONS
BRACELETS
LAB CORRECTED
11X14ONLY
$3.99
PROFESSIONAL PRINTS
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 3/148
P h o t o ©
2 0 1 3 H e r n a n R o d r i g u e z
The Photo Bundle gives you all of our photogr
software at less than half price. Our tools
help your photography look natural, not digita
VisitAlienSkin.com
to see beautiful exampand try the Photo Bundle for yourself.
“A client like Evander Holyfield inspires me to
pull out all the creative stops. The tools from
Alien Skin help me quickly explore ideas that
would be tedious or impossible otherwise.”
— HERNAN RODRIGUEZ
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 4/1484 • www.ppmag.com
PROFESSIONAL
senior editor
JOAN SHERWOOD
features editor
LESLIE HUNT
editor-at-large
JEFF KENT
art director/production ma
DEBBIE TODD
creative services manag
publications & SSACHERYL PEARSON
creative services coordin
VALENCIA JACKSON
eastern region ad manager
TARA TRUITT
404-522-8600, X230, [email protected]
central region ad manag
MARINA ANDERSON
937-902-8217, manderson@p
western region ad managerAMY WALLS
404-522-8600, X279, [email protected]
publications sales staff
director of sales & strategic alliances
WAYNE JONES
404-522-8600, x248, [email protected]
EDITORIAL
director of publications
JANE GABOURY
Experience countsMAKING EVERY CLIENT A VIP
Reality TV, before-and-after glamour transformations of the gal
next door, the worldwide platform afforded by the World Wide
Web—these and other cultural phenomena are leading many an
American to crave a sliver of limelight as never before. While most
people don’t expect to be celebrities, more of us desire the feeling
that, at least momentarily, it is all about us. We want to be the
center of attention and adoration, if only briefly.
A stroll through any shopping mall illustrates how this craving is
being cultivated and leveraged at every juncture. Tween-age girls
years away from earning their first minimum-wage paycheck are
routinely treated to high-end pampering at the nail salon and made
to feel like princesses. The teddy bear store roils with exuberant young
birthday party guests building plush toys in their own likeness. It’s
not just the end result that counts, it’s the experience of feeling like
the star of your own show that brings ultimate satisfaction.
Increasingly, I’m hearing from photographers who are delighting
their clients—and consequently finding greater business opportunities—
by delivering value beyond fantastic images. They’re giving clients
the experience of a lifetime. OK, maybe not a lifetime, but definitely
a shimmering highlight in a workaday year. And an experience
those clients will no doubt want to have again.
This month’s cover photographers, Michelle and Justin Stevens,
foster both drama and glamour in their wedding coverage
(“Glamour: Always in Fashion,” page 84). Is that not a delicious
experience for a bride? To be expertly lit and deftly posed and
lovingly doted over is flattering and exciting. It’s an experience she’ll
remember fondly whenever she views her wedding images through
the years. Great imagery is great. Great imagery that calls to mind
your ephemeral stardom is even better.
Jane Gaboury
Director of Publications
facebook.com/ppmagazine
twitter.com/ppmagazine
pinterest.com/ppmag
theloop.ppa.com
editorial offices
Professional Photographer229 Peachtree Street NE, Suite 2200, Atlanta, GA 30303-1608 U.S
404-522-8600, fax: 404-614-6406Professional Photographer (ISSN 1528-5286) is published monthl
subscriptions
Professional PhotographerP.O. Box 3606, Northbrook, IL 60065-3606, 800-742-7468;
fax 847-291-4816; [email protected]; www.ppmag.com
member services
PPA - Professional Photographer800-786-6277, fax 404-641-6400, [email protected], www.ppa.com
Advertising materials contact: Debbie Todd at [email protected] rates/information: U.S. Print: $27, one year; $45, two yea
three years. U.S. Print and Digital Combo: $37, one year; $65, two years; $years. Canadian Print: $43, one year; $73, two years; $108, three years. C
Print and Digital Combo: $53, one year; $93, two years; $138, three yInternational: $19.95 one year digital subscription.
Back issue/Single copies: $10 U.S.; $15 Canada; $20 InternationaPPA membership includes: Domestic $17.50, Non-Domestic $42 annual sub
Subscription orders/changes: Send to Professional Photographer, Attn: CDept., P.O. Box 3606, Northbrook, IL 60065-3606; 800-742-746
FAX 847-291-4816; email: [email protected]; Web site: www.ppmagPeriodicals postage paid in Atlanta, Ga., and additional mailing offic
Postmaster: Send address changes to Professional Photographer magP.O. Box 3606, Northbrook, IL 60065-3606
Copyright 2013, PPA Publications & Events, Inc. Printed in U.S.A
Article reprints: Contact Professional Photographer reprint coordinatoWright’s Reprints; 1-877-652-5295.
Microfilm copies: University Microfilms International,300 North Zeeb Road, Ann Arbor, MI 48106
Professional Photographer (ISSN 1528-5286) is published monthly for $27 per yePublications and Events, Inc., 229 Peachtree Street, NE, Suite 2200, International Tow
GA 30303-1608. Periodicals postage paid at Atlanta, Ga., and additional mailing offic
Acceptance of advertising does not carry with it endorsement by the publisher. Opinions ex
Professional Photographeror any of its authors do not necessarily reflect positions of Profess
tographers of America, Inc. Professional Photographer, official journal of the Professional Pho
of America, Inc., is the oldest exclusively professional photographic publication in the Western H
(founded 1907 by Charles Abel, Hon.M.Photog.), incorporating Abel’s Photographic W
Louis & Canadian Photographer, The Commercial Photographer, The National Photographer, P
Photographer,and Professional Photographer Storytellers. Circulation audited
and verified by BPA Worldwide.
contributing editors
DON CHICK, ROBYN L. POLLMAN, ELLIS VENER
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 5/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 6/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 7/148
GLAMOUR: ALWAYS
IN FASHIONJustin & Michelle Stevens play up
their brides’ flair for the dramaticby Stephanie Boozer
FUN-LOVING AFFECTIONHappiness and energy are naturalmarketing tactics for Tony & Amy Hofferby Eric Minton
ONE WITH THE CROWDTravel photographer Eric Lindberg earnsaccolades by knowing how to blend in
by Erin Quinn O’Briant
WEDDINGS: FLAIR FOR THE DRAMATIC
Kevin Jairaj brings a fashion-forward flavor to wedding and portrait photography
by Will Pollock
WEDDINGS: LOVING PEOPLE
Steve Nissle learned the weddingphotography business at his father’s side
by Eric Minton
PORTRAITS: FREEDOM TO LET GO
Limiting the bookings enhancesJulie Klaasmeyer’s exclusivity by Stephanie Boozer
IMAGE BY: KEVIN JAIRAJ
112
104
120
128
84
94
Features
CONTENT
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 8/148
DepartmentsCONTACT SHEE T
30 Walking on water: Kos Evans
32 PP ’s giveaway of the month
32 PP asks: What’s the oddest thia client ever asked you to do?
34 Chasing the action: Jim Edds
36 The fearless photographer:Marc Pagani
PROFIT CENTER
39 What I think: Eric Lindberg
40 Ask the experts
42 A beacon shinesby Kalen Henderson
44 Starting at the endby Bridget Jackson
46 Differentiating your businessby Angela Pointon
48 Handing out memoriesby Jeff Kent
50 A business niche in Mauiby Tim Cotroneo
54 Whatever happened to qualityby Thomas Fallon
56 My studio: D.B. Walton
by D. Brent Walton
THE GOODS
59 What I like: Kevin Jairaj
60 Roundup: Wow your wedding cby Robyn L. Pollman
62 Pro Review: Sekonic LiteMastPro L-478DRby Stan Sholik
66 Lighting: Location lightingby Stan Sholik
76 Pro review: Tamron SP 90mmf/2.8 Di VC USD Macro 1:1 len
by Cate Scaglione80 Pro review: Adorama Flashpo
by Ellis Vener
ON THE COVER: The image is part of a Loan Ction album created by Artistique of PortlandIt was made with a Nikon D3 camera with a 70-200mm f/2.8 lens at a focal length of 1201/125 second at f/3.5, ISO 400, in availableMichelle Stevens of Artistique found bride agroom Thanh and Huan particularly engaging
8 • www.ppmag.com
16 FEEDBACK
24 FOLIO
133 PPA TODAY
142 AFFILIATE SCHOOL DA
146 GOOD WORKSPROFESSIONAL PHOTOGRAPHER | MARCH 2013 | WWW.PPMAG.COM
By narrowing her photographic niche and limiting her studio’s
bookings, Julie Klaasmeyer was able to slow down while maintaining a booming business.
IMAGE BY: JULIE KLAASMEYER
CONTENTS
128
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 9/148
[email protected] www.elinch
"In my studio we do everything with
Elinchrom’s BXRi compacts. In fact,strobes are Elinchrom lights - but I
use them in the studio - they're wit
location shoots and when I'm on th
doing my live training sessions arou
country. I need light I can count on
time, and the BXRi's are ultra consi
incredibly dependable, and that's rea
important to me.
I especially love the BXRi's built-in
wireless control and triggering syste
because it lets me change power an
ratios right from the top of my cam
more climbing up ladders, or pulling
booms, or getting out of "the zone"
make a simple adjustment). I do all
my camera position, and it saves a t
frustration, and money.
Skyport has saved my butt on more
occasion and honestly, now that I ha
type of control I just couldn't go ba
being able to pop the lights.The BX
the built-in Skyports have changed e
and that's why I tell all my friends w
photographers - you gotta go Elinch
I love my BXRi's, they just
flat out rock!
Photoshop was not
used to place any elements in this i
Learn more about cameras, photogr
Photoshop, Lightroom and many ot
photography related topics at
www.scottkelby.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 10/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 11/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 12/148
Professional Photographersof America229 Peachtree St., NE, Suite 2200
Atlanta, GA 30303-1608
404-522-8600, 800-786-6277
FAX: 404-614-6400,
www.ppa.com
2013-2014 PPA board
president
*RALPH ROMAGUERA SR.
M.Photog.Cr., CPP,
API, F-ASP
vice president
*SUSAN MICHAL
M.Photog.Cr., CPP, ABI
treasurer
*MICHAEL GAN
M.Photog.Cr., CPP
chairman of the board
*TIMOTHY WALDEN
M.Photog.Cr.,
Hon.M.Photog, F-ASP
directors
DON MACGREGOR
M.Photog.Cr., API
ROB BEHM, M.Photog., [email protected]
LORI CRAFT, Cr.Photog.
MICHAEL TIMMONS
M.Photog.Cr., F-ASP
RICHARD NEWELL
M.Photog.Cr.
STEPHEN THETFORD
M.Photog.Cr., [email protected]
AUDREY L. WANCKET
M.Photog.Cr., CPP
MIKE FULTON
Cr.Photog.
industry advisor
LOU GEORGE
PPA staff
DAVID TRUST, CAE
Chief Executive Officer
SCOTT KURKIAN, CAE
Chief Financial Officer
Chief Operating Officer
JANE GABOURY
Director of Publications
KRISTEN HARTMAN
Director of Member
Value and Experience
WAYNE JONES
Director of Sales &
Strategic Alliances
ANGELA KURKIAN,
M.Photog.Cr.
Director of Education
SCOTT MORGAN
Director of Information
Technology
WILDA OKEN
Director of [email protected]
CARLA PLOUIN
Director of Marketing
and Communications
LENORE TAFFEL
Director of Events
SANDRA LANG
Executive Assistant
*Executive Committee
of the Board
12 • www.ppmag.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 13/148
photographers wanted
and start fulfilling dreams JOIN OUR TEAM
TODAY
To learn more about opportunities at Photography by David's Bridal,
email [email protected] visit photographybydavidsbridal.com/joinus
Let David’s Bridal be your partner. Our talentedphotographers are supported by a team of centralized
planners, editors and production partners.
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 14/148
Innovationthat InspiresThe compact X-E1 is engneered to deliver extraordnay image qualty.
It starts wih FUJIILM's propretary 15.3MP APS-C X-Tans MOS sensor
wose uniqe pixel array s desgned to dever surpasse mage
resolto ad coor acuracy hoose from te ewy expaded X es
inep wt two ew brght, ig-efiiton FUJINO X-Mout esesg a 4 F28 ad a 8 F284 les. he 8
alows poogapc fexby, optmzes lowgt sootg ad
ouped w te EXR roessor Pro, te X-E deivers ig performace
atofocusing. veryg yo need one omat, beatf amera
system.
FujifilmXseresCameas.comFUjlFIM and FUjlNON are tademaks of FUji FM Corpoation and is aiates. © 2012 FUjlFILM Noh Aeca Cooaio ad ts afilaes Al rigs eserved
"I've retired my DSL
spectacular color re
size and shapess
is ow my camera o
itercageable le
versaile for any as
lightwegt easy tocomfortable. O cou
films te camera ca
my eye sees
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 15/148
X-ElInspiration. Innovation. Per
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 16/148
EMAIL • FACEBOOK • TWITTER • THE LOOP
SEEKING FEEDBACK
If Professional Photographer is on your mi
us what you’re thinking. Send your questioand comments via these channels:
feed back|
facebook.com/ppmagazine
twitter.com/ppmagazine
theloop.ppa.com
PAPER PUNCH
A lot of people enjoy reading with their iPads,
Nooks and so on. I got my Professional Photographer magazine in the
mail today and I still enjoy flipping through the pages. Am I just a weird minori
Karl Mullings, KFM Designs
•
I also read quite a few magazines on my iPad, and I consider myself a huge tech
but there is still something about holding a book or magazine in your hands and
it that I prefer unless I need the convenience of traveling light. When i
comes to Professional Photographer magazine, I rarely read the online vers
(although it is very well done) because I simply prefer paging through th
magazine physically; I find it more rewarding.
Robert Zimmerlich, CPP, ClickChick Photography
•I love the print version as well and keep back copies to
loan out to student interns all the time.
Tara Patty, Tara C. Patty Photography
BANG-UP DIGITAL
Spark names top 10 best digital prod-
ucts for photographers. Congrats
@PPMagazine for Best Magazine.
Zach Prez
Finally got to download the December digi-
tal version. Looks awesome! Thanks for
including me!
Carrie Wildes
Carrie Wildes Photography, Art, Design
POWER OF NUMBERS
Just wanted to drop you a note about
Bridget Jackson’s column in Professional
Photographer (“Making Money”). I was
one of those kids in high school who
absolutely hated math. Her articles on cost
of sales and strategic pricing are making me
like it! My dad
would be
proud. I’m
looking forward to her insightful articles in
upcoming issues.
Clark Sanders, CPP
Clark Sanders Photography Inc.
VALUING CHANGE
ORDERS
One of the questions in the
Ask the Experts column in the
December issue related to
something I learned as a project
manager in high tech: Evaluate
each change the client requests.
Changes have impacts on time
and money, and it is only fair
that clients know what they are
letting themselves in for.
For example, adding four more
people to a set of individual por-
traits has significant impacts on the photog-
rapher’s time on site, image processing, and
output. The details should be worked out so
the customer knows that significant addi-
tional cost and time will be incurred to c
with specific requests. That gives them option to rethink their ideas in the light
new cost and time information. If they a
to the additional cost and time, then so
the better! I
Paul Mc
Carpe
16 • www.ppmag.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 17/148Discover more online at XXXCMBDLSJWFSJNBHJOHDPNt
Amanda ReedOwner of Amanda Reed Photogra
“My seniors will come from hundreds of miles
away for these Custom Magazines. Their school
friends notice right away they’ve been to Amanda
Reed Photography.”
“Ordering Prints on Standout
Mounts have been popular with my
clients. They can choose from
several options to match any décor.”
Standout Mounts
Custom Magazine“Clients love high-quality wall pr
and I love the look on their faces
when they see their Gallery Wrap
the first time.”
Gallery Wraps
“My business and my family mean the world to me. When it comes to my clients, delivering
the final product is the climax moment of their journey with me. I know that I can trust
Black River Imaging to nail that moment every time. My family and I have visited their
facility several times and everyone there is like family, wonderful and caring. From top to
bottom, they are doing everything possible to help professionals succeed.”
To view more of Amanda's work visit www.amanda-reed.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 18/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 19/148
2-3 Day Turnaround, FREE Overnight ShNEW WRAPAROUND COVERS | PHOTOGRAPHIC OR PRESS PAPER | UP TO 50 PAGES/100 SIDES | THIN OR THICK PAGES | DESIGN
MILLER’SIGNATUR
ALBUM
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 20/148
2-3 Day Turnaround, FREE Overnight ShippingNEW WRAPAROUND COVERS | PHOTOGRAPHIC OR PRESS PAPER | UP TO 50 PAGES/100 SIDES | THIN OR THICK PAGES | DESIGN SOFTWA
MILLER’SSIGNATUREALBUM
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 21/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 22/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 23/148
2-3 Day Turnaround, FREE Overnight ShNEW WRAPAROUND COVERS | PHOTOGRAPHIC OR PRESS PAPER | UP TO 50 PAGES/100 SIDES | THIN OR THICK PAGES | DESIG
MILLER’SIGNATUR
ALBUM
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 24/14824 • www.ppmag.com
f olio| Showcasing images selected from the files of the PPA Loan Collection, Folio is a monthly sampleof award-winning photography from the most recent International Photographic Competition (IPC),which is open to non-PPA members. The current Loan Collection is a select group of more than400 photographs chosen for distinction by the IPC jurors. ppa.com/IPC
GET A GRIPThe Labrador puppy in “Get a Grip” by Aileen Harding, CPP, is just 4 weeks
old. Harding, who specializes in fine-art portraiture, captured the image in
her studio, A. Harding Photography, in Baytown, Texas. “I lay down on my
stomach to get an eye level perspective and shot at f/8 to get detail from the
pup’s nose to his ears,” says Harding. “This perspective placed the image’s
focus on his sharp little puppy claws, his stubby puppy ears and wrinkly
puppy face.” aharding.net
CAMERA & LENS: Canon EOS 5D Mark II camera, Canon 70-200mm
f/2.8 IS II lensEXPOSURE: f/8 for 1/125 second, ISO 100
LIGHTING: Typical high-key setup with a white paper background; two
White Lightning Ultra 1600 monolights feathered across the backgroun
metered at f/8; one White Lightning Ultra 3200 with a 4x6 Larson soft
camera left, metered at f/8; one White Lightning Ultra 1600 with umbr
bounced light behind the camera and slightly to right for fill, metered to
SOFTWARE: Adobe Lightroom to adjust white balance and increased
then Adobe Photoshop CS5 to remove puppy dandruff, clean up the floo
retouch the catch lights in the eyes.
©Aileen Harding
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 25/148
Sell yourimagesanywhere.Get paid everyFriday!
Unlimited uploads
Personalizedthemes to matchyour branding
NEW social mediaintegration
NEW
Digital BragBook with everysite you post
Sell ANY productin your galleries
Free Sign-Up: www.collages.net/PPAsignup
(877) 638-7468 | [email protected]
Albums | Books | Professional Printing | Cards | Sell Images Online | Post Production Serv
Photo Credit: ABM Wedding Photography. ©2013 Collages.net Inc. All rights reserved.
Get unlimited galleries, images, and storage for only $149 per year. Add unlimited
Digital Brag Books for only $100! For more information, visit www.collages.net/Plan
VISIT US AT
WPPBOOTH
1539
ONLY $149PERYEAR
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 26/148
©Steve Jessee
GOLDEN ARCHES (left)Steve Jessee, M.Photog.Cr., CPP, specializes in landscape art photography
senior portraits at his studio, Associated Photography, in Princeton, W.V., and
also a Photoshop instructor at Concord University. He captured “Golden Arch
while exploring shooting locations in Washington, D.C. “I stepped into thi
beautiful hallway [part of the U.S. Postal Service building] to get out of th
rain,” says Jessee. “The leading lines and the arches woke up my senses to
capture the moment.” associatedphotography.ifp3.com
CAMERA & LENS: Nikon D7000 camera, Nikon AF-S Zoom-Nikkor 17
f/2.8D IF-ED (2.1X) lens
EXPOSURE: f/5.6 for 1/125 second, ISO 800
LIGHTING: Available light
SOFTWARE: Processed in Adobe Photoshop 6 with a Topaz Adjust 5 Sp
filter to bring out the full color range. Jessee applied a glow to the hangin
lights, and that’s when the title of the image came to him.
SUNRISE AT MESA ARCH (below)Randy Van Duinen captured “Sunrise at Mesa Arch” while he was leading
photographic workshop in Canyonlands National Park, Utah. At his busineRandy Van Duinen Photography, in St. Petersburg, Fla., he specializes in
architectural, landscape, and HDR photography in addition to being a
photography instructor. Because Mesa Arch has been much photographed
Duinen looked for a fresh take. “In order to capture as much detail as I wa
shot a nine-stop bracket series to merge into an HDR image.”
rvdphotography.com
CAMERA & LENS: Canon EOS 5D Mark II camera, Canon EF 16-35mm
II USM lens shot at 16mm
EXPOSURE: f/22 for 1/40 second
LIGHTING: Natural available light
SOFTWARE: Lightroom 4, PhotoMatix 4.2, and Adobe Photoshop
©R an
d y V anD ui n en
26 • www.ppmag.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 27/148
Free Sign-Up: www.collages.net/PPAsignup
(877) 638-7468 | [email protected]
Albums | Books | Professional Printing | Cards | Sell Images Online | Post Production Servi
*DESIGNSALE can be used on your first Custom Design order unti l July 1, 2013 at Midnight (EST ). This offer cannot be combi ned with any other offers or coupon codes.Photo Credits: Dustin Meyer Photography and Visual Xpressions. © 2013 Collages.net Inc. All rig hts reserved.
Enjoy Custom Design pricing as low as $0.75 per image! Use code DESIGNSALE
at checkout. Expires July 1st. Learn more: www.collages.net/Design
Spendmore time
behindthe lens!Custom Designas low as
$0.75 per image!
Save time and money by trusting yourdesign work to our experienced designteam. Each custom design is unique—no templates! Choose from three designlevels to match your studio’s style andclients’ preferences, from clean andclassic, to sophisticated and stylish.
“I trust Collages.net’stalented design team tocreate my albums which
allows me to have moretime to be me—a momand a photographer.
Best of all, more timebehind the lens allows me to make moremoney.” Tina DeAngelis, Visual Xpressions,
Collages.net customer since 2008
ASK ABOUT O
POSTPRODUCTSERVICE
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 28/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 29/148
Where discerning photographers belong.
Stacie + MpixPro: A Beautiful Partnership
0SL[3URZDVWKHÄ UVWYHQGRU,XVHGIRUP\SKRWRJUDSK\EXVLQHVV$VP\EXVLQHVVKDVJURZQVRKDVP\ORYHIRU0SL[3UR 7KH\DOZD\VSURGXFHEHDXWLIXOSURGXFWVZLWKVXSHUIDVWWXUQDURXQG$QG,DSSUHFLDWHWKHLUJUHDWFXVWRPHUVHUYLFH
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 30/148
CONTACT SHEETWhat’s New, Cool Events, Interesting People, Great Ideas, Etc.
All images ©Kos Evans
“The most important
thing is to believe in
yourself. Sometimes
your ideas can be
ahead of the vision at
the time, but if you
continue chipping
away, people catch
up and come on board.”
—KOS EVANS
Walking on
water The daredevil photography
of Kos Evans
BY JEFF KENT
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 31/148
I t’s hard to imagine that one of the
world’s foremost marine photog-
raphers stumbled into the field—
or surf, as the case may be—but
that’s the reality. While still in
school, Kos Evans, who has made a profes-
sional name for herself as simply “Kos,”
lucked into an opportunity to photograph
powerboat and water skiing competitions.
A year after graduating from college, for-
tune again brought a major opportunity,
this time to shoot the 1982-83 America’s
Cup yacht races.
Kos has built a career in marine photog-
raphy, both artistically and commercially.
She’s pioneered innovative techniques and
aced challenging commercial assignments
for some of the world’s most recognizable
brands. Kos runs her own photo agency, Kos
Picture Source, a worldwide source of yacht-
ing photography, and is a player in new
communications technology with the recent
release of an interactive publishing platform
for the iPad called Boyd.
“I decided to specialize in marine photog-
raphy because I felt there was a lot more work
to be done with the imagery of yachting,”says Kos. “I also liked that there was a lot of
organization involved before you take a pic-
ture. It’s not like sitting on a [playing
field’s] touchline and catching the action
that’s laid out in front of you. With marine
photography, you have to create your shots.
You have to instruct a boat driver or helicop-
ter pilot where you want to be. You have to
observe weather conditions, even wind shifts,
and you have to hope the large waves in front
of you don’t obliterate the shot as it starts to
be created. There’s a lot involved.”
Kos does her best work when the client
lets her interpret the image in the way she
feels will hold the strongest marketing value.
Yet some of Kos’ best-known images are not
highly commercial. Years ago, she developed
a method for photographing yachts from
perch on the mast. Those distinctive ima
have become her trademark and helped
her a reputation as a daredevil willing t
push the limits artistically and physical
These photos and others are feature
the new book, “Walking on Water: The devil Acrobatics of a Pioneering Photogra
(Bloomsbury). The book lends insights
how Kos perceives her images and wha
experiences to capture a particular shot
not about f/stops,” she says, “because wh
are hanging out of a helicopter at 100 mp
up a 200-foot swaying mast, those techni
ties are just a very small part of the pic
Most of all, the book demonstrates how
innovative approach has set her apart i
highly competitive business. “The most im
tant thing is to believe in yourself,” she
“Sometimes your ideas can be ahead of
vision at the time, but if you continue ch
away, people catch up and come on board
See more from Kos at kosphotos.com.
March 2013 • Professional Photograph
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 32/14832 • www.ppmag.com
CONTACT SHEET
PP Asks …Facebook is where the happyhappens. LIKE our page(facebook.com/ppmagazine),and take part in tear-inducingdiscussions like the following:
YOU WANT ME TO WHAT?!
WHAT’S THE ODDEST THING A
CLIENT EVER ASKED YOU TO D
A lady came into my studio with a photoher sister. She wanted me to copy the pfor enlargements and when I did, turn hter around so she could see her face. Afshe had the negative.
Bruce Cen
A wrestler came into my studio with lotprops for his promo ads that I was photgraphing for. He wanted to be photogra
in fairy wings, in a garden of flowers, wiHanson CD … . It was an extremely fun s
Erin
A lady brought me an old B&W snapshofrom when she was little. She wanted mreproduce it in color so that she could swhat color her dress was. She argued wwhen I told her that I couldn’t tell what her dress was. She said they did it to “TWizard of Oz,” so she knew it could be d
Melissa
Following a business shoot, a client ask
that I completely redesign her eyebrowslips in Photoshop.
Kelly Shull
A client requested sand be brought in fooutdoor shoot so it would look like she the beach. We live in Illinois; I’m pretty the corn fields in the background wouldgiveaway that she was not at the beach
Rebecca Whitaker Do
I was asked to incorporate feathers fromfreshly killed turkey (with bits of skin stthem) into a newborn shoot.
Heather Lickliter
A neurologist who was doing research otiple sclerosis hired me to photograph sof his lab mice in various stages of the disea
Sharon Go
For more on that mouse photo shoot another unpublishable answers, see theFacebook discussion that began Jan. 10(facebook.com/ppmagazine).
PP ’s Giveaway of the Month
Tamron’s new 90mm macro lens uses optical and image stabilizing
technology to deliver sharp focus on the subject and soft natural
blurring in the foreground and background. This lens is compatible
with full-frame and APS-C DSLR cameras. It features high-grade glasselements, 1:1 maximum magnification, full-time manual focus,
internal focusing, vibration compensation, and eBAND (extended
bandwidth and angular-dependency) coating for
significant anti-reflection properties. It’s valued at $499.
Learn more at tamron-usa.com.
WIN THIS!
ENTER TO WIN A
TAMRON SP 90MM
F/2.8 DI VC USD
1:1 MACRO LENS
PPMAG.COM/WIN
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 33/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 34/148
“In my line of work, the saying is that if
you’re not scared, you’re in the wrongplace,” laughs Jim Edds from his home
base in Pensacola, Fla. When everyone else
is evacuating the path of an impending
storm, Edds goes rushing in.
Edds is among that rare breed of photog-
raphers who make their living capturing the
drama of Mother Nature’s most destructive
forces: hurricanes, typhoons, cyclones, tropi-
cal storms. After more than a decade chasing
storms around the globe, he’s published
“Hurricane Journey,” a digital book combin-
ing text, photography, and video (available
at the Apple iTunes Store). The compilation
is a fitting format for Edds’ work. It covers
everything from how a storm develops to how
forecasters track it to the proper precautions
to take before evacuating and how to survive
if you get stuck in a major storm. Edds
includes interviews with National Ocea
and Atmospheric Administration fligh
directors and technicians to create a we
rounded look at storms, highlighted by
own photos and videos.
“In the past 10 years, I think I’ve film
more storms than just about anybody,”
Edds, adding that the frenzied storm a
between 2003 and 2005 alone was enou
base a career on. “You need a way to do
you want and what you love with your era. I used to live for the weekends before
this; now I don’t. I’m being creative, tra
—sometimes I get a little vacation out
You can make a year’s salary off of one
if you do it right.”
That means Edds keeps a constant
the weather. When the Atlantic basin i
quiet, he watches the Pacific. The trick
judging when a storm is going to build
something worth hopping a plane for.
“Getting there is the fun part,” says
“The forecast track isn’t always right, so it
ting into the right place at the right tim
can get to a storm and be the only guy th
can feed out that footage to anyone. It’s go
Read more about Edds and see his wor
extremestorms.com.
CONTACT SHEET
34 • www.ppmag.com
A l l i ma g e s © J i m
E d d s
Into the eye of the storm withphotographer-videographer Jim Edds
Chasing the Action
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 35/148
Photo by Shelley Paulson | Zenfolio user since 2010
Zenfolio has everything you need to place yourphotography online and start selling
Start a free trial at zenfolio.com
See
every month. Stop by our booth at WPPI for more details a
check out our show special for new accounts.
S e e u s a tB o o t h #
Shelley Paulson | Zenfolio user since 2010
hy thousands of photographers switch to Zenf olio
HOME
GALLERIES
ABOUT
CONTACT
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 36/148
New Orleans-based photographer Marc
Pagani has taken his camera from the slopes
of Mt. Everest to the beaches of Cuba, docu-
menting life in Nepal, Tibet, Argentina,
Chile, Iceland, Mexico, France, and many
other destinations along the way. In a new
book released by Course Technology PTR,
Pagani talks about his experiences over more
than a dozen years of photo-centric travel.
“Fearless Photographer: Travel” presents sage
advice on the technical and tactical. Here,
Pagani gives six of his favorite travel tips.
1. Before you even think about the air-
fare, do your research. Decide on a location,
make a photographic goal, learn the visa
requirements and other logistics, and reach
out to friends and family members to find
contacts who live near your destination.
Knowing someone who is willing to help out
with logistics is immensely helpful to your
CONTACT SHEET
The fearless photographerMarc Pagani shares insights on travel photography
A l l i m
a g e s © Ma r c P a g a ni
36 • www.ppmag.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 37/148
overall experience and your photography.
2. Always learn the locale’s words for
“thank you,” “yes,” “no,” “please,” and as
many other basic words and phrases as pos-
sible. Simply making the effort to speak the
language goes a long way. At your destina-
tion, talk to the locals about the region. In
conjunction with a good guidebook, Pagani
says it’s always helped him piece togetherreliable information about where he should
shoot, what dangers to watch out for, and
where to go for nightlife and dining.
3. Especially in remote areas where there
are language barriers, take along a small
instant print camera like the Polaroid PIC-
300. Use it to give your portrait subjects a
quick photo memento as thanks for allowing
you to shoot them. “This really helped break
the ice when I was in Northeastern Vietnam,
Tibet, and Nepal,” says Pagani.
4. Back it up, reminds Pagani: “I’m talk-
ing about redundancy in your image backup
scheme while you travel, preferably includ-
ing a cloud-based server so that if all of your
gear is destroyed or stolen, the images are
still accessible.”
5. Shoot everything. When you’re in a new
location, photographing the transportation
modes, foods, architecture, people, animals,
nightlife, and religious icons and rituals will
help give the viewer an understanding of the
culture and overall feel for that area. Tell a
complete story with your images.
6. Make a photocopy of your passport
and keep it in a safe place apart from your
actual passport. If you’re carrying your pass-
port, keep the photocopy in a safe place in
your hotel room, and vice versa.
See more from Marc Pagani at marcpagani.com.
March 2013 • Professional Photograph
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 38/148
This new, private community (PPA members on
the above and more. And it makes it easier tha
to connect with your peers in a safe place. Fro
ideas to sensitive topics like dealing with dema
clients, share it all without fear of potential cus
seeing it. Log in and get in theLoop!
theLoop.PPA.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 39/148March 2013 • Professional Photograph
Professional Photographer P R E S E N T S Business, Marketing, and Sales Strategie
What I think Eric Lindberg emphasizesbusiness fundamentals
What advice would you give to someone just
beginning in the business? Have another
source of income to carry you through the
startup phase. It could take a couple of years
or a lot longer depending on how hard you
hustle to build business.
What’s the greatest challenge your business
has faced in recent years? Semi-pros willing
to sell photos cheap or give them away. I
haven’t overcome this challenge, but I’ve
worked around it partly by finding smaller
markets that are interested in fresh imagery.
What’s the secret to running a successful photography business? Business fundamen-
tals are key. We may consider ourselves
artists, but if we aren’t also adept at plan-
ning, marketing, advertising, selling, and
accounting, most of us won’t get very far.
Many photographers diversify: Along with
shooting for clients, they teach, lead work-
shops, create successful blogs, sell how-to e-
books, do public speaking, offer their work
through galleries, sell at art fairs and festi-
vals, create lines of greeting cards, and pro-
mote their work through social marketing.
We need to adapt to changes in the market.
IMAGE BY ERIC LINDBERG
ERICLINDBERG.COM
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 40/148
Q. One of my clients hires me to do product
shots under a limited-use license. She uses
the photos online for her blog and her Etsy
store. She asked me recently if she could use
some of my photos in a wedding magazine.
Does this require a different license agreement
between us or do I deal directly with the
magazine publisher? Do I seek compensation
for the published photos or is it reasonable
to barter for an ad in the magazine?
A. Technically, the publishing company would
need a license agreement to use those images
in the magazine, so you could reach out to the
publisher about a license. However, you also
have to consider your client. You don’t want your
client’s story killed because you weren’t able
to reach a deal with the publisher. The maga-
zine could easily walk away from your request,
and you would have a very unhappy client.
I believe the best bet is to talk to the pub-
lisher and suggest a swap for an ad. If that
doesn’t work, my approach would be to let the
magazine use the client’s images for the story
without a fee. I wouldn’t want to lose a clientover this, and based on the fact that it’s a sup-
porting image (not the cover, for example), you
probably are not missing out on enough money
to risk the loss of future business. In any case,
you do need to ask for and expect a photo credit.
—Eric Doggett
Q. Does anyone have a workable high school
senior ambassador program that outlines
the basic steps needed to attract seniors?
A. The high school senior market is one of the
most competitive segments in the photogra-
phy industry, so getting in front of your target
market can be harder than ever. In the past,
ambassador programs were the key to gener-
ating active referrals and bringing in new
clients. But as the number of photographers
in the market has grown, so has the number
of these programs. The result is that they
don’t work like they used to.
Yet my studio’s model program is a key
piece of the marketing strategy that has
grown our senior business year after year. It
has set us apart as senior portrait expert.
How did we do it? We started by asking our-
selves this: In a market where everyone is a
photographer, what makes us different?
Once you answer that question for your-
self, you have to look at how to get target
seniors in the door. How do you create a
model program that says your studio is the
place for senior portraits? You create both an
experience and a relationship.
To understand how to do this, focus on
three key elements:1. Make your program exclusive. The tra-
ditional ambassador program offers no sense
of belonging or exclusivity. For current high
schoolers, these factors are critical. They all
want to stand out, be famous, and feel a part
of something that not everyone can be a part
of. Look at it this way: If you are doing an
open model call (seeking models online by
inviting anyone who wants to be a model),
then your target market realizes there is
nothing special about being a part of your
program because anyone can do it. Befo
exclaim But we want anyone who wants
a part of our studio to do it! realize I’m t
about how you market your program: Yo
need to build a degree of exclusivity into
becoming a model (or ambassador) for ystudio to drive your target to want it mo
Focus on students’ desire to feel unique
famous, and you will start to create valu
your program.
2. Do not require ambassadors to pr
your services. The current model program
too much emphasis on actively pushing
rals as opposed to focusing on the fun a
experience of being a model. I know, I kno
want referrals. I do too! But to reach this
eration, you must break down your curre
of thinking in relation to advertising. You
not simply photograph seniors and creat
sales pitch for them to go out and pimp
studio to their friends. You must create
and a relationship with your models to a
them the opportunity to be your represen
in the world. Create ways for your mode
market your studio year round whether
they actively refer individual clients to you
target market—their friends and peers—
see and hear about their experiences, an
will give you a more valuable platform th
having your model Madison tell her frien
Katelyn “Hey, go to this studio! Tell them
you and get eight free wallet prints.”
3. Don’t do it alone. To make your pgram successful, give the impression th
bigger than just your studio. Create bus
partnerships and get partners involved i
program. Create ways for them to intera
with your models, and create value for y
models with those relationships. Do not
these into direct sales pitches, but weave
into the model experience. Aligning you
dio with people who complement your b
will create mutually beneficial marketing
opportunities and drive long-term bene
Almost everyone has an ambassador
gram. To create one that grows your busyou must separate yourself from the pa
Focusing on ambassadors’ experience an
relationship with your studio will help you a
differentiation and a profitable senior busin
—Jen B
Got a question? Email our experts c/o Peditor Jane Gaboury at [email protected]
40 • www.ppmag.com
Ask the expertsLicensing agreements and senior ambassadors
STUDIO MANAGEMENT SERVICESPROFIT CENTER
The high school senior market is one of the
most competitive segments in the photography
industry, so getting in front of your target
market can be harder than ever.
GURUS FROM PPA STUDIO MANAGEMENT SERVICES ANSWER YOUR BUSINESS,
MARKETING, AND SALES QUESTIONS. FOR INFO ON WORKSHOPS, GO TO PPA.COM.
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 41/148
Ultra-bright, dimmable output
Focusable from tight spot to wide Àood
High-CRI photo-quality tungsten LED
Self-contained, DC powered
Model, accent, key and fill all in the palm of you
Designed in collaboration with noted photograp
Brian Marcus and John Solano
www.lowel.com
See the GL-1 at WPPI, Booth #329
Learn more at LowelGL.com
Lowel GL-1 Power LED
Hollywood Lighting
In The Palm of Your Hand
Introducing A Revolutionary New LE
©Brian Marcu
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 42/148
PROFIT CENTER: STARTING OVER
BY KALEN HENDERSON,
M.PHOTOG.MEI.CR., CPP, API
Is our industry crazy or what? I mean, really,
in how many industries are the professionals
expected to compete in an arena where the
engineers keep creating new devices weekly
for use by pros and amateurs alike?
Professional photographers deal with the
madness every day. Our bread and butter is
being plucked from our lunchboxes with the
aid of the very corporations that produce the
tools we use. They are creating “toys” for
amateurs who are deluded into thinking they
can make money as photographers in their
spare time. Well, I have yet to find a true pro-
fessional photographer who has any time to
spare in the midst of business marketing activ-
ities, community participation, client educa-
tion, continuing education, postproduction,
and, oh yes, photo shoots—all the while
deflecting the barrage of social media post-
ings made by the weekend warriors newly armed with the latest photo editing actions.
Take heart. I recently saw a beacon in the
darkness, when a bride arrived on my
doorstep with a flash drive in hand and a
horror story about how one of these “amaz-
ing” weekend artists failed to deliver on her
wedding. The images were—to use a techni-
cal term—awful. Her question to me was,
“What will you charge me to fix this?” I told
her it would have been much less expensive
to have hired me in the first place, but that
was a moot point. She was in tears. I had
sympathy for her and a lot of anger toward
that part-time wannabe for promising so
much more than he or she could deliver.
Now back to our bride and how we’re
going to spin this little problem to our advan-
tage. After all, those of us who have dedicated
our lives, not just our weekends, to this pro-
fession have both the knowledge and the desire
for knowledge that will enable us to make
lemonade from the lemons we’ve been handed.
If we quickly assess the cause of the problem,
we can perhaps provide a corrective solution so
that this young bride will have wedding images
to show her children and grandchildren.
We’re giving not just a sparkly marketing
campaign but a veritable educational show-down. We must lead with our experience,
our knowledge, and our education and then
explain to the potential client why those
things are important. I’ve seen the websites
of many photographers who think it’s
important that potential clients know what
kind of car they drive or how they feel
about recycling. Shouldn’t it be more
important that a client be assured of a
tographer’s knowledge of resolution s
color balancing, and how to make the mother-in-law look 20 pounds lighter
that tan dress? Of course it should.
Marketing is using various media to
vince people to become your customer
Education is the process of teaching th
why. What we’re encountering are con
sumers who didn’t know what to ask in
first place and are then wondering Why
when they receive an inferior product.
What the occasional photographer
actually doing is creating business for m
without even knowing it. Every sad sto
remedy is another testimonial for my p
sional skill. Collect enough testimonial
you “right” the rulebook. I
Kalen Henderson’s Studio K/Henderso Photography is located in Mt. Pleasant,
A beacon shinesShow clients the light through education
42 • www.ppmag.com
©Veer
In how many industries are the professionals
expected to compete in an arena where the
engineers are creating new devices weekly for use by pros and amateurs alike?
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 43/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 44/148
Begin with the end in mind, advised business
guru Stephen Covey. It is challenging to start
a journey without knowing where you’re going.
After covering managerial accounting,
portrait pricing, and wedding pricing, it’s time
to cut to the chase. Let’s figure out the bot-
tom line before we journey into the topics of
selling, marketing, branding, taxes, and all
the rest of the functions that require the
attention of the successful studio owner.
What is your bottom line? It might be
having enough money to replace the income
from your full-time job, it might be to con-
tribute a certain amount to your household
income, or it could be having the ability to pay
for your child’s college education. Regardless,
you are in business to make money. You should
have an idea of what you’d like your bottom
line to be. From there, you’ll be able to deter-
mine how many sessions you need to photo-
graph and the average sale from each of those
sessions that you need to reach your goal.
Let’s begin with the end in mind: How
much do you want to make?
Look at the table below. Here we’re
assuming you want to make $85,000. To do
that, you will need to gross more than
$200,000 in sales, average 25 percent cost
of sales (COS), and keep your production
workflow efficient. Fixed expenses can be no
more than 35 percent for a home studio (45
percent for a retail studio), and your time
management must be spot on.
Consider your time for a moment. In this
example, you spend 8 hours a week working
on your business (financial management, mar-
keting, relationship building, etc.). The rest
of your time is spent working in your business
(photographing sessions, postproduction,
designing albums, etc.). Given the seasonal
nature of the typical studio, those hours will
be concentrated into the seasons of your
specialties (wedding season, senior sea
portrait season, and so on). It is impera
that you create a workflow that provid
the most efficient use of your time.
Document your workflow from the
client contact through the delivery of p
ucts, and update that process periodica
based on technology advancements an
recognizing time-wasters in your produ
calendar. This bottom-line tool, along
other tools to help you assess your busi
from the PPA Financial Benchmark Su
is available at ppa.com.
Once you have made this assessment
see that you need to develop a marketing
that will attract clients who will spend an
average of $4,000 for wedding photog
and $1,500 on a portrait session and fin
products. This is the exciting part. You
what you need to do, having your goal
mind, as you plan and build your mark
calendar.
Just as important as getting those c
in the door is creating and perfecting y
sales strategy. For weddings, this strate
considers what you need your average
be, and using the good-better-best-and
it-all pricing strategy allows you to design
pricing in a way that will yield the resul
need to meet your bottom line. The mi
package should be at the price point that
like your average to be. For portraits, you
plan is a journey of education from the
tial contact to delivery of final product
are walking your client through a creat
process that leaves no room for doubt a
the value of their portrait. Look for mo
sales strategies in the coming months.
Bridget Jackson is the PPA Studio Manment Services manager. Contact her at [email protected].
Starting at the endLet’s get to the bottom of it
PROFIT CENTER: MAKING MONEY
BY BRIDGET JACKSON
TOTAL BOTTOM LINE BEFORE TAXES $85,000
SALES SESSIONS AVERAGE
Weddings 25 $4,000 $100,000
Portraits 75 $1,500 $112,500
Total sales $212,500
Cost of sales (25%) -$53,125
Gross profit $159,375
Total fixed costs (35%) -$74,375
Bottom line $85,000
WORK SESSIONS HOURS/SESSION TOTAL HOURS
Weddings 25 40 1,000
Portraits 75 8 600
Administrative 8/week 400
Total hours 2,000
Cost per hour $42.50
44 • www.ppmag.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 45/148
Portfolio Sites • BizSites • Stores • Blogs • Client Proofi
Web Styling Service • SEO Service • Social Media Se
With PhotoBiz it's like having two of me. I absolutely love thfact that we can update stuff so quickly. It makes our job a lot easier, and we have more time to do what we actually dowhich is shoot.
- Hiram TrilloGet more of my story at
PhotoBizLovesMe.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 46/148
PROFIT CENTER: MASTERING MARKETING
BY ANGELA POINTON
When you’re heading out to the drugstore,
do you get excited? Are you passionate about
shopping there? Does the experience leave
you wishing you could spend more o your
hard-earned dollars there?
Or is your drugstore like most any other
drugstore in America, with the same prod-
ucts, similar layout, and checkout people who,
honestly, would rather be anywhere but
there? None o the national drugstore chains
has been successul at dierentiating its
products or services. When one drugstore
chain started oering lu shots, all the others
were doing the same beore you could say
“lu shot.” Because there are no dierentia-
tions among the chains, they oten compete
on price, as evidenced by the repetitive cycle
o weekly circulars, which have ushered in a seasonal rotation o discount doom.
BEING DIFFERENT MATTERS
Dierentiation creates a space your business
lives in with ew, i any other, photography
businesses. I you can connect with the things
that can make your photo business unique,
you have the beginnings o dierentiation.
Unique businesses experience ew com-
petitive threats, get out rom under discount-
ing and price competition, and most important,
align themselves with the kinds o customers
they want to serve. There are consumers
looking or unique experiences. And there
are clients you’re dying to work with who are
just waiting or you to show your true colors.
DON’T BE A DRUGSTORE
KNOW WHO YOU ARE. One o the key
aspects o dierentiating your business is this
basic: It’s your business. The biggest mis-
take I see photographers make is comparing themselves to photographers they admire,
compete with, or hear about rom potential
clients. Measuring yoursel this way results
in one outcome: The insane act o making
business decisions based on someone e
business strategy. The result is that you
make your business more like theirs.
Wise photographers know what the
have to oer the world. They do not im
others. I they remain true to themselv
rather than look outside themselves, th
have the oundation or dierentiation
EXAMINE ALL ASPECTS. Exam
each little touch point that engages (or
bores) your customers. Challenge your
to brainstorm improvements to these
points in ways that are original to you.
like turning up the volume on a great s
Your customers’ experience today will
enriched by the sweet crescendos you i
going orward.
LISTEN AND IMPROVE CONT
OUSLY. I you ask customers how yo
could dierentiate your business, they’l
you exactly what you don’t need to hear.
because their rame o reerence is othe
photographers. It’s when you’re not ask the question that you really need to be
tening. Customers give us wonderul in
into ways we could truly be dierent. I
to you to turn the thought That will ne
work into How can I make that work?
Sometimes ideas will all on the cut
room loor. This challenge o being uni
about using scrutiny and having relent
passion toward dierentiation, all whil
inding the things that will create space
between you and your competition, de
the customers you want to work with,
create a truly unique photography busin
Angela Pointon is the founder of Steel T Images, which offers advice to photograp She blogs at steeltoeimages.com and twe@steeltoeimages.
Diferentiating your businessHow and why a competitive edge benefits you
46 • www.ppmag.com
Living in a space o litt le diferentiation. Living in a space that’s all your own.
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 47/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 48/148
Even though his studio, Abbey Photogra-
phers, has been around since his parents
started it in 1954, Neal Clipper, M.Photog.Cr.,
CPP, is always searching for new marketing
opportunities and ways to distinguish him-
self from the crowd.
One of Clipper’s most successful initiatives
has been bringing photo printers to weddings
and other events. Initially, he printed some
complimentary keepsake prints. As demand
grew, he started offering the service as a prepaid
product. Now, about half of his weddings and
bar and bat mitzvahs include onsite printing.
These events typically bring Clipper two
or three leads in addition to one or more book-
ings. But the visibility this service brings the
studio goes well beyond the additional book-
ings. “The second we hand someone a print,
he or she immediately turns around and shows
it to someone else. It’s instant marketing for
the studio,” he says. To maximize the oppor-
tunity, the studio’s website and ordering and
contact info go on the back of every print.
Clipper collects charges for the service in
advance of the event. For weddings, he sends
two photographers to shoot the event (one
for posed shots, the other for photojournalis-
tic coverage), and another two-person team
(photographer and assistant) to photograph
every couple upon entering the reception. He
prints some images taken by the first team as
keepsakes for the wedding party and the
images of the guests as wedding favors. For
corporate events and other gatherings, a
two-person team can photograph the atten-
dees and operate the printer.
The setup includes either the Mitsubishi
CP-9810DW or CP-70D printer (the CP9810
is bigger with a larger paper capacity, the
CP-70D is more portable), Nikon DSLRs,
Sony Vaio laptops, and a Dynalite 1000
power pack with two light heads modified by
Westcott soft boxes. Clipper and team
in both raw and JPEG formats, saving t
raw files for the archives and printing fr
the JPEGs. For some events, he project
images onto a large screen to increase in
est among the guests.
For photographers looking to brea the onsite printing market, Clipper su
gests doing the work gratis for a few c
to work out a system and build referra
your onsite printing goes over well, yo
got instant referral cards circulating in
marketplace.
“A lot of photographers are stuck in
mindset that they don’t want to hand
something out for free,” says Clipper.
have to get away from that way of thin
This is an opportunity to offer someth
different, to separate yourself from th
pack. And if you get paid a reasonable
up front for the service, it provides a g
revenue stream as well.” I
See more from Neal Clipper at abbeyphotographers.com.
Handing out memories
BY JEFF KENTPROFIT CENTER
Neal Clipper generates buzz, and biz, with onsite prints
48 • www.ppmag.com
Giving guests complimentary prints at the
generates excitement and maximizes refe
All images ©Abbey Photographers
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 49/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 50/148
Many of the oceanfront hotel properties on the
Hawaiian island of Maui are so beautiful that
guests find it hard to leave their cozy confines.
Maui-based photographer Brian Ross says it’s
a shame not to explore all the island has to offer.
For years, Ross had carved out a nice living
as a destination wedding photographer. Even
though his high-end photography received rave
reviews from clients, Ross felt an entrepreneur-
ial gnawing to launch another kind of busi-
ness. What did Maui need? he asked himself.
Ross came up with an idea for a brand
new niche in the tourism trade, and he
began canvassing his network of Maui hotel
concierges for feedback on the plan. Do it,
was the consensus. And with that encour-
agement, Ross launched Photo Safari
Hawaii and began offering tours in 2008.
ECO-PHOTO TOURS
Ross hit the ground running in the promo-
tion of his authentic eco-photo tours. “For
vacationers looking for something unique, I
show them the real Maui, the soul of Maui.
My goal is to create a nature experience
through photography,” Ross says.
In addition to making face-to-face sales
calls and launching a website, Ross hired
guides who exhibited the same passion he
had for both photography and nature. These
guides would lead tours of Maui as well as
all the major Hawaiian islands.
With inquiries from curious website visi-
tors and support from the concierge commu-
nity, Ross’ full-day, half-day, and multi-island
eco-photo tours began to look like a business
enterprise with staying power. Ross had dis-
covered an audience of vacationers hun
for photographic tips from a seasoned
fessional. These tourists would learn ph
graphic insights that would last a lifetim
they toured the state’s magnificent trov
volcanoes, tropical rain forests, waterfa
beaches, fishing villages, and sea caves
THE JOURNEY BEGINS
A tour with a Photo Safari tour guide b
with curbside pickup service at guests’ h
Ross or a team member arrives in a wh
SUV with Photo Safari’s palm tree logo
emblazoned on the side. This heavy-du
transportation is what’s needed for off-
trips to Maui’s hidden photographic ge
On a glorious 80-degree day in Nov
ber, two guests from Minnesota were g
by Ross and the sound of Hawaiian sin
Israel “Iz” Kamakawiwo`ole playing on
car stereo. The song playing that morn
“Over the Rainbow,” would be prophet
what lay ahead.
This was the Photo Safari full-day R
Hana tour, a 140-mile roundtrip trek to M
eastern tip. Ross pulled back the curtaiMaui’s historical and geographical high
The 45-year-old native of Philadelphia
recounted chapters from his own photog
adventures, some of them in the music
industry, such as rubbing elbows with
Beyoncé, taking a portrait of Ray Char
a jazz festival, and composing images o
Taj Mahal on a trek astride a camel.
Spend any time with Ross and you’l
his passion for photography and Maui’
environment contagious. He says Haw
vowel-drenched vocabulary is somethi
can relate to. Take the name Hawaii: th
means breath, wai is water, and the fin
the unity of breath and water. One of R
first lessons for these guests began with
about the meaning of the word “photogr
A business niche in Maui
BY TIM COTRONEOPROFIT CENTER
Entrepreneur photographer Brian Ross goes on safari
50 • www.ppmag.com
©J ud
yG r und t ner
Brian Ross perches on the running board of a Photo
Safari Hawaii SUV as nature supplies a rainbow.
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 51/148
The third-grade teacher in the group was
correct when she said, “Writing with light.”
LOCAL PARTNERSHIPS
If photography and nature rank first and
second in the Photo Safari priority list, then
food is third. For Ross’ guests, that trans-
lates into sampling fine local treats like
mango bread, passion fruit, and pineapple
coconut ice cream.
Among the unique food stops during that
day’s tour was Coconut Glen’s Island Reme-
dies stand, which Glen Simpkins operates
from a bamboo hut just outside Hana. Inside
the funky roadside hut is a New England
culinary-trained chef scooping original-
recipe coconut milk ice cream into freshly cut
coconut bowls. Meeting entrepreneurs like
Simpkins in the middle of seemingly nowhere
is part of the unique added-value formula Ross
envisioned when shaping his business plan.
WONDERFUL WORLD
More than once during the tour, Ross spoke
of his belief that life is more about the jour-
ney than the destination. This proved true
when he suddenly pulled the SUV onto the
shoreline of a volcanic rock beach.
Ross grabbed his Nikon D3 camera and
encouraged his guests to follow. On the hori-
zon a rainbow was beginning to form. The tour
guests got shots of the rugged beach landscape
as a second rainbow began paralleling the
first. Looking at his guests, Ross said, “This is
the best part of my job. Every day is different.”
As they all climbed back in the SUV to head
home, Iz sang his version of “It’s a Wonder-
ful World.” The lyrics connected organically
with the photographic moments that h
just transpired.
The tours are only the beginning of
Ross and his team anticipate for 2013.
will continue to conduct photography w
shops, and Ross is jazzed about his new
enterprise, Extraordinary Adventures
Hawaii, which will offer guests experie
such as dolphin encounters, surfing les
and volcano hikes.
If life is more about the journey, the
there is no end to what Ross’ beloved
Hawaiian Islands can offer tourists sea
ing to write with light and more. Louis
Armstrong may have been thinking ab
Hawaii when he sang, “What a wonde
ful world.” I
Tim Cotroneo is a freelance travel write from Lino Lakes, Minn.
Leave the baggage. Take the power.
photogenic.com | 800.682.7668
Ask About Our$25 Rebate
The NEW PHOTOGENIC ION…LITHIUM-ION PURE SINE WAVE INVERTER You never have all the luxuries of the studio when youshoot off-site. But now you can lighten your load with ahighly compact and portable power supply. Compatiblewith most monolights, produces over 1,000* flashes andrecharges quickly. A standard USB port, LED power monitorand dual 3 prong AC outlets provide maximum versatilityon any budget. Portable power wherever you need it!
*Based on performance of 320 WS Monolight per charge.
March 2013 • Professional Photograph
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 52/148
10” x 10“ ............$14.49
11” x 14” ............$18.69
12“ x 18” ............$21.9916” x 20” ............$25.29
16“ x 24” ............$31.49
20” x 24” ............$32.99
20“ x 30” ............$39.49
24” x 30” ............$43.9924” x 36” ............$54.99
30” x 40” ............$60.49
www.photonovelty.com1-800-844-5616 ext. 714
Contact us today and setup
your free account to accessthese wholesale prices!
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 53/148
Roll Up Floor ®&30)5XVWLF%RDUGV
%RQQLH0DWDVVD
)UHHGRP&ORWK ®&30(VWHOOD
6ROLG5RFN3KRWRV
:::'(11<0)*&20
MANUFACTURING CO., IN
:::3+272129(/7<&20
Whether you need 1 or1,000 this is the place!
Otter Box® BrandiPhone Cases iPad Cases
Kindle Cases
$1'08&+025(
0HWDO6KDSHV
Photo Statues
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 54/148
My wife has been through two expensive
toasters in two years. The first was a trusted
American brand. It was a four-slicer, but
after just a few months, it could toast only
two. Next she tried a well-known European
brand. Same song, second verse. Both
brands are now made in China. An online
search for toasters made in the U.S.A. pro-
duced the name of a man who rebuilds
toasters made decades ago and promises
years of trouble-free service. Without hesita-
tion, my wife paid a premium to get one.
What do toasters have to do with fine
portraits? Everything. Buyers are frustrated
with products that do not satisfy, do not
function, and do not last. This presents an
opportunity to distinguish yourself with por-
traits and service that don’t merely satisfybut
delight your clients for years and make them
loyal to your brand.
8 STEPS TOWARD QUALITY
Here are eight ways to appeal to clients who
are looking for quality.
1. Be an expert.Excellent portraits are cre-
ated in large part long before the click of the
shutter: The photographer has chosen the
location that best suits the subject, time of
day for the best light, style that fits the client’s
decor, and composition that lends itself to wall
display. These are key pre-session elements that
require communicating with clients to dis-
cover their taste and desires and then guiding
them in making the best choices. Insist on the
important things. Don’t take shortcuts. Your
expertise will show in the finished portrait.
2. Make your clients look good. It’s what’s
most important to them. Look for their best
features as well as those you should hide or
minimize. Use posing, lighting, and camera
angle to the best advantage for the subject. If
you have to tell clients you can “fix” some-
thing in Photoshop, they’ll lose confidence
in you and discount the value of your work.
3. Keep it classic. A trendy portrait with
the latest clothing styles and an edgyback-
ground will go out of style and become a
purchase that clients regret. They won’t invest
in your brand again. You canmake classic por-
traits vibrant and contemporary.
4. Emotions sell portraits. Donald Jack,
M.Photog.Cr., a fine portrait artist and
instructor, teaches ESP—expressions sell
portraits—and I’ve amended that slightly.
Your portrait will be cherished because it
captures the personalities of the subjects and
their relationships with each other. People
buy portraits of people they love. Capture
that love and you will capture their hearts.Put your clients at ease. Interact with them
and allow them to interact with one another.
5. Protect your brand. Fail to deliver high
quality in any area, and you’ll hurt your
brand. There’s an apt saying: Big things
make it, small things break it. You might
have a beautiful setting, gorgeous light, and
wonderful expressions, but the client might
see only the one small detail she doesn’t like.
Address that detail for her, and you will earn
her trust, her loyalty, and her referrals.
Months after their purchase, those broken
toasters were not under warranty. My por-
traits are. I will retouch, revise, or remake a
portrait for any reason at any time. It repre-
sents a small cost to me and allows my
clients to buy with confidence.
6. Details, details, details. Do you o
variety of attractive finishes and a prot
coating? Beautiful presentation option
Archival reproduction? How do you pa
your work for delivery? Elegant details
your work apart, increase the perceived
value of your work, and build your bra
Make these family keepsakes with the b
of everything.
7. Exceed expectations. The electric
pany is reliable. The gas station makes
available 24/7. These things do not ins
my praise or my referral because they are
I expect. Consumers expect photograp
to make images. What can you do beyo
making pictures? Plenty, and at every s
the transaction. You can provide expert
ning suggestions on your website; prod
guide on decorating with portraits; kno
best outdoor locations for portraits; acco
date those with special needs; provide ho
ality in your studio; shoot at the client’s h
give dynamic presentations of the imag
and so much more. A high-quality port
the sum of everything that leads to it.
8. Follow up. Shortly after clients bosession, they get a packet of helpful info
tion, examples of my work and design
and testimonials from previous clients
do I get those testimonials? I simply ask c
to tell me how everything looks. I get a
great testimonials, and if there’s a comp
I pursue a remedy until the client is mo
than satisfied. One of the best reasons
low up with your clients is simply that
businesses do not.
Quality is the sum of all your clients
ceptions about you and your product. S
the opportunity to provide something
businesses do not. A quality product be
quality client. I
Thomas Fallon Photography is in Southland, Maine (thomasfallonphotography
Whatever happened to quality?
BY THOMAS FALLONPROFIT CENTER
Superior products earn lifetime clients
54 • www.ppmag.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 55/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 56/14856 • www.ppmag.com
D.B. Walton
Palmyra, N.Y.
PROFIT CENTER: MY STUDIO
BY D. BRENT WALTON, CR.PHOTOG., CPP
After having owned a studio in the San FranciscoBay area for eight years, I relocated to Palmyra,N.Y., in 2009. There, I bought a 1.8-acre estatealong with a commercial building a quartermile down the street that I intended to use asa studio. The estate has a historic 178-year oldcolonial mansion, large parking area, cottagewith greenhouse, a garden, stone walls, andmore than 50 mature trees. Frustrated becausethere were leases in the commercial buildingthat had to be honored, I turned the cottageinto an interim studio. The new studio workswell, perhaps better than the commercial building
would have. It’s separate from the house andyet close enough that I can quickly tend topersonal matters between clients.
The cottage was built around 1920 as acabana house to store swimming poolequipment. The estate is located in downtownPalmyra in the village’s historic district.
This part of the cottage camera roomhas a U-shaped track for muslin backdropsplus eight straight rails for scrims and otherbackdrops. Main and fill lights are on lightstands, and ceiling-mounted studio lightsprovide hair accents and light the backgrounds.The far wall and door retain their original colors
for a grungy, textured background option.
The mansion’s tavern room serves as aclassroom as well as our sales and projectionroom. People love the atmosphere of thisrecreated 19th-century public house.
Old doors, some with particularly interest-ing textures, are attached to the back wall of ourstorage building for use as backgrounds. Thebuilding is 10x14 feet and holds foam wall propsand wardrobe (which includes black shirts insizes up to 3X for clients who forget ouradvice during the wardrobe consultation).
Down the street from our studio is this
narrow pedestrian alley that I love. The sunnever makes it all the way down the walls sothere is always soft, warm light. There arelots of little areas like this within a fewhundred yards of my studio doors.
Here I am (and again and again!) in thecottage’s office, which was remodeled afterwe purchased the property.
1
2
3
4
5
6
©R ob er t S t eer e
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 57/148March 2013 • Professional Photograph
3
5
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 58/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 59/148March 2013 • Professional Photograph
Professional Photographer P R E S E N T S Products, Technology, and Services
What I like Kevin Jairaj says out-source what you can
What makes your workflow flow?
One thing I learned while working o
my business degree was to outsourc
whenever it made financial sense. I
I expect to create a luxury brand
based on stellar images and cus-
tomer service, I cannot be behind t
computer 15 hours of every day. I
outsource my editing, specialty re-
touching, and album design. This
ensures that I have plenty of time t
grow my business, meet with client
and network with vendors.
When you’re working on location, what’s your most valuable piece of
gear? My Profoto BatPac portable
power source. I can take it anywher
and power up lights, fans, and othe
accessories all day long.
Has a piece of equipment ever
changed the way you approach pho
tography? The Canon EOS-1DX
camera. I can shoot in some very low
light situations without having to a
flash. I recently shot part of a recep
tion at ISO 10,000 and was amaze
IMAGE BY KEVIN JAIRAJ
KJIMAGES.COM
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 60/148
THE GOODS
FEEL LIKE A KIDBring out your clients’ inner child with these jazzy reel viewers featuring your
images. Each reel holds seven photos that can be enhanced with 3-D text and
effects. These are charming for displaying photos of the newly married couple on the
tables at the reception. Order a single viewer and reel or multiple sets at a volume
discount. Image3D, from $24.95 for one viewer with reel, image3d.com
60 • www.ppmag.com
TIES THAT LEGALLY BINDPhotography is exciting work, but it remains a business
fraught with realities such as lawsuits, divorces, and
bounced checks. The Complete Legal Wedding Contractwill protect both you and your client by plainly expressing
the expectations of both parties. This contract won’t
guarantee a complication-free wedding day, but it will
ensure all parties understand the terms, details, and payment
requirements. Design Aglow, $150, designaglow.com
ROUNDUP BY ROBYN L. POLLMAN
S’wonderful
W ow your wedding clients
DRIVE TO SUCCEEDWith the ease of use and large
capacity of USB drives, they’re
growing in popularity for file deliv-
ery. Enhance these 8GB or 16GB
drives with one- or two-sided
custom engraving of your logo, the
client’s name, or the memorable
date. Make the presentation even
more distinctive with a personalize
USB case featuring a fabric,
leather, or photographic print cove
White House Custom Colour,USB drive from $13.50 (add $2.50
for engraving), USB case $22,
whcc.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 61/148
RECLAIMED AND FRAMEDLoktah’s eco-friendly reclaimed barn wood
frames have two panes of glass to displayyour beautiful deckle-edged prints in a unique
fashion. They are available in weathered gray
and brown in sizes from 8x10 to 24x36 inches.
Framing service is included with the purchase
of a print. Loktah, $32.70 to $159, loktah.com
March 2013 • Professional Photograph
ALBUM SIMPLICITYWouldn’t you love to sell just one album that
pleases every client? Miller’s Signature
Album allows you to create custom variations,
from an affordable family album to a high-end
wedding album. Favorite selections includewraparound covers, photographic or press
paper, up to 50 pages (100 sides), thin or
thick pages, and easy-to-use complimentary
design software. Miller’s Professional
Imaging, from $90, millerslab.com
MAKE IT STICKMagnet Select Cards make lovely save-the-date wedding
reminders. A flat, bifold, or trifold card can be ordered with a
magnet attached by a glue dot. The magnet can be removed
easily and placed on the fridge as a constant reminder. The
cards are available in any of the company’s Premium Press
Papers, and use of design templates is free. Simply Color
Lab, from $1 per card, simplycolorlab.com
Image ©Marc Anthony Photography
Template ©Ashe Design
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 62/148
I admit that when I first heard about the
touch-screen Sekonic LiteMaster Pro L-
478DR meter for photographers and video-
graphers, I passed it off as a marketing
gimmick. Touch screen? What’s the point?
After using the L-478DR, I soon realized
how wrong I had been. The touch-screen
feature is nice, but more important, the
technology built into the meter is amazing.
The L-478 meters fall between the L-358
and the L-758 in the Sekonic lineup. There
are two meters in the L-478 series, the L-478D
and the L-478DR. The principal difference
between them is the PocketWizard transmit-
ter built into the L-478DR: The functional-
ity it enables with PocketWizard-compatible
flash units sets this meter apart from all others.
The L-478s are the first with touch-screen
controls. The 2.7-inch screen, although
and clear enough for information displ
too small for users to make sweeping fi
gestures. To change settings you tap or
and hold. The screen is responsive to li
pressure and the selections change qui
The screen’s brightest setting, the defau
good in the studio but is insufficient fo
outdoors in sunlight.
THE GOODS: PRO REVIEW
More than a touch-screen gimmick, the SekonicL-478DR meter gives you dynamic control.
BY STAN SHOLIK
Magic touchSEKONIC LITEMASTER PRO L-478DR
62 • www.ppmag.com
Once you set up a lighting ratio with the meter from the subject position, it takes only seconds to adjust the lighting ratio from the camera using the met
the first exposure I switched the fill light off by deselecting its zone in the power control screen (left). Turning the fill light zone on and setting the slider
fill light to one stop under the main light produced a 2:1 ratio (center). Moving the slider to set the fill light to the same exposure as the main light produc
1:1 ratio (right). The range of adjustment using the meter is +/-3 EV in either 1/2 or 1/3 EV increments.
A l l i mages©S tanS h ol i k
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 63/148
The brightness limitation might be a com-
promise made to extend the power of its two
AAA batteries. The use of small batteries con-
tributes to the meter’s compact size (2x5x1
inches), but I’d be OK with a larger unit if,
like the L-758 meters, it was powered by a
CR123A lithium battery and had a brighter
display. With the user-selectable display
dimming and the meter power downtimes, I
had no battery drain problems when I used
Energizer Ultimate lithium AAA batteries; a
battery power level icon is always visible dur-
ing metering. The meter takes a few seconds
to power back up after it shuts itself off, so I
set the display to remain on until I manually
powered off the meter. The Energizer bat-
teries lasted about four hours in this mode.
Both incident and reflected light readings
are available with the L-458 meters, but the
5-degree reflected light receptor is an
optional accessory, not built-in as it is with
the L-758 meters. The built-in incident light
lumisphere retracts into the top of the unit
for metering lighting ratios, copy work, or
illumination levels.
As with the L-758 meters, Sekonic rec-
ommends calibrating the L-458s to your
cameras with the free Sekonic DTS calibra-
tion software (See “Dynamic Ranger,” Pro-
fessional Photographer, October 2012). You
can calibrate without the reflected light attach-
ment by entering the incident light values into
both the incident and reflected light boxes in
the software. (An updated xRite ColorChecker
Passport for calibration is pending.)
The L-478D and L-478DR models have
three ambient light modes for both photog-
raphy and videography. The L-478D has
four flash measuring modes; the L-478DR
has six. The ambient light modes allow you
PROS
Touch-screen accessand navigation
Ability to measure everyimaginable ambient, flash,
and video situation
Wireless power controlfor all PocketWizard
ControlTL-compatibleflashes
Calibration to eachcamera’s dynamic range
Compact size
CONS
Screen difficult to readin bright light
Poor battery life if displayremains active
March 2013 • Professional Photograph
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 64/148
to set a shutter speed then meter for the
aperture, or set an aperture and meter for
the shutter speed. The third ambient light
option allows you to set both shutter speed
and aperture and meter for the ISO setting.
Videographers can choose from the HD
Cine mode, which displays f/stop value for
input shutter speed, ISO sensitivity, and
frame rate (f/s); the Cine mode, which dis-
plays f/stop value for input f/s, ISO sensitiv-
ity, and shutter angle; or the Illuminance
mode, which displays the brightness value of
the incident light in lux or foot-candle units.
Custom settings allow input of custom shut-
ter angles and frame rates. The default shut-
ter angle setting is 180 degrees.
The four flash modes common to both
meters are cordless, cordless cumulative
(multiple flash), cord, and cord cumulative.
The sync socket is on the bottom of the meter.
The two additional modes in the L-478DR
allow you to remotely trigger PocketWizard-
equipped flash units in single or cumulative
flashes. What sets the L-478DR apart from
other meters and makes it worth the cost
over the L-478D is the ability to control the
power level of flash units connected to Pock-
etWizard ControlTL receivers.
The PocketWizard ControlTL system is
available for Canon and Nikon DSLR cam-
eras and their compatible hot shoe mount
flashes. With an AC9 AlienBees Adapter, it
is also available for Canon and Nikon with
all Paul C. Buff flash units with a remote ter-
minal, including the AlienBees and White
Lightning monolights and the Zeus power
packs, or with the PowerMC2 receiver
PCB Einstein flashes or with the Powe
receiver for all Elinchrom RX flashes.
I tested the L-478DR with my Nikon
and AlienBees, and it is amazing to be a
control your lighting and adjust ratios
metering. Setting up the meter and the
ControlTL units takes a little care, but
instructions with the ControlTL units an
L-478DR manual are easy to follow.
Once all your signals are set up, op
the Radio Triggering or Radio Trigge
Cumulative mode from the measuring
mode selection screen. The gear icon t
you to the power control screen, whic
allows you to control the radio signal
of the flash units in each of three zone
used a main light in zone A, a fill light
64 • www.ppmag.com
THE GOODS: PRO REVIEW
In the measuring mode selection screen (left), ambient light modes are in the left column and flash modes in the right. You can turn off the modes you don
to see. The Tool Box allows you to set filter compensation (center), set up the radio channels, and perform other functions. The power control screen is where
adjust flash output for the three zones (right). Tapping the + or - symbols for each slider gives more precise control than making selections by sweeping your
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 65/148
and a background light in C. From the sub-
ject position with the Lumisphere in its
recessed position, I turned off zones B and C
to meter the main light and then adjusted
the output to the aperture I wanted. After
turning off zones A and C, I adjusted the
fill light. Finally, turning off A and B, I
adjusted the background light level. Turning
on all three zones, I switched to the meas-
uring mode screen and made an average
exposure for the main and fill lights and
set this on my camera. I ended up adjust-
ing only the fill for different ratios, but I
could have adjusted any of the zones from
the camera using the meter. If I had any
doubt of the levels, I could move to the
subject and meter and adjust levels sepa-
rately as I did the first time. It doesn’t get
any easier or more precise than that.
The L-478DR and L-478D are packed
with other neat features. There are 24 filter-
compensation adjustments with additional
room for six of your own. Choosing a filter
automatically adjusts the meter reading for
the filter factor. There is an averaging func-
tion, a contrast function, a mid-tone function,
and the ability to record nine different read-
ings for later recall or averaging.
Despite my initial skepticism, I now
that L-478DR represents the state of th
in hand-held meters for its useful featu
and, aided by the touch-screen interfac
ease of use. I
Stan Sholik is a commercial/advertisin photographer in Santa Ana, Calif.
SpecsSekonic LiteMaster Pro L-478DR MeterTYPE: Digital exposure meter for ambient and flash light
RECEPTOR HEAD: Rotating domed head, retractable for contrast reading
LIGHT RECEIVING: Incident and reflected lightRECEPTOR INCIDENT LIGHT: Convertible to flat diffuser
RECEPTOR REFLECTED LIGHT: 5-degree viewfinder (separate accessory, $110)
STREET PRICE: $479; Sekonic L-478D is $309
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 66/148
On most location assignments, about the only
thing you can be sure of is that there will be
problems to solve, and many of the problems
will have to do with lighting. Your problem-
solving options are many, but electronic
flash units are the most popular solution.
Hot shoe-mount flash units, on-camera
or used remotely, are lightweight and com-
pact. They provide the versatility of auto-
mated exposure and remote triggering. But
when these flashes don’t have the power,
recycle speed, or battery life for your needs,
you must look elsewhere. The trick is to
choose a solution that also meets your
budget. Compiled below are location light-
ing solutions for such situations. They are
arranged in three groups: powerful on- and
off-camera flash units, portable monolights,
and portable power packs and inverters.
ON- AND OFF-CAMERA FLASH
These lights are similar to hot shoe flash
units but with enhanced features. They’re
especially popular with event, wedding, and
location portrait photographers, but their
light weight and excellent portability are
useful for fieldwork in other specialties.
Rather than attaching to the camera hot
shoe, most are recommended for use with a
camera bracket or light stand.
With the price marked down from
to $180, the Adorama Flashpoint 400
Battery Powered Flash Kit is the barga
this group. The flash is shaped like an old
flashbulb head with a handle—a large
tor over a cylindrical body—and is desi
to mount to a light stand. A separate p
holds the rechargeable 12-volt nickel m
hydride battery in a metal case. A radio
transmitter and receiver are available a
sories (adorama.com).
In 2012, Lumedyne celebrated its 2
year of providing location lighting for p
tographers, and the lineup is extensive
Signature Series flash heads are all me
while the Next Generation series is ligh
weight ABS plastic. Both series are ava
with either an 800 watt-second (Ws) o
2,400 Ws flash tube. Prices range from
$400 to $525 for the heads. Three seri
power packs are available, each with ou
of 200 Ws and 400 Ws. Prices range fr
$900 to $1,200 without batteries. Bat
are $200 to $700 (lumedyne.com).
Norman lighting products were firs
introduced 50 years ago, and the comp
line of rugged 200 Ws and 400 Ws poflash kits is still evolving. The latest add
are the A200CR and the A400BR-M,
include PocketWizard transceivers in the
Along with the compact stand or brack
mounted head and separate power pac
kit includes two batteries, a 5-inch refle
charger, and strap for the battery pack
Street price is about $1,500 for the 200
kit, $1,765 for the 400 Ws kit with a m
ing light in the head. Basic kits are also
available in both lines starting at $1,25
wide range of accessories is available fo
Norman portable flashes (normanlights
Photographers are familiar with ma
Photoflex products but may be surpris
learn of the TritonFlash kit. With a 30
power rating, the TritonFlash uses a lig
THE GOODS: LIGHTING
You can go far with the right location lighting,free of AC limitations and coils of cable.
BY STAN SHOLIK
The power to goLOCATION LIGHTING
66 • www.ppmag.com
Adorama Flashpoint400 w/s BatteryPowered Flash Kit
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 67/148March 2013 • Professional Photograph
weight and environmentally friendlier lithium
ion battery rather than the more conventional
nickel metal hydride and lead acid batteries
found in other packs. The stand-mountable
head comes with a removable 7-inch reflec-
tor. The battery charger functions as an AC
power converter, allowing the unit to run
from 100-240 volt AC power when avail-
able. Street price for the kit is about $1,275.Other kits, some including Photoflex light
modifiers, are also available (photoflex.com).
Now in its 35th year serving photogra-
phers, Quantum Instruments produces three
lines of flash heads—the Qflash Trio QF8,
the Qflash Q5dR , and the Qflash X5dR — as
well as associated batteries, all manufac-
tured in the United States. These flash units
are compatible with nearly every camera’s
automatic exposure system and with many
TTL exposure systems, either on their own
or in combination with other Quantum acces-
sories. The hot shoe mount Trio includes
Quantum’s FreeXwire transmitter that pro-
vides control over any number of remote
Qflash units as well as Canon or Nikon
flashes with the appropriate Qlink accessory.
Street price of the 200 Ws Trio and Quantum
Turbo battery is about $1,350. The latest Qflash
X5dR delivers 400 Ws with a recycle time of
3.8 seconds when powered by the appropri-
ate Qpaq-X power module and battery or
Lumedyne and Norman portable packs. Street
price for the X5dR head is about $810, the
Qpaq-X power module is $280, and the high
performance battery is $685. Accessories from
reflectors and diffusers to Quantum’s Fre-
eXwire radio receiver are available (qtm.com).
MONOLIGHTS
Battery-powered monolights are ideal for
location assignments where mobility is not a
requirement, but there is a need to keep
equipment to a minimum and safe from
people tripping over cords. School photos,
group shots, team photos, and even portraits
and engagement photos fall in this category.
Monolights are at least as powerful as the
units above and some have modeling lights
that you can use with the battery power to
preview lighting, at least briefly. Radio
gers are available for all monolights, eit
from the monolight manufacturer or
through third-party sources.
The Flashpoint II series of monolig
from Adorama are designed for both A
DC power. The latest addition, the Flash
DG600 AC/DC Blue, is a 300 Ws mon
with a 7-watt LED modeling light that
can use with battery power. (See “True
page 80.) Stepless flash power is availa
from 1/32 to full power with recycle tim
1.5 to 4 seconds. The price of the head w
the separate portable battery pack dire
from Adorama is $300 (adorama.com
All Bowens monolights, from its 20
Gemini 200Rx to the 1,500 Ws Gemin
1500Pro, are compatible with the rece
restyled Bowens Travelpak control/bat
units. The Travelpak can power two Ge
heads and features a separate control p
and the choice of a small or large batte
This modular system allows you to swa
Norman A400B
Bowens Gemini 2
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 68/148
batteries during a long photo session. A car
charger and AC charger are available for the
batteries that can be charged outside the
control panel. Street prices of the Gemini
monolights range from $450 to $1,310. The
small Travelpak is available for $530 and
the large for $640. A wide range of acces-
sories is available (bowensusa.com).
All Paul C. Buff and AlienBees monolights
are compatible with the third-generation
Vagabond Mini Lithium portable power
pack. The monolights include the 640 Ws
Einstein E640, the AlienBees with maximum
power from 160 Ws to 640 Ws, and the
White Lightning models with maximum
power from 330 to 1,320 Ws. The
Vagabond Mini Lithium consists of a remov-
able lithium ion battery in a Vagabond pure
sine wave inverter, which supplies 120v
power to the monolights. Two outlets are
provided on the Vagabond, but adding a
control strip allows you to connect two addi-
tional monolights. Use of the modeling
lights is recommended for only a very brief
time, but 400 to 500 full-power flashes are
possible with a single 640 Ws monolight
connected. The Vagabond Mini Lithium is
available for $240. Monolights are available
from $225 to $550 (paulcbuff.com).
The Norman Allure DP320 monolight
powered by the lead acid BP320 Battery
Power Supply delivers 320 Ws of location
lighting. The included DC power cable also
allows the DP320 to be used with Quantum
Turbo and Turbo Z batteries. The control
panel allows you to set power to full, half, or
quarter settings. The BP320 supplies enough
power for about 115 full-power flashes. Street
price of the DP320 is about $370 and the
BP320 is about $162 (normanlights.com).
Three Photogenic Studiomax III mono-
lights—the 160 Ws AKC160B, and the 320
Ws AKC320B and AKC320BR—connect to
AC power or the Photogenic AKB-1 battery
pack. The 12-volt lead acid battery in th
AKB-1 provides more than 200 full-po
flashes to the AKC160B and more than
to the 320 Ws monolights. The battery
user-replaceable but can be charged on
the battery pack. The modeling light ci
is automatically disconnected on the m
lights when they are connected to the A
1. The monolights are compatible with
Photogenic accessories. Approximate s
price of the AKC160B is $290, the AKC
is $320, and the AKC320BR with bui
radio trigger is $350. The AKB-1 battery
including battery, battery case/charger
ing, soft case with belt clip for protection
unit, soft case shoulder strap, and wall ad
has a street price of about $165. Additi
batteries are $60 (photogenic.com).
PORTABLE POWER PACKS
AND INVERTERS
Major production assignments on loca
away from AC power require reliable e
ment with enough versatility to cover a
eventuality the client or art director ma
throw at you. Gas-powered AC generat
are an option if noise is not an issue, anexternal power inverters have a place a
but the more common solution is batte
powered packs connected to flash head
This solution is also an excellent option
location photographers who have the b
to invest in the equipment, the time to
up, and assistants to carry, look after, a
pack the equipment when done.
The Explorer 1500 from Bowens pr
vides two independent digitally contro
channels that you can adjust in 0.1 EV
The interchangeable 12 amp-hour batt
provides up to 150 flashes at the full 1,5
Ws, recycling in 3.8 seconds or 180 flas
at 1,200 Ws with 3-second recycling. T
Explorer is compatible with all Bowens
Quad heads and the Bowens Ringflash
68 • www.ppmag.com
THE GOODS: LIGHTING
Paul C. Buf Einstein E640
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 69/148
REDEFINING
VIDEO AUTO
FOCUS FOR
PROFESSIONALS
The new Lumix GH3 is at the leading edge of a new breed of mirrorless interchangeable lens cameras
that’s changing photography for multi-media professionals. Just touch any part of the image on the
articulating OLED screen and it automatically becomes the focal point. You also get advanced AF
tracking and pro-level rack focusing, so you can follow the action with confidence. Just another
way we’re engineering a better world for you. Learn more at panasonic.com/LUMIX
sc r e e n s i m u la
t e d
t R E C
[ A F ]
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 70/148
Additionally, the unit features two Gemini
sockets, which allow connection of two
Gemini monolights. By connecting two
Quad heads and two Gemini 750 units, you
can achieve a total of 3,000 Ws from the
power pack. Street price of the Explorer with
one Quad 3KM head is about $2,795
(bowensusa.com).
Broncolor has recently unveiled a new
battery powered pack, the Move, which is
available in addition to the well-known
Mobil packs. The Move supplies 1,200 Ws
to two flash heads but weighs just over 13
pounds, including the plug-in lithium ion
battery. In recognition of the need for photog-
raphers to shoot video as well as stills on loca-
tion, the Move can supply the new MobiLED
lamphead with power for two hours of con-
tinuous light as well as power for flash expo-
sures when needed. Street price of the Move
is about $5,000, and the MobiLED head
with 30-watt LED modeling light is about
$1,330. The 1,200 Ws Mobil A2L power
pack is still available in two configurations,
with a lithium ion or lead acid battery. It
also powers the MobiLED head. Street price
is about $3,700 (bronimaging.com).
Manfrotto is the U.S. distributor of Swiss-
designed Elinchrom flash equipment. The
recently upgraded 1100 Ws Ranger RX packs
can now be operated by remote control,
either from a computer or the optional hand-
set. With outlets for two heads, the packs
deliver about 140 full-power flashes in fast
recycling mode or up to 3,800 low-power flashes
in slow recycling mode. The battery recharges
in three hours either within the pack or
externally. Street price of the Ranger RX
pack with battery and charger is about $1,725.
The Ranger RX Speed AS offers asymmetri-
cal power distribution, shorter recycling
time, and more flashes per charge at a street
price of $1,835. The standard Freelite S lamp
head has a street price of $600; the Freelite
A head provides a shorter flash duration
with a street price of $790 (elinchrom.us).
Germany’s Hensel Studiotechnik w
first company to introduce professiona
battery-powered power packs in 1996.
Porty name is still retained for the pack
Hensel has recently introduced new Po
packs with lithium ion batteries. The 60
Porty L 600 and the 1,200 Ws Porty L
deliver power to two heads symmetrica
asymmetrically. They weigh slightly m
than 13 pounds each, including the inte
radio receiver and battery. An optional
power unit is available to attach to the in place of the battery for studio use wh
AC is available. Compact EH Pro Mini
heads for the packs are compatible with
full range of Hensel light modifiers. Str
price of the Porty L 600 is $2,765, the
L 1,200 is $3,295, and the Pro Mini sta
dard head is $879 (henselusa.com).
With seven different packs ranging
power from 600 Ws to 1,200 Ws, Profo
the widest range of battery-powered offe
The newest pack is the 1,000 Ws Pro B
1000 Air . With maximum recycling tim
less than one second at full power and a
range of 1 to 1,000 Ws, the Pro B4 has
independent flash head outlets. Recharg
for the exchangeable battery is a mere
minutes, and if AC power is available, t
70 • www.ppmag.com
Bowens Explorer 1500
Broncolor
Mobil A2L
THE GOODS: LIGHTING
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 71/148
www.tamron-usa.com
Picture Perfect. Telephoto That Delivers.
SP 70-200mmF/2.8 Di VC USDEffortless Performance,Outstanding Resolution, A Class Apart.
;HTYVU»Z:7 :\WLY7LYMVYTHUJL ϐTT- SLUZ KLS P]LY ZOP NOYLZVS \[PVUHUK
high performance to cater to the needs of experienced amateurs or professionals who
demand the best standards. Whether you’re preserving a special moment, capturing
the right image to communicate a feeling, or shooting to make a cover photo,
;HTYVU»ZϐTT-IYPUNZWOV[VNYHWOLY HUKJHTLYH[ VNL[OLY PUM SH^SLZZ
unison. Tamron’s proprietary USD (Ultrasonic Silent Drive) combined with VC
(Vibration Compensation) captures action in high-speed without distracting from
the moment—and without camera-shake. This compact, full-size telephoto zoom
lens offers serious photographers the power to capture the moment from afar
while preserving it in high fidelity.
Model A009Di (Digitally Integrated) lens designed for digital APS-C andfull-size SLR cameras, with flower-shaped lens hood.Compatible mounts: Canon, Nikon, Sony*
* The Sony mount does not include VC, as Sony digital SLR bodies include image stabilization functionality. The Sony lens is designated as “SP 70-200mm F/2.8 Di USD”.
Focal length: 200mm Exposure: F/10 1/60 sec IS © S
t e w a r t P o w e r s
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 72/148
battery can be recharged while the pack is in
use. Features abound, including integrated
Profoto Air remote and sync, providing the
ability to control the pack from your camera,
your computer, or with a handheld remote.
Street price is $7,900. The 600 Ws packs
have their own head, the AcuteB, that sells
for $849. The other packs take the standard
Pro head that sells for $2,050. Hundreds of
accessories are available for Profoto equip-
ment (profoto.com/usa).
The Explorer 1500 Digital Portable
Power Supply is the latest power pack from
Speedotron. With two outlets and available
ratios of 1:1 or 2:1, the Explorer can deliver
up to 225 full-power flashes per charge.
Power is variable over 7+ EV, and maximum
recycle time is 3.5 seconds. It will power
modeling lights for 10 seconds at a time
before automatically switching them off.
Street price of the 25-pound pack is about
$1,770. The Explorer is compatible with sev-
eral Speedotron heads, including the $360
basic 103 CC model (speedotron.com).
There is another option for location pho-
tographers, particularly those who have
invested in AC-powered flash equipment
and then find themselves doing location
assignments without a studio. Power invert-
ers convert battery power to AC, and there
are several on the market designed for pho-
tographers. The Paul C. Buff inverter is
mentioned above but is recommended only
for Paul C. Buff/AlienBees monolights.
The Profoto BattPac has two AC ou
and can drive up to four Profoto D1 mo
lights (250, 500 and 1,000 Ws), two P
ComPact monolights (300, 600 and 1,
Ws), or one Profoto Acute2 generator (1
or 2,400 Ws). But Profoto also recomm
it for powering wind machines, charge
refrigerator boxes, and continuous ligh
Maximum continuous power output is
watts and pure sine wave. The street pr
$1,745 (profoto.com).
Although not a manufacturer of ph
graphic equipment, Goal Zero is know
respected among outdoor explorers for
battery packs, power inverters, and solar p
The Extreme 350 Kit includes the Extrempower pack, the Extreme Universal Inv
and a wall charger. The unit has an AC
that delivers 400 watts from the 350 watt
lead-acid battery. There are also 12-vo
USB power ports. Adorama sells the Ex
350 and inverter for about $425. Other
with capacities up to 1,250 watt-hours, m
which are available with solar panels fo
tion recharging, are available (goalzero.co
Stan Sholik is a commercial/advertisin photographer in Santa Ana, Calif.
72 • www.ppmag.com
THE GOODS: LIGHTING
Elinchrom 100 WsRanger RX
Speedotron Explorer 1500Digital Portable Power Supply
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 73/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 74/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 75/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 76/148
As your creative horizons expand, you will
find yourself contemplating your next lens
purchase. If a macro lens comes to mind but
you know you’d seldom use it, consider the
Tamron SP 90mm f/2.8 Di VC USD Macro.
It’s a razor-sharp macro lens that’s as afford-
able as it is portable.
As a portrait photographer, my need for
a heavy-hitting macro lens is limited to the
occasional wedding detail shot, for which
I’ve used Tamron 60mm and Canon 100mm
f/2.8 macro lenses. On a lifestyle shoot last
summer it occurred to me that I could bring
new depth to visual storytelling with a decent
macro lens. But would it be worth the large
investment in a prime Canon macro lens?
Not convinced, I decided to try the mod-
estly priced Tamron SP 90mm f/2.8 Di lens.
With its lightweight plastic casing and rub-
berized focusing ring, it looked less robust
and aesthetically sophisticated than my
lenses. But I noticed that its lens elemen
deeply recessed for protection (if presum
less accessible for cleaning). The lens sh
with a padded drawstring lens pouch a
hood, which are sold separately with ot
lenses. With this lens’s deep recess, the
isn’t necessary in some environments, b
it’s good to have for outdoor shooting a
high-contrast interference. Its pinch-to
lens cap snaps on and off more easily th
others I’ve used. After a few shots, I beg
appreciate the rubber focusing ring, as
enormously helpful in manual focusing
If your macro subjects are primarily
this lens will absolutely deliver. At 90menables plenty of work space to execute
fortably. Its image stabilization, activat
when the shutter is pressed halfway, is
ful in dim lighting when the use of a fla
tripod isn’t practical.
In autofocus mode, the Tamron 90
f/2.8 macro lens is a little robotic and s
to find the focus point. When I’d lose m
patience I’d switch to manual mode, w
is best for optimal sharpness. While it’s
the best lens to capture moving subject
does beautifully with most still life and e
portrait subjects. Its impressive clarity is
attained with a bit of patience; the smo
movement of the focus ring allows you to
your macro focusing skills with practic
To achieve desirable depth of field w
THE GOODS: PRO REVIEW
Tamron delivers sharp and creamy images at a budget price.
BY CATE SCAGLIONE
Closer to fineTAMRON SP 90 MM F/2.8 DI VC USD MACRO 1:1
Though it’s not a glamorous image, this photo of an uncleaned ring on glass reflecting pearls demon-
strates how the lens can create an image that’s simultaneously sharp, creamy, and crisp .
76 • www.ppmag.com
ate Scaglione
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 77/148
Welcome to the new Animoto!
More awesome videos. Whole new look.
40+ HD and unbranded
video styles
Pro-exclusive video styles
co-designed with:
TAMARA LACKEY,
VANESSA JOY & ROB ADAMS,
VICKI TAUFER
NOW FEATURING
Use multiple songs
in your video
Triple Scoop Music
2,000 music tracks
20-minute maximum
per video
Experience the whole new Animoto.ANIMOTO.COM/PHOTOGRAPHY
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 78/148
macro, you need to use a fairly small aper-
ture. With most macros, diffraction is the
main issue, as the captures get soft when
stopped down. It handles flare well unless
you’re shooting into the sun. Chromatic
aberration was not an issue. I saw no distor-
tion or vignetting at any working distance
with the lens on my full-frame Canon body.
I am not a tripod user in my portrait
work, but I did test the lens in a variety of
circumstances. I placed a well-worn engage-
ment ring on a highly textured background
so I could evaluate the lens’s depth of field
and bokeh capture, and more important, the
degree of sharpness it attained. It did not
disappoint; I saw the diamond’s scratches,
flaws, and even specks of dirt invisible to the
naked eye. I checked its performance in low-
light shooting at f/11, still relatively wide open
for a macro shot, evaluating focus, fall-off,
and overall softness. The reflective surface
allowed me to look for surface scratches (as a
measure of sharpness) and examine the
bokeh effect (from the pearls reflected onto
the glass). The image is by no means glam-
orous, but it demonstrates how this lens can
be sharp, creamy, and crisp all at once.
As sharp as the images are, the bokeh is
equally beautiful and buttery, so I tested the
Tamron as a portrait lens. Shooting in my
typical wide-open style, it achieved beautiful
results, but it required putting substantially
greater distance between photographer and
subject than when I use a prime portrait
lens (e.g., 85mm or 50mm). Stopped d
far, this lens is perhaps too sharp for so
complexions, but its versatility for port
was a delightful surprise.
FINAL EVALUATION
Is it sensible to invest in a third-party-m
lens? You could argue against it on the
that it could quickly become outdated
camera-maker changed the body’s elec
design. But then, Tamron offers a six-y
warranty on the SP 90mm f/2.8 Di VC
macro lens, five years more than Canon
on a new macro lens. And while a third
party lens might not have the best resa
trade-in value, this lens’s price tag of $
(almost half the price of the new Canon
100mm macro) alleviates my concern.
Cate Scaglione is co-owner of Je Revele Fine Art Photography, a multi-service fine art studio she co-owns with busine partner Natalie Licini.
THE GOODS: PRO REVIEW
In a wide-open portrait shooting style, the Tamron SP 90mm f/2.8 Di VC USD macro lens yields b
tiful results. This image was captured at f/11 for 1/80 second. Stopped down too far, the lens coul
more sharp than you would like for most complexions.
78 • www.ppmag.com
PROS
Razor sharp
Functions well in low lightthanks to vibration control
Lightweight and portable;a perfect travel companion
Smooth manual focusing
Beautiful for portraits
CONS
Slow autofocus
Hunts for focus
Not great for macros offast-moving subjects
Deeply recessed for protection,lens could be hard to clean
©Cate Scaglione
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 79/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 80/148
You no doubt know Adorama as a retailer of
photographic gear but probably not as a
manufacturer of lighting equipment. Tech-
nically it isn’t, but its Flashpoint lighting
division has been part of the company since
the late 1980s. Originally a sales and rental
arm, it’s grown to become a distributor of
low-cost monolights and light modifiers sold
under the Flashpoint brand.
The Flashpoint DG600 300 W/S AC/DC
Blue Monolight is well suited for both indoor
and outdoor work. Slightly lighter and smaller
than the similarly powered Flashpoint
620M II monolight, it’s probably more
rugged due to the rubberized layer covering
its metal frame. The LED modeling array is
definitely more shock resistant than the
tungsten bulb modeling light of the 620M.
The handle on the back of the flash provides
a bit more room for large hands.
There are big differences in the con
layout as well. A large LED has been a
for viewing the power setting at a glan
tenth-stop increments on the EU scal
where 300 watt-seconds (Ws) equals
and stops are measured in whole num
(e.g., 5.6 yields a full stop less output t
6.6). Output levels are set with a rotat
knob, and the power setter (AC, Off, D
a rocker switch. All other controls are
THE GOODS: PRO REVIEW
Adorama releases an economical location light with consistent flash-to-flash performance.
BY ELLIS VENER
True blueADORAMA FLASHPOINT DG600
300 W/S/AC/DC BLUE MONOLIGHT
I used the accessory Flashpoint DG battery pack to power the single Adorama Flashpoint DG600 monolight to capture “Flight Instructor.” It was a dark a
stormy day with shafts of sunlight occasionally stabbing through the scudding clouds. To emulate that effect, I wanted a hard, crisp light, so I pointed it d
at the plane and used only the standard 8-inch reflector with no diffusion. I triggered the flash using PocketWizard MultiMax transceivers.
80 • www.ppmag.com
©Ellis Vener
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 81/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 82/148
membrane-covered push buttons labeled
with icons rather than words.
The sync cable connection is sized for
mini-phone jacks. On the front end, reflec-
tors and speed rings mount via locking bay-
onet. The combination stand and umbrella
mount is lightweight but serviceable for
soft boxes up to 36x48 inches.
Good news: At any given output set-
ting, the DG600 is consistent from flash
to flash in real-world use, which is not
necessarily true of all low-cost monolights.
Recycle times are mercifully short, even
at full power. The bad news is a little more
complicated.
Flashpoint claims the DG600 has a
six-stop power range, but in my tests the
actual range was 7.4 stops—both a good
thing and a bad thing. Having more range
means greater versatility, so that’s good.
But because of its EU scale, when you’re
setting the output, you’d expect that reduc-
ing the power from 6.0 to 5.0 would lower
the output by one full stop; nope, it reduces
power by 1.4 stops. On the other end of the
range, the change from minimum power,
1.0, to what should be one stop brighter is
also actually 1.4 stops brighter. In the mid-
dle range, a 1-stop change is actually 1.2
stops. You can create a cheat sheet, but my
advice is to use a flash meter, especially
when using multiple lights.
My tests over the entire output range
with the grayscale panels of a Datacolor
SpyderCheckr target showed a color shift
of -800 degrees, which is typical of many
flashes that reduce voltage to achieve dif-ferences lower than maximum output.
Reducing discharge voltage also length-
ens flash duration. While the claimed flash
dura tion range of 1/1,500 to 1/800 second
seems plausible, there’s no tool available
to verify it.
While these findings look dire on paper,
they’re fairly consistent with other low-cost
monolights and even some of the much
more expensive models. The problems are
rooted in the way the monolight reduces
output power. The DG600 reduces output
(watt-seconds) by lowering the voltage
(energy) of the electric current going to the
flashtube. The result is warmer light and
longer flash duration as the output is
dialed down.
The use of an LED array as a mode
light is interesting. LEDs are far more
cient, cooler to the touch, longer lastin
and less fragile than the conventionall
used tungsten and quartz-halogen bu
As there’s practically no heat generate
the modeling light array of the DG60
the end of the shoot it’s cool enough t
much sooner than most monolights. T
LED array occupies almost the entire
reflector plate behind the flashtube, so
accurately matches the flash’s beam p
tern. The downside is that once you fa
in soft boxes, umbrellas or other light ifiers, and typical light-to-subject dist
for portraits, at a 7-watt maximum (ab
equivalent to a 50-watt tungsten light
just isn’t bright enough to be anything
minimally useful.
It sounds like I’m pretty down on t
Flashpoint DG600 monolight but onl
comparison to the heavier duty, more
expensive lights I usually use. For som
just starting to use flash, they’re a goo
buy: rugged yet affordable, quick recy
fairly quiet, lightweight, and small.
Consider its ability to use either a ligh
weight rechargeable battery pack or 1
130 volts AC, and the DG600 is a fine
low-cost monolight for shooting both
inside and out. I
THE GOODS: PRO REVIEW
82 • www.ppmag.com
FLASH DURATION
There are two ISO standards for meas-
uring electronic flash duration: t0.5, the
most common, measures the length of
time a flash unit emits 50 percent or
greater of its peak output. If a flash
duration scale is not mentioned
in the flash’s marketing materials,
assume t0.5.
The more precise t0.1 standard meas-
ures all photographically relevant light—
everything above 10 percent peak output
at a given setting. If you are interested in
knowing how well your flash will stop
motion, that is the flash duration number
you are interested in. It is approximately
three times longer than the t0.5 time.
FOUR IMPORTANT FEATURES OF THE FLASHPOINT DG
• The name has nothing to do with its maximum watt-second (Ws) rating:It tops out at 300 Ws.
• It’s blue. Not the light, the body. It’s a bright blue rubberized material overa metal chassis.
• The modeling light is a 7-watt LED array rather than the usual quartz-halogeor tungsten bulb.
• Like other Flashpoint M series monolights, it can be powered by AC or the opF3PPDG battery pack—great for location work.
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 83/148
Your guide to the perfect productsand services, from beginning to end.
Paci¿c AlbumsFlush-mount albums with super-fastturnaround! Get creative with an
ocean of possibilities. Forty-eightmix-and-match cover materialsinclude metal print and photocover options. Now available withcontinuous panoramic pages!
BAY PHOTO LAB
bayphoto.com/pacific-albums
Gallery WrapsFloat Frame Gallery Wraps fromRichmond Professional Lab com-bine sophistication and simplicity.
Each canvas or metallic wrapcomes ready to hang in one of 12solid wood frame styles.
RICHMOND PROFESSIONAL LAB
richmondprolab.com
The SourceThe Source is a perfect advertisingopportunity to get your companynoticed. The Source is the newProfessional Photographer advertorialsection, with prime positioning in themagazine and eye-catching designthat features your company. Contactyour sales rep today!
PROFESSIONAL
PHOTOGRAPHER ppmag.com
Coffee Table BAlbum Crafters’ Coffee TBook is a custom-bound
panoramic modern imagPhotographically printedavailable in a variety of sall Album Crafters’ standmaterials and custom cov
ALBUM CRAFTERS
albumcrafters.com
CustomizablTemplatesCustomizable templates toyour own unique businesstunning album templates, actions to enhance your imand card templates to skyyour print sales. Use codeppmag30 at checkout foryour entire order. Expires
ROCKSTAR EXPOSUR
rockstarexposure.com
Signature AlbFall in love at first sight wMiller’s NEW Signature Aan elegantly simple solutevery client. Choose youoptions (papers, covers, ecreate an album to fit bigsmall budgets alike.
MILLER’S PROFESSION
millerslab.com/signaturea
March 2013 • Professional Photograph
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 84/148
images ©Artistique
Justin and Michelle Stevens play up their brides’ flairfor the dramatic with lighting, posing,
and good old-fashioned sex appeal.
BY STEPHANIE BOOZER
G lamourALWAYS IN FASHION
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 85/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 86/148
Every wedding is a story, a novella of human drraphers Michelle and Justin Stevens are comm
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 87/148
truth of the event as well as their own
artistic expression. Their studio, Artistique,
in Portland, Ore., draws an upscale clien-
tele who seek the couple’s particular brand
of glamour and style.
Vintage-themed weddings are becom-
ing the rage in wedding counter-culture,
according to Michelle, and are hugely
popular in the Portland area. Capturing
the drama of a bygone era is what Artis-
tique is known for. One wedding might
feature groomsmen dressed in 1940s-stylezoot suits and fedoras, boldly poised with
tommy guns, the next a rockabilly bride
with full-sleeve tattoos and cat-eye makeup,
and another a roller derby jammer with
her team of bridesmaids posing rink side.
“Those are the types of clients we love—
the quirky ones,” says Michelle. The
Stevenses’ dramatic shooting style is what
attracted a themed wedding following ini-
tially. “We have a more dramatic look in
our normal work. Once we got some
unusual weddings, we just attracted more
clients who were looking for someone who
could capture the essence of their style.”
PRODUCING GLAMOUR
That dramatic look is the culmination of
the Stevenses’ shooting aesthetic—both
wield cameras—and their commitment to
off-camera lighting. The couple cites
Hollywood’s elegant past as inspiration,particularly the work of George Hurrell,
who is widely regarded as the master of
Hollywood glamour shots.
“His ability to simply capture the soul
is a dying art,” says Justin. “It’s beautiful.”
Michelle also draws on the look of old
black-and-white portraits of young s
lets with their thick-lashed eyes dow
managing to present themselves as b
demure and provocative. “Classic gla
our,” she calls it. She also notes a styl
ebrated in a more recent era: those
glamour portraits once popular at su
ban shopping malls. Though many p
tographers remember those images w
chuckle or a groan, Michelle says the
damental idea of it proved inspiratio
“I loved the fact that you could m woman who normally looks great lo
spectacular with the right lighting an
makeup,” she says. “Most girls are ra
with magazines full of beautiful wom
they wish they could look like. ... I w
our brides to have that feeling about
wedding photos, that they look abso
amazing, better than some thought t
could. That is achieved by controlled
lighting, flattering posing, and some
production magic.”
As you’d imagine, the Stevenses d
travel light. Natural lighting has its p
and they do take advantage of it, but
look to enhance what’s already there.
dings, especially, don’t just happen u
beautiful lighting conditions,” says Mi
“I believe that with so many new pho
raphers coming into the market, the
who stand out are going to be the one
can light beautifully and pose in a flat way—two things that seem to be gettin
Posing is an area where the Steven
grab attention. Their brides often esch
more demure poses for a bit of sex ap
a slight boudoir feel. “The sexier edge
we have in some of our photos defini
March 2013 • Professional Photograph
unfolding at a unique cadence. Wedding photogto telling that story in a way that illustrates the
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 88/148
reflects our philosophy,” says Michelle. “Lots
of girls want to look both beautiful and sexy
on their wedding day, and the guys too. We
love it when couples are comfortable and
want to do some spicier poses.”
Adds Justin, “It’s our job to create some-
thing for them that they can’t get from their
friend, uncle, or neighbor. Helping the bride
feel sexy and beautiful on her wedding day is
important to us.”
COMPETITIVE EDGE
Creating a look that’s dramatic, timeles
and classically glamorous is what fuels
Artistique. The studio’s tagline is “Love
Beauty. Glamour.”
Michelle is also passionate about te
ing and speaking, specifically about ad
lighting, and plans to do more of both
future. “One of my pet peeves in photog
today is young photographers who boa
they only shoot natural light, as if thos
use other forms of light are somehow in
rior,” she says, adding that sometimes
ral light just looks, well, bad. “One thin
learned from the very beginning in sch
that a real photographer controls light, wh
it is natural light, tungsten, or flash. You
to be proficient at all methods of lighti
really give the best service to your clien
Michelle’s photographic education b
when she enrolled in a photography pr
gram at the age of 17. By the time she w
18, she had opened her first retail studi
space and shot her first wedding. It wa
foolish, she admits: “I discovered that w
you learn in school is nothing compare
what you learn in life.”
A native of England, Michelle move with her parents to the Detroit area whe
father brought his robotics engineering
career to America. Due to differences in
countries’ education systems, Michelle
uated high school at age 16. She persev
in the photography program at Henne
Technical College in Minneapolis and c
tinued shooting part-time. After gradu
and a series of moves that took her to t
Pacific Northwest, Michelle met Justin
they moved to Portland in 2003. Justi
been fostering an interest in photograp
and with Michelle’s technical expertise
couple entered the wedding market ful
throttle.
“We shot 41 weddings in our first ye
says Michelle. “It was totally crazy and in
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 89/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 90/148
These days they aim to book 30 to 40
weddings a year, several of which are desti-
nation weddings. Michelle plans to make a
room for a new project, a sort of boudoir pho-
tography for dogs. The Stevenses are absolutely
smitten with their greyhound, Poopsie.
Building a dog portrait portfolio is just one
of the ways Michelle challenges her creativity.
She’s also discovered the thrill of competi-
tion. The Stevenses are members of Profes-
sional Photographers of Oregon, which has
named Michelle state or wedding photogra-
pher of the year multiple times. Last year, the
studio began competing at the national level.
“I love competition,” she says. “I go into
every wedding with the mentality that
we’re going to make a competition prod-
uct that day. It makes me be as creative
as possible. I’m always trying to do better
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 91/148
Built-in Photocell
Built-in Pulsar Radio Trigger for wire-free sync freedo
Solid, ultra-sturdy
metal body for streng
and durability
Travelpak battery
compatible for studio o
location versatility
Well ventilated for long periods of use. No fan necess
Large, user-replaceable professional flash-tube
250W Halogen modeling
lamp. Shape does not
obscure flash-tube
Single, simple dial to quickly control flash power and modeling level
Bowens ‘Global standard’ S-Type
accessory attachment to accept widest
range of reflectors
the little light packed full of featur
bowensusa.com‘Bowens’® and ‘the power behind the picture’® are registered trademarks of Bowens International Ltd.
(SSTVKLSZHUK[LJOUPJHSZWLJPÄJH[PVUZMLH[\YLKOLYLHYLZ\IQLJ[[VJOHUNLHUK^P[OV\[UV[PJL)V^LUZ0U[LYUH[PVUHS3[K†Price shown does not include shipping or any applicable state sales tax and may vary by retai
facebook.com/bowensflashtwitter.com/litebookmag
youtube/bowenstv
The Gemini 400Rx is a compact, lightweight and now includes a built-in Pulsar radio receiver controlled via a simple, single push-button as well as manVUS`MV\UKVUL_WLUZP]LÅHZO\UP[Z;OL7\SZHYYHKPVHSSV^ZM\SSJVU[YVSV]LYKPMMLYLU[YHKPVaVULZ\ZPUNMV\YJOHUULSZHUKZP_Z[\KPVZL[[PUNZWOV[VNYHWOLYZ[VPZVSH[L]HYPV\ZSPNO[ZV\YJLZVYJVTIPUPUN[OLTHUKÄYPUN[OLTHSSH[VUJL^P[OV\[SLH]PUN`V\YJHTLYH
The inclusion of the inegrated Pulsar radio receiver coupled with the versatility of featuring both mains and battery power operation makes the Gemini R[OLTVZ[YLZV\YJLM\STVUVSPNO[Z`Z[LTZHUK[OLILZ[]HS\LMVYTVUL`H]HPSHISL[VKH`
super-value portable l ight ing ki t
;OL.LTUP9_[^PUOLHKRP[PUJS\KLZ!_.LTPUP9_
_7\SZHY;_9HKPV;YPNNLY_¢>PKL(UNSL9LÅLJ[VYZ
_:PS]LY>OP[L<TIYLSSHZ_:\WWVY[:[HUKZ_:`UJ
*VYKWS\ZTHPUZSLHKZHUKTVKLSPUNSHTWZ
7HY[*VKL!)>;?<2
super-value l ight ing deals
7HY[5V+LZJYPW[PVU7YPJL †
)><: .LTPUP9_
)><: .LTPUP9_
)><:.LTPUP9_/LHK2P[
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 92/148
at each wedding than I did the last one.”
The studio’s main area of competition is
also the one Michelle finds the most diffi-
cult: albums. “Albums are so much harder
than a single image because you have to
take a whole wedding and produce this
fluid story with stellar images at each point
in the event,” she says. “That’s really what
keeps me motivated.” Michelle is often a
state competition judge herself and loves
the feeling of being on both sides of the
judging table.
“We’ve won Album of the Year five years
in a row. Now the pressure is so much worse
because people expect a win. We have to be
that much more creative every year.”
Michelle credits her recent competition
entries with a dramatic increase in the album
quality that Artistique is able to delive
just keeps me reaching further, and sit
through the judging, you learn a ton,” sh
“It really helps keep your creativity up t
Though they admit that they would
mind slowing the pace a little, the Stev
say the allure of competition and the s
influx of eclectic brides keep them insp
and engaged.
“I will always want to do weddings,
Michelle. Themed weddings especially
unique brides have 100 percent confid
in what we do. … They come in and tel
do what we do and be as creative as we
want, which is always music to our ear
See more of Justin and Michelle’s work
artistique.com, and check out their destion weddings at artistiquedestination
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 93/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 94/148
images ©Hofer Photography
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 95/148
Happiness aenergy are natu
marketing tactics fTony and Amy Hoff
BY ERIC MINT
Fun-loving
affection
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 96/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 97/148March 2013 • Professional Photograph
If you don’t believe you h
bragging rights, then maing your business can be
problematic—unless you
others brag for you.
Tony and Amy Hoffer
owners of Hoffer Photog
in Downingtown, Pa., on
western outskirts of Phil
phia, have been in the w
ding and portrait photog
business for six years. To
self-deprecating about an
inherent photographic ta
“I’m not naturally artisti
gifted. I have to work pre
hard at it,” he says.
What is natural for To
and Amy are easy-going
friendliness, fun-loving en
and adventurous spirit. “W
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 98/148
pretty affectionate and happy people,” Tony
says of himself and his wife, who shoot ses-
sions as a team. “That’s normal for us, so
we don’t have to market that.” Even though
the couple doesn’t set out to exploit these
personality traits, they are key ingredients
in their marketing. In the
six years since Tony shot
his first wedding, the busi-
ness is booking about 40 a
year in addition to doing
portrait and commercial
photography.
Beyond their website, the
Hoffers rely on word of mouth
for attracting business, Tony
says, and that starts with the
client’s experienceduring
photo shoots. “As much as
we want to take great pho-
tos, I think that’s secondary to our clients
having a great experience,” he says.
Share a little happiness, the Hoffers believe,
and your clients will pay it back. “When people
refer us they usually say, ‘Check out Hoffer
Photography—they’re really nice people, they
work quickly, and they make great pho
Tony says. That’s important for their bu
If they had to give up the photograp
business tomorrow and turn to, say, ser
air conditioners, their philosophy woul
the same, says Hoffer. “My goal is that
ple would trust us, that
see] we’re hard workin
care about quality, that
hire us for that. My sec
goal is to make great ph
raphy that people disco
our website.”
Their website’s port
speak for themselves,
although a good porti
of the site features clie
praising the Hoffers. A
professionally produc
4-minute video on the
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 99/148
Ensures maximum colorcontrol and fl exibility
Provides powerful controlfor display color correction
Simple and cost effectivedisplay color correction
© 2013 Datacolor. Datacolor®
and Spyder®
are registered trademarks of Datacolor. All rig
www.datacolor.com/spyder4
Whatever your style,Spyder shows your true colors.
Calibrate Your World.
Your display is the window to your digital world. An un-calibrated display produces unexpectedresults. Spyder4 simplifi es color calibration and enables true-to-life reproduction of images.
For more information visit: http://www.datacolor.com/ppmarch
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 100/148
‘‘ ’’ As much as we want to take great photos, I think that’s
secondary to clients having a great experience.
splices interviews with footage of a photo
shoot in action. Hoffer says they originally
didn’t want to be in the video, but watching
the Hoffers work is a big part of the trailer’s
energy and fun.
Meanwhile, clients do all the talking.
“We invited people to the house and left the
room and didn’t give them any instruction.”
Straight-from-the-client testimony is
also the foundation of another page on their
site called Raves. The fact that the praise
there is unsolicited is part of the marketing
strategy. “If people leave a review, we put it
up on the site. That comes across as authen-
tic because we don’t ask people for feedback.”
Veracity is part of the Hoffer brand. “Things
coming across honestly is very important for
me,” whether he’s recounting his work on
his Facebook page, blog, or in direct contact
with potential clients. “You consciously need
to be appropriately excited and not act like
every wedding we’ve done was the best thing
ever. That’s something people can see through.”
The 30-year-old Tony started out as a
communications major concentrating in public
relations and advertising at Eastern Univer-
sity in Wayne, Pa., and his first real photog-
raphy experience was a class in college. Still, it
was graphic design that drew his interest,
and after teaching himself that craft he went
to work as a graphic designer. He bou
Canon Rebel camera to serve his needs
He worked his way into the photo b
ness gradually, first taking on senior p
and wedding commissions at the requ
his mother’s coworkers.
He ended up shooting nine weddin
2007. The next year he shot more than 2
left his graphic design job. Amy accomp
him on assignments, and he taught he
shoot. When she wasn’t available, he h
other professional photographers, but
work turned out to be better than anyb
else’s, and it was pretty much a race to get
quit her job,” Tony says. That she did in
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 101/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 102/148
Though now with better equipment
(they are an all-Canon operation, using the
5D Mark III bodies, “pretty much every
lens Canon sells,” and 600EX flash along
with Einstein studio flashes by Paul C.
Buff) and more experience, a sense of wide-
eyed wonder at being able to wield a cam-
era for a living is part and parcel of their
work. For Tony, no angle, perspective, or
composition is off limits. “We look at things
with a fresh pair of eyes,” he says. “Anything
that we’ve done that’s cool or interesting is
probably the result of us working to do it
rather than just a natural talent or skill
that we have.”
They travel for about a quarter of their
wedding shoots and immerse themselves in
the local culture as much as they can to com-
bine with the couples’ particular interests in
their pictures: a couple walking along the
beach in California with a bicycle prominent
in the foreground, a couple enjoying huge
mugs of beer in Munich, a couple cudd
as they drive a roadster down a country
near their lake house. “Where we are [
Philadelphia], there are spots where p
take wedding and engagement photos:
Art Museum, the Love statue,” Tony sa
“For me, the interesting thing is to do s
thing different. Otherwise, why do it? W
like to come and see things for the first
to capture the essence of where they are.”
Tony’s eye as a graphic designer and
understanding of composition help ma
the Hoffers’ work stand out. He won’t
that, but his clients will. One of the cou
in the video describes how Tony interr
them in their reception because the su
outside was perfect for a shot. They foll
him outside, and he got the image. Tha
trust. That’s their happy memory. I
See more of the Hoffer’s work at hofferphotography.com.
Eric Minton is a is a writer and editor Washington, D.C., with more than 35
years of experience.
ANATOMY OF A SHOOT
DATE : Sept. 8, 2012
LOCATION: Jordan, Ontario, Canada
SUBJECT: Nora Charette and her father
CIRCUMSTANCES: Wedding (photo by Tony)
TECH: Canon EOS 5D Mark III camera with a Can
24mm f/1.4 lens, shot in natural light at f/2.0 for
1/250 second, ISO 100
TONY’S TAKE: “Remnants of a hurricane were c
through, and we were nervous as the wedding was
what predicated on being outdoors. About 15 minut
before the ceremony, huge storm clouds started rol
through behind the small white chapel. Once all the
guests had entered and the groom was waiting, thebegan to walk toward the chapel. While Amy was in
church shooting photos of people walking down the
I decided to wait outside for the bride. It was a risk
because the clouds were moving so fast, and I didn’
know if it would actually work out. Then just before
bride walked down the path, she and her father stop
I love how he is looking up checking the weather and she is looking down thinking about the ceremony. I also love the composition of the chu
the added element of the storm clouds and the symbolism of it all. It’s definitely one of my favorite shots from 2012 simply because it all came toge
It’s rare when you see something, wait for it for 10 or 15 minutes, and then it actually materializes the way you had hoped. This was one of those ti
102 • www.ppmag.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 103/148
LEARN ONLINE WITH THE
WORLD’S TOP PRO PHOTOGRAPHERS
Subscribe today for unlimited access to hundreds of exclusive step-by-step, from start-to-finish photography cour
Only $199 a year — or — 24 95 a month
visit www.kelbytraining.com for more info
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 104/148
One with the
CROWD
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 105/148
Travel photographer
Eric Lindberg earns
accolades—and steady
work assignments—by
knowing how to blend in
All im
BY ERIN QUINN O’BRIANT
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 106/148
PPhotographer Eric Lindberg, fresh from a
two-week Kenyan safari, claims it’s hard to
take a bad photo in Africa. His favorite shot
from this trip: a group of Maasai men com-
peting to see which warrior could jump high-
est. “I really like the photo not only because of
the image of the guy jumping, but the expres-
sion of the faces of the other guys watching
him,” says Lindberg. That keen eye for faces,
combined with a deep sense of responsibility
to the environment, sparks Lindberg’s
globe-spanning photography.
FASCINATION WITH FACES
People are Lindberg’s favorite subjects.
He’s especially compelled by the faces
of those in cultures different from his
own. One of the challenges, of course,
is getting the owners of those faces to
agree to be photographed.
Naturally shy, Lindberg didn’t find
task easy, but he’s adapted. “One thing
developed over the years is the ability t
walk up to strangers and get us on the
wavelength and then start photograph
them,” he says.
Sincerity and a bit of creativity go a
way. “Most of the time I don’t speak th
language, so I’ve gotten good at pantom
ing,” he explains. “If it’s a shopkeeper, I
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 107/148
might buy something from them and engage
in conversation.” After a couple of decades of
practice, Lindberg now routinely asks people
he’s never met before in every corner of the
world to smile, pose, and hold props.
Mostly, they’re happy to participate. Lind-
berg estimates that 10 percent to 15 percent
of those he approaches turn him down, but
that’s okay. He respects their decision, and
the world is full of fascinating faces.
ONE WITH THE CROWD
AND THE EARTH
The key to getting people shots is to become
part of the crowd so everyone forgets you’re
there, says Lindberg. “For a guy who’s 6-foot-
2 and blond, that isn’t easy. When I’m on the
street I like to look inconspicuous. I tend to
dress down, wear muted colors and used, worn
clothing. Usually I stay on the sidelines.”
When blending in just won’t work, Lindberg
lets people satisfy their curiosity about
instead. “I go right into the middle of th
marketplace and let everyone see me un
they lose interest,” he says. “Then I star
photographing.”
The human spirit captivates Lindbe
does the majesty of the natural world. “
have a strong conservation ethic, and I
passionate about the environment,” he
“Through my photography and writing
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 108/148
to convey the fragility and the delicate
nature of what’s left of our wild world.”
For him, that means showing others the
world through his lens. “I have always felt
like I see things in the world other people
don’t see. I see the world differently and I
find beauty in small things and big things—
so much beauty everywhere. I have almost
an addiction to portraying and conveying
the beauty that I see.”
WRITER, PHOTOGRAPHER,
AWARD WINNER
Lindberg is a writer as well as a photogra-
pher, and both callings fuel his career. “I
have the soul of an artist but not the ability
to paint or sculpt or do some traditional
artistic mediums,” Lindberg laughs. “Writ-
ing and photography are two ways I can
express myself, interpret the world arou
and convey my vision of it to other peo
He worked part-time as a travel wri
and photographer for about 10 years, s
articles to magazines and newspapers
around the country. “As I became busie
busier, I honed my photography skills.
joined the Society for American Travel
ers, and that opened a lot of doors for m
met more people; my name got out the
Better than that: The Society of Ame
Travel Writers honored him as Photogr
of the Year in 2011, a title he was again
awarded in 2013. The 2011 award mar
major career change for Lindberg. He r
“I was hearing from people I hadn’t heard
before.” Reflecting on the years of work
went into his current successes, Lindberg
“I’ve hustled hard to make contacts, me
THE INSPIRED PHOTOGRAPHER
ERIC LINDBERG’S TOP 10
Ask Eric Lindberg about inspiration,
and he’s quick to point to the master
photographers who inspire him. “There
are times when I need to juice up my
creativity and the tank is empty and Idon’t have what I need to get out
there,” he says. These photographers,
many of whom shoot for National
Geographic , fill him with enthusiasm:
Annie Griffiths
Joel Sartore
Jodi Cobb
Steve McCurry
William Albert Allard
James Nachtwey
Ansel Adams
Edward Weston
Robert Frank
Henri Cartier-Bresson
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 109/148
W W W. M I L L E R
S LA B. C O M/ S P O R
T SA N D E V E N T
S/ O V E R V I E W
| 8 0 0. 8 3 5. 0 6
0
IMAGES SO CRISP YOU CAN ALMOST SEE SWEAT DRIP OFF THE PAGE. TURNAROUND SO FAST IT’S LIKE YOU’RE WATCHIN
INSTANT REPLAY. SUPERIOR SERVICE AND PROFESSIONAL EXPERIENCE THAT LEAVES THE REST IN THE DUST.
BECAUSE PRACTICE REALLY DOES MAKE PERFECTUNYIELDING
SPORTS & EVENTS
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 110/148
people, and develop relationships with editors.
Some of it is luck and some is marketing.”
UP NEXT: A PASSAGE TO INDIA
Most of Lindberg’s recent photographs,
including those from Kenya, have been
taken on assignment. After the interview for
this story, he’s headed from his home in
Denver to a dog sledding camping trip in
Canada. This year, says Lindberg, “I’d like to
take two to three months and just go o
with my cameras with no assignment a
free to shoot whatever I see.”
Probably in India. Lindberg has alr
spent eight months there all told, he rec
and he’s ready for more. “I’ve never fou
myself farther from home than in Ind
he says. “So much of what I see I don’t
understand: the languages, the religio
love getting lost in a culture that’s so c
ful and vibrant.”
That’s Lindberg’s idea of heaven. “I
feel more perfectly centered and grounde
when I’m on an assignment by myself
ing a culture or a people or a place,” he
“I feel so right in the moment that ever
thing else drops away.”
The rest is almost easy. I
See Eric Lindberg’s work at ericlindber
Writer Erin Quinn O’Briant lives in th Francisco Bay area. She is the author of“Glitter Girl: A Novel.”
110 • www.ppmag.com
EQUIPMENT FOR TRAVEL PHOTOGRAPHY
Whether he’s in Canada or Kenya, Lindberg carries as little as he can. His camera equipment is
all Canon: two EOS 7D bodies and additional items as needed.
FOR EVERY SHOOT: 10-22mm f/3.5-4.5 lens; 24-105mm f/4 L lens
FOR WILDLIFE AND NATURE: 100-400mm f/4.5-5.6 lens
IF ROOM ALLOWS: 100mm f/2.8 macro lens; 24mm f/2.8 lens; 50mm f/1.8 lens;70-300mm f/4-5.6 lens; Speedlite flash unit
NICE TO HAVE: Gitzo 1227 and 1550 tripods; Kirk Enterprises ball head; polarizing filter; split
neutral density filter; neutral density filter; 4- and 8GB memory cards; remote shutter release cord
TOP TIP: For travel photography, ditch the fancy camera bag at the hotel. Instead, Lindberg says,
stash photographic gear in a scuffed-up canvas bag, which helps you become one with the crowd.
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 111/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 112/148
BY WILL POLLOCK
If you sat in on a wedding sho
managed by Kevin Jairaj, yo
might think you were watch
Secret Service operation. On
assignment, Jairaj’s second
tographer and others on his team are
with wireless transmitters that includ
in-ear monitors and wrist microphon
The communication technology, he sa
helps facilitate complicated events.
“We’re usually talking on our wrist [ra
during the wedding,” he says. “The co
nators, the groom and all the grooms
think it’s the coolest thing ever. We ca
communicate without interfering. Sin
I’m a big believer in the team concept
always assign duties easily. I have my
ond shooter do certain tasks while my
assistants and I are doing something We make sure everything is covered.”
The body of the listening device the
clips to a belt and the wiring runs unde
shirt up to the earpiece. “At every even
coordinators want to know where to get t
says Jairaj. “To me it is invaluable. Some
the bride and groom will want to see each
for photos before the ceremony, but a l
times they won’t. They want to wait fo
walking-down-the-aisle moment. If tha
case, I usually have my second shooter w
guys and I am usually with the girls, and
simply radio to my second shooter to co
nicate what the bride needs. Clients see
professional you are and how neat every
is. It is under control. They love that. I
great added benefit.”
Flair for the dramaticKevin Jairaj brings a fashion-forward flavor to wedding and portrait photograph
All images ©Kevin Jairaj
W E D D I N G S
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 113/148
RIGHT PLACE
Radio comm isn’t the only buzz around KJ
Images Photography in Dallas. Kevin Jairaj
earned kudos last summer for his portraits
of Olympic athletes. A longtime sports fan,
Jairaj jumped when the opportunity arose
to photograph stars of soccer, swimming,
gymnastics, and other sports for “USA
Today,” producing portraits that made
Olympians and other pho tographers proud.
(See the ppmag.com Web-exclusive “A Gold
Medal Gig: Kevin Jairaj Scores an Olympic
Opportunity,” ppm.ag/?Xd.)
“It turned out well for me,” says Jairaj,
who gained a high profile from wide distri-
bution of the photographs. Jairaj’s Olympic
experience allowed him to dip into his
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 114/148114 • www.ppmag.com
‘‘’’
I love when
people approach me and
say they saw an imageonline and they knew
immediately it was mine.
longtime passion for sports. “It has been
a nice change for me because it is totally
different than wedding photography. It
keeps me fresh. I use it to recharge and
energize myself.”
MAKING THE LEAP
In a sense, Jairaj picks up today where he
began, when the passion for photography
was a college sideline for capturing images
of friends, family, and the odd sports event.
After college, his corporate job as a Lucent
Technologies account manager paid the
bills while he grew his photography busi-
ness. Then it was time to make some
tough decisions.
“I continued to shoot even when I had a
corporate job,” Jairaj says. “I wanted to
learn more. I hooked up with a couple of
other photographers and second-shot wed-
dings for them and did a lot of fashion
work here in Dallas while I still had my
corporate job.
“One day I shot a wedding as a favor
for a friend,” he adds. “I loved it. I loved
everything about it. I loved the fact that
I could be creative, and I loved the reac-
tions of the family and the bride and
groom when I gave them their photos.
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 115/148
PPA Has Got You Covered.
$15,000of equipment insurance...now included in your
PPA membership.
PPA helps you protect what matters and, as a pro photographer,
that includes your photographic equipment. With PhotoCare,
PPA covers your premium* for $15,000 of equipment insurance.
It’s just one more way that membership in PPA pays.
*PhotoCare Equipment Insurance is available to U.S.-based PPA Professional Active and Life membersonly. Policy is provided by PPA as a part of membership and includes equipment coverage up to $15,000
per year. Restrictions apply. Additional coverage is available for purchase. Insurance provided by
Lockton Affinity. PPA members must activate their policy and maintain membership to receive coverage.
WWW.PPA.COM/INSURANCE
ACTIVATE YOUR POLICY TODAY!
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 116/148
They were so thankful, so happy. I got
hooked after that.”
That experience, along with a growing
client base of brides and grooms, led him to
quit his corporate job and make photogra-
phy a full-time career. “I never looked back,”
he says. “I’m in charge of my own success,
and I want to be my own boss.”
His business swelled to about 40 to 50
weddings per year, then he was able to scale
back to a volume of 20 to 25 and add bas-
ketball games and other sports events.
Enjoying a varied spectrum of projects
across multiple fields, Jairaj has been able to
develop a signature photographic look, and
he urges others to do the same. People can see
the difference, he says: “I love when p
approach me and say they saw an image
and they knew immediately it was mine.”
Kevin Jairaj’s online portfolio can be skjimages.com.
Will Pollock of Stone Four Media is a flance journalist and photographer basin Atlanta.
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 117/148
SUCCESSWARE.NET | 800.593.3767
What do top studioowners use to manage?
These owners have all chosen SuccessWare to help them manage their
businesses. Other software may track your business but they all fall short
when it comes to managing your business. SuccessWare is the only studio
management software that will assist you with; creating a business plan,
pricing your products, preparing financial reports and tracking client
information. SuccessWare manages all your day-to-day operations giving
you the knowledge to make solid management decisions necessary toachieve your goals and take your studio to the next level. You can’t get that
with just tracking software.
TRACK. PRICE. PLAN. PROFIT. MANAGE.
Don’t just take our word for it, see what Jed, Vickie and other successful
photographers have to say at: www.successware.net/success_stories
“Having a financial management program that lays everything out
of you so that you can get the information you need, when you nee
to make good business decisions is vital...the bottom line for us is
SuccessWare puts us in control.”
Jed & Vickie Taufer | VGallery | Morton, Illinois
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 118/148Prices, specifcations, and images are subject to change without notice. Manuacturer rebates are subject to the terms and conditions (including expiration dates) printed on the manuacturers’ rebate orms. Not responsible or typographical or illustrative errors. © 2000-2013 B & H Foto &
When in New York,
Visit our SuperStore
420 Ninth Ave.Corner of 34th Street
New York, N.Y. 10001
Over 70,000 square feet
of the latest gear
The most knowledgeable
Sales Professionals
Hands-on demos
Convenient free parking
available
The Professional’s Source™
scr i e to our Cat log
ndH.com/catalog
2-444-6633
Page 1
AF FlashesSB-400 ................. SB-700 ......326.95
SB-910 ..........................................546.95R1 Wireless Twin Flash ...............................
R1C1 Wireless Twin Flash System ...............
DX ED-IF Lenses for Digital Only10.5/2.8 Fish-Eye ......................................35/1.8 G AF-S (52ø) ....................... 196.9540/2.8 G AF-S Micro (52ø) .............. 276.9585/3.5 G ED VR Micro (52ø) ............ 526.9510-24/3.5-4.5 G AF-S (77ø) .......................12-24/4 G AF-S (77ø) ................................16-85/3.5-5.6 G AF-S VR (67ø) ..................17-55/2.8 G AF-S (77ø) .............................18-55/3.5-5.6 G AF-S II (52ø) ....................18-55/3.5-5.6 G AF-S VR (52ø) ....... 196.9518-105/3.5-5.6 G AF-S VR (67ø) .....396.9518-200 /3.5-5.6 G AF-S VR II (72ø)......... 846.9555-200/4-5.6 G AF-S (52ø) ........................55-200/4-5.6 G AF-S VR (52ø) ........ 246.9555-300/4.5-5.6 G AF-S VR (58ø) .....396.95
D-Type AF Lenses14/2.8 D ED .......... 24/2.8 D (52ø).......16/2.8 D (39ø) with Hood ...........................24/3.5 D ED PC-E (77ø) .............................
28/1.8 G AF-S (67ø) ....................... 696.9528/2.8 D (52ø)...........................................35/2.0 D (52ø)...........................................45/2.8 D ED PC-E Micro (77ø) ....................
D-Type AF Lens
50/1.8 D (52ø)....... 50/150/1.8 G AF-S (58ø) ............50/1.4 G AF-S (58ø) ............
60/2.8 D Micro (62ø) (1:1) ...60/2.8 G AF-S ED Micro (62ø85/1.8 D (62ø) with Hood .....85/1.8 G AF-S (67ø) ............85 /1.4 D IF (77ø) ........ 85 /1.4
105/2.8 G AF-S ED-IF VR Mic105/2.0 DC D with Hood (72ø180/2.8 D ED-IF (72ø)..........200/4 D ED-IF Micro w/Case 200/2 G AF-S ED-IF VR II (52ø300/4.0 D AF-S ED-IF (77ø) .14-24/2.8 G AF-S ED-IF .......16-35/4.0 G AF-S ED VR (7717-35/2.8 D AF-S ED-IF (77ø24-70/2.8 G AF-S ED-IF (77ø24-85/2.8-4.0 D IF (72ø) .....24-120 /4.0 G AF-S ED VR (77ø) .28-300 /3.5-5.6 G AF-S ED VR (7
70-200 /2.8 G AF-S ED-IF VR II (77
70-300/4.5-5.6 G-AFS VR (680-200/2.8 D with Collar (7780-400/4.5-5.6 D VR (77ø) ..200-400/4 G AF-S ED VR II (5TC-14E II (1.4x) TeleconverteTC-17E II (1.7x) TeleconverteTC-20E III (2x) Teleconverter .
EOS Flash System (USA)270EX II ................320EX ...................
430EX II ................580EX II ................
600 EX-RT................................................
MR-14EX Ringlight ....................................MT-24EX Twin Flash ..................................
EF-S Lenses for Digital Only (USA)(Not compatible with full frame cameras)
60/2.8 USM Macro (52ø)...........................10-22/3.5-4.5 USM (77ø) .........................15-85/3.5-5.6 IS USM (72ø) .....................17-55/2.8 IS USM (67ø) ............................17-85/4-5.6 IS USM (67ø) ........................18-135/3.5-5.6 IS (67ø) ...........................18-200/3.5-5.6 IS (72ø) ...........................55-250/4.0-5.6 IS USM (58ø) ...................
EF Lenses (USA)
20/2.8 USM (72ø) ............................... ......
24/2.8 IS USM (58ø) .................................
28/2.8 IS USM (58ø) .................................35/2 (52ø) .............50/1.8 II (52ø) .......
50/1.4 USM (58ø) ..135/2.8 (52ø) ........
50/2.5 Macro (52ø)...................................85/1.8 USM (58ø) ............................... ......100/2 USM (58ø) ................................ ......100/2.8 USM Macro (58ø).........................28-135/3.5-5.6 IS USM (72ø) ...................70-300/4-5.6 IS USM (58ø) ......................70-300 /4.5-5.6 DO IS USM (58ø) ....................
75-300/4.0-5.6 III (58ø) ............................75-300/4.0-5.6 III USM (58ø) ....................
TS-E MF Lenses (USA)17/4.0 L ................
45/2.8 ..................
24/3.5 L II .............
90/2.8 ..................
EF “L” Lenses (USA)14/2.8 USM II .................................. .........24/1.4 II (77ø) ..........................................35/1.4 USM (72ø) .................................. ...50/1.2 USM (72ø) .................................. ...85/1.2 USM II (72ø) ..................................100/2.8 IS USM Macro (67ø) .....................135/2.0 USM (72ø) ...................................180/3.5 USM Macro (72ø).........................200/2.0 IS USM (52ø) ...............................300/4.0 IS USM (77ø) ...............................300/2.8 IS USM II (52ø rear) ......................400/5.6 USM (77ø) ...................................8-15/4.0 Fish-eye USM.............................16-35/2.8 USM II (82ø) .............................17-40/4.0 USM (77ø) ...............................24-70/2.8 USM II (82ø) .............................24-105/4 IS USM (77ø) .............................28-300/3.5-5.6 IS USM (77ø) ...................70-200/4.0 IS USM (77ø) ..........................70-200/2.8 USM (77ø) .............................70-200/2.8 IS II USM (77ø) .......................70-300/4.0-5.6 IS USM (67ø) ...................100-400/4.5-5.6 IS USM (77ø) .............. ...1.4x III Tele ............ 2x III Tele ...............
on Select Bodies, Lenses and Flashes!
on Select Bodies, Lenses and Flas
EOS-60D DSLR
tY)%7JEFP$BQUVSF
t%*(*$*NBHF1SPDFTTPS
t4%4%)$4%9$$BSE4MPU
t8PSLTXJUIBMM$BOPO&'&'4-FOTFT
t7BSJ"OHMF$MFBS7JFX'MJQ0VU-$%
tGQT$POUJOVPVT4IPPUJOH
t*40&YQBOEBCMFUP
t)%.*0VUQVUUP)%57
Body Only...................................................#CAE60D 18MegaPixels
EOS-5D Mark II D-SLR
t3FDPSE)%7JEFP tQ.PWJF.PEF
t.FHBQJYFM'VMM'SBNF4FOTPS t)JHI
3FT-$% t4-3WJFXGJOEFS t-JWF7JFX.PEFt6TFT$BOPO&'-FOTFT t$'.%$BSE4MPU
t%VTU8FBUIFS3FTJTUBOU t64#
t4FMG$MFBOJOH4FOTPS tGQT#VSTU.PEF
tQPJOU"'4FOTPS"SSBZ t*40
Body Only..................................................#CAE5D2
Kit with 24-105mm IS ......................#CAE5D224105
EOS-7D D-SLR
t3FDPSE)%7JEFP t.FHBQJYFM4FOTPS
t-$% t7JFXGJOEFS
t6TFT$BOPO&'-FOTFT t$'.%$BSE4MPU
t%VTU8FBUIFS3FTJTUBOU tGQT#VSTU.PEF
t4FMFDUBCMF7JEFP&YQPTVSFBOE'SBNF3BUFT
t/FX1PJOU"MM$SPTT5ZQF"'4ZTUFN
t*40FYQBOEBCMFUP
Body Only..................................... .......... #CAE7D
Kit with 28-135mm IS ................... #CAE7D28135 18MegaPixels
EOS-5D Mark III D-SLR
t$MFBS7JFX)JHI3FTPMVUJPO-$%
t%*(*$*NBHF1SPDFTTPS t1PJOU
)JHI%FOTJUZ"' t6TFT$BOPO&'-FOTFT
t%VBM$'4%$BSE4MPUT t6QUP'14
t%VSBCMF.BHOFTJVN"MMPZ$POTUSVDUJPO
t'VMM)%QBOEQ'PSNBUT
t#VJMU*O)%3BOE.VMUJQMF&YQPTVSF.PEFT
Body Only..............................................#CAE5D3*
Kit with 24-105mm L IS ................ #CAE5D324105
EOS-1Dx D-SLR
t%VBM%*(*$*NBHF1SPDFTTPST
t.BHOFTJVN"MMPZ#PEZ
t&ZF-FWFM1FOUBQSJTN7JFXGJOEFS
t-$%.POJUPS t6TFT$BOPO&'-FOTFT
t%VBM$'DBSETMPUT
tY)%7JEFP$BQUVSF
t-JWF7JFX4UJMMBOE7JEFP3FDPSEJOH
t1PJOU)JHI%FOTJUZ"VUP'PDVT
Body Only..............................................#CAE1DX*
Digital Rebel T4i DSLR
t45.-FOT4VQQPSUGPS2VJFU"'JO.PWJFT
t%*(*$*NBHF1SPDFTTPS
t7BSJ"OHMF5PVDI4DSFFO-$%t6TFT$BOPO&'-FOTFTYGBDUPS
t4%)$4%9$$BSE4MPU
t*40&YQBOEBCMFUP
t'VMM)%.PWJF.PEFXJUI$POUJOVPVT"'
Body Only..................................... .......... #CAEDRT4I
Kit with 18-55mm IS.............................#CAEDRT4IK 18MegaPixels
Lumix DMC-G5 Mirrorless Digital C
t'VMM)%Q7JEFP t.JDSP-FOT.PVOU
t3FEFTJHOFE7FOVT&OHJOF*NBHF1SPDFTTPS
t5PVDI4DSFFO5JMUBCMF3PUBUBCMF-$%
t4%4%)$4%9$$BSE4MPU
t-JWF7JFX'JOEFSXJUI&ZF4FOTPS
t&MFDUSPOJD4JMFOU4IVUUFS.PEF
t"EKVTUBCMF*ODBNFSB'JMUFST
t$POUSBTU"'5PVDI"'BOE-JHIU4QFFE"'
Kit with 14-42mm G Vario Lens ..... #PADMC G5KB
E-PL5 Mirrorless System Camera
t'MJQ1PSUSBJU-$%5PVDITDSFFO
t5SVF1JD7**NBHF1SPDFTTPS
t'VMM'SBNF;VJLP-FOTFT
t4%4%)$4%9$$BSE4MPU
t*O#PEZ*NBHF4UBCJMJ[BUJPO
t'VMMJ)%7JEFP t'"45"VUP'PDVT
t*ODBNFSB"SU'JMUFST t*40
t"WBJMBCMFJO#MBDL4JMWFSPS8IJUF
Kit with 14-42mm II Lens ....................#OLEPL51442* 16MegaPixels
18-200/3.5-5.6 DX GAF-S ED-IF VR II Digital Lens
t&YDMVTJWFMZEFTJHOFEGPS%JHJUBM4-3T
tNNFRVJW27-300mm
t73**7JCSBUJPO3FEVDUJPO
t48.4JMFOUWave Motor)
tG4UPQ3BOHFt'PDVThUP*OýOJUZ
t8FJHIUP[
10-22/3.5-4.5EF-S USM Digital Lens
t&YDMVTJWFMZEFTJHOFEGPS%JHJUBM4-3T
tNNFRVJW16-35mm
tBTQIFSJDBMlens elements
tG4UPQ3BOHF
t.JOJNVNGPDVTtNNýMUFSEJBNFUFS
t8FJHIUP[
SB-910 Speedli-TTL Shoe Mount Flash
t5VOHTUFO'MVPSFTDFOU'JMUF
t(VJEF/Pht4JNQMJýFE(SBQIJD
User Interface (GUI)t#PVODF4XJWFM
;PPN)FBE(17-200mm)
t8JSFMFTT$POUSPMMFS
t8FJHIUP[
600 EX-RTShoe Mount Flash
t%VTUBOEXBUFSSFTJTUBODF
t(VJEF/Pht8JSFMFTT3BEJP
Multiple Flash Systemt#PVODFBOE
Swivel Headt;PPN)FBENNt$VTUPN'VODUJPOT
t8FJHIUP[
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 119/148
The Professi
800-94
212-44
F
212-23
Store & Mail
Sunday 10-5 t
Friday 9-1 Saturda
Over 300,00at your
www.Ba
We Buy
NYC DCA Electronics Store Lic. #0906712; NYC DCA Electronics & Home Appliance Service Dealer Lic. #0907905; NYC DCA Secondhand Dealer – General Lic. #0907906
Flash System
FL-300R Flash .........169.95FL-600R Flash .........299.95
FL-50R Flash ...........499.95RF-11 Ring Flash .....249.95
Zuiko 4/3 System Digital Lenses
35/3.5 Macro ED (52ø) ............................................ 229.95
50/2.0 Macro ED (77ø) ............................................ 499.957-14/4.0 ED (72ø) ................................................ 1,799.9511-22/2.8-3.5 ED (72ø) ........................................... 799.9512-60/2.8-4 ED SWD (72ø) ...................................... 999.9514-42/3.5-5.6 ED (58ø) ........................................... 249.9518-180/3.5-6.3 ED (62ø) ............................... .......... 499.95EC-14 1.4x Teleconverter ............................... .......... 439.95
AF Flash System
AF-360FGZ ............................................................... ......... AF-540FGZ ............................................................... .........
SMCP-DA Digital AF Lenses
21/3.2 AL Limited “Pancake” (49ø) ......................................40/2.8 Limited “Pancake” (49ø) .................................. .........
70/2.4 Limited “Pancake” (49ø) .................................. .........10-17/3.5-4.5 ED IF (77ø) ..................................................
16-50/2.8 ED AL IF SDM (77ø) ............................................18-55/3.5-5.6 AL II (52ø) ....................................................
50-135/2.8 ED IF SDM (67ø) ................................ ...............50-200/4-5.6 ED WR (52ø) .................................. ...............
Flash System
HVL-F20AM .............149.99HVL-F20S................149.99
HVL-F43AM.............349.99HVL-F58AM.............499.99
Digital Lenses
24/2 Carl Zeiss (72ø) ................................. ........... 1,399.99
50/1.4 (55ø) .................................. .......................... 449.99100/2.8 Macro (55ø)................................................ 799.9916-80/3.5-4.5 DT Carl Zeiss (62ø) ........................... 999.9911-18/4.5-5.6 DT (77ø) ........................................... 799.9918-200/3.5-6.3 DT (62ø) .................................. ....... 549.9970-200/2.8 G APO (77ø) ....................................... 1,999.9975-300/4.5-5.6 (55ø) ................................ .............. 249.99
D7000 DSLR
t&91&&%*NBHF1SPDFTTPS t-$%.POJUPS
tQ)%7JEFP$BQUVSF tQPJOU"'4ZTUFN
t3"8+1&(4UJMM*NBHF$BQUVSF
t "DDFQUT/JLPO"'-FOTFTYGBDUPS
t5XJO4%4%)$4%9$$BSE4MPUT
t3(#%.BUSJY.FUFSJOH4ZTUFN
tJ55-'MBTI4QFFEMJHIU$PNQBUJCJMJUZ
t/JLPO*ODMJNJUFEXBSSBOUZJODMVEFE
Body Only #N ID7000 ........................... 1,196.95 16MegaPixels
D4 DSLR
t3"85*''+1&(3"8+1&('JMFT t-$%
XJUI-JWF7JFX t'9GPSNBUGVMMGSBNF$.04
4FOTPS tQ)%#SPBEDBTU2VBMJUZ7JEFP
t&91&&%*NBHF1SPDFTTPS t*40
t$PNQBUJCMFXJUI.PTU/JLLPS0QUJDT
t.BUSJY$FOUFS8FJHIUFE4QPU.FUFSJOH
t$'5ZQF92%$PNQBUJCMF
t/JLPO*ODMJNJUFEXBSSBOUZJODMVEFE
Body Only...................... #NID4 .................. 5,996.95 16MegaPixels
D800 D-SLR
tYNN$.04'9'PSNBU4FOTPS
t-$%.POJUPS t/JLPO'.PVOU-FOT.PVOU
t$'4%%VBM$BSE4MPUT t0QUJDBM-PX1BTT'JMUFS
t&ZF-FWFM1FOUBQSJTN7JFXGJOEFS
tYQ)%7JEFP$BQUVSF
t.BUSJY$FOUFS8FJHIUFE4QPU.FUFSJOH
t#VJMU*O'MBTIJ55-'MBTI$POUSPM
t/JLPO*ODMJNJUFEXBSSBOUZJODMVEFE
Body Only............................ #NID8 00 ........................ $2,996.95 36MegaPixels
Alpha SLT-A99 DSLR
t4POZ%VBM"'4ZTUFN5SBOTMVDFOU.JSSPS
t'VMM'SBNF&YNPS$.044FOTPS
t9("0-&%&MFDUSPOJD7'
t5SV#MBDL5JMUJOH-$%
t6TFT4POZ"MQIB-FOTFT t.41SP%VP )(%VP4%4%)$4%9$$BSE4MPUT
t*OUFSOBM4UFBEZ4IPU*NBHF4UBCJMJ[BUJPO
t'VMM)%YQ7JEFP3FDPSEJOH
Body Only.........................................#SOSLTA99V* 24MegaPixels
Alpha NEX-6 .JSSPSMFTT4ZTUFN$BNFSB
t'BTU)ZCSJE"'XJUI1IBTF%FUFDUJPO"'
t-$% t6TFT4POZ&NPVOU-FOTFT
t9("0-&%5SV'JOEFS&7'
t4%4%)$4%9$.41SP%VP1SP)(%VP
$BSE4MPU t$BQUVSFT)%7JEFP
t8J'J$BQBCMF t'BTUGQT#VSTU4IPPUJOH
t1MBZ.FNPSJFT$BNFSB"QQT
with 16-50mm Lens .............................#SONEX6L* 16MegaPixels
D3200 DSLR
t&91&&%****NBHF1SPDFTTPS t)%Q7JEFP
t-$% t-JWF7JFX tQPJOU"VUPGPDVT
t6TFT/JLPO"'-FOTFTYGBDUPS
t4%4%)$4%9$$BSE4MPU t6Q5P*40
t/JLPO*ODMJNJUFEXBSSBOUZJODMVEFE
D3200 Kit Black w/18-55mm VR ...#NID32001855........696.95
D3100 Kit with 18-55mm VR ...........# NID31001855 ........646.95
D5100 ,JUXJUINN73 #NID51001855 .................796.95 24MegaPixels
D600 DSLR
t'9'PSNBU'VMM'SBNF$.044FOTPS
t6TFT/JLPO"'-FOTFT t&91&&%1SPDFTTPS
t-$% t4%4%)$4%9$$BSE4MPUtQ)%7JEFP$BQUVSF t8JEF"SFB"'
'PDVT1PJOUT t*40&YQBOEBCMFUP
t/JLPO*ODMJNJUFEXBSSBOUZJODMVEFE
#PEZ0OMZ #NID600 ..................................................2,096.95
,JUXJUINN73-FOT #NID6002485 ................2,696.95 24MegaPixels
1 J2 Mirrorless Digital Camera
t&91&&%%VBM*NBHF1SPDFTTPS
t'VMM)%Q.PWJFXJUI4UFSFP4PVOE
t*OUFSDIBOHFBCMF/*,,03-FOT4ZTUFN
t-$% t4%4%)$4%9$$BSE4MPU
t/JLPO*ODMJNJUFEXBSSBOUZJODMVEFE
t"WBJMBCMFJO#MBDL0SBOHF1JOL3FE4JMWFSPS8IJUF
1 J2 ,JUXJUINN73 #NI1J21030* .....................546.951 J2 ,JUXJUINN73 #NI1J21030K* ....796.951 J1 ,JUXJUINN73 #NI1J11030* ...846.95 10
MegaPixels
285HV ProessionalAuto 4IPF.PVOU'MBTI
t(VJEF/Ph
t "VUPNBUJDFYQPTVSF
SBOHFUPh
tBVUPGTUPQTFUUJOHT
t3FNPWBCMFTFOTPS
t#PVODF)FBE
t;PPN)FBE t8FJHIUP[
#VI285HV .....................................85.00
Qfash TRIO1BSBCPMJD3FþFDUPS'MBTI
t(VJEF/Ph
t#PVODFBOE
4XJWFM)FBE
t#VJMU*O'SFF9XJSF
t3BEJP8JSFMFTT55-
t)JHI4QFFE4ZOD
t64#1PSU t55-DPNQBUJCMF
262'.................................... 875.00
622 Super Pro TTL)BOEMF.PVOU'MBTI
t3FRVJSFT)FBE
t55-XJUIBQQSPQSJBUFNPEVMF
t(VJEF/P
t#PVODFTXJWFM
t "VUPG4UPQTG
t7BSJ1PXFS
464 .................................. 196.95
58 AF-2 TTL4IPF.PVOU'MBTI
t(VJEF/Ph
t'VMM55-.PEF
t;PPN)FBE
t#PVODF4XJWFM)FBE
t6QEBUFWJB64#1PSU
t8FJHIUP[
.&"' .............................. 399.99
Octacool Light KitXJUI0DUPCPY
t0DUBDPPMPS
-BNQ'JYUVSF
t3FNPWBCMF
"MVNJOVN
3FþFDUPS
tX-BNQT
t*OUFSOBM%JGGVTJPO#BGþF
Octacool-6 *.0$4#........................................ 199.95Octacool-9 *.0$4#........................................ 259.00
Octacool-6Front
Octacool-9#BDL
Background System
Background Stands
&DPOPNZ .............................. 74.95
Port-A-Stand ....................109.95*
.VMUJ1PMFWBVMU..............217.99
Paper Backgrounds
Available in 48 Colors
YZET......................... 24.95YZETX$PSF...........45.95
* FREE!
Roll ofWhite Paperw/ Purchase
SpectroLED Light Kits
t%BZMJHIU#BMBODFE,
t#FBN1BUUFSO
60° Flood
t"$PS%$0QFSBUJPO
t
Dimming Control
t*ODMVEFT4UPQ
%JGGVTJPO4PDL
SpectroLED 9 500 LEDs #GESPAD35 ............... 249.00SpectroLED 14 1144 LEDs #GESPAD75 ........... 499.00
LED 14
LED 9
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 120/148
BY ERIC MINTON
f all the wedding photo
phy masters he stud
under, Steve Nissle
M.Photog.Cr., CPP
found the most impor
lessons came from his father, Ken. From
tography mentors such as Rocky Gunn
Stockwell, Monte Zucker, Don Feltner,
Avila, and Denis Reggie, Nissle learned
refine his techniques and strategies. But
his father, Nissle learned the essential r
love in wedding day photography: the
between the bride and groom, the love
family and friends and, for the photogr
capturing that love and being part of it
“Our industry is loving people—it r
is,” says Nissle, proprietor of Nissle Ph
raphy in Mesa, Ariz. “When I’m photo
graphing a wedding, that’s what’s on mmind. I make sure I get the bride and g
alone and make sure they can touch ea
other and kiss and be themselves. I ma
sure I record their wedding day in their
For Nissle, doing that entails detail
preparation weeks before the event, ma
out the whole shoot with the formulas
formed over 40-some years of experien
Once he gets the assignment, Nissle
an engagement photo session at no ch
and starts planning with the couple. A
or two before the wedding, he meets wi
couple and their parents and writes ou
day’s timeline and details such as the of
vendors, and the names and relationsh
the wedding party and other special fr
and family who will be in attendance.
Loving peopleSteve Nissle learned the wedding photography business at his father’s side
l images ©Steve Nissle
O
W E D D I N G S
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 121/148
P h o t o s h o p a n d L i g h t r o o m a
r e r e g i s t e r e d t r a d e m a r k s o f A d o b
e S y s t e m s I n c o r p o r a t e d .
The World’s Best Photoshop ® Training!
Join NAPP Today @www.PhotoshopUser.com | 800.738.8513
NAPP HAS EVERYTHING YOU NEED
TO GET REALLY GOOD AT PHOTOSHOP• 10 issues of Photoshop User magazine – it’s like getting a new
Photoshop book every month!
• Full-length online Photoshop courses taught by Scott Kelby andThe Photoshop Guys
• 1000s of exclusive online video tutorials with tips and new techniques
• 100s of money-saving discounts from major retailers
• 3 Help Desks for Photoshop, Lightroom & gear questions
• Your own portfolio gallery to showcase your work
Learning Photoshop is fun,easy and affordable with NAPP.
NAPP announces full-length online
PHOTOSHOPCLASSESAS PART OF YOUR MEMBERSHIP
®
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 122/148
‘‘’’
It could be the full church on the outside, the inside of the church
from the very back. It could be a location we’ve selected, like a
fountain. We find these locations and pick the right timeof day to put the bride and groom in that location.
“By the time we get to the reception, I’ve
memorized almost everybody’s name,” Nissle
says. “When you call people by their first
name, it makes a big difference.” It also helps
when navigating the family poses. “You have
to step into their lives and be a family mem-
ber, help them feel totally relaxed and enjoy-
ing the process while you get the pictures.”
His wife and business partner, Dianne,
an image consultant and relationship life
coach, helps him pinpoint the couple’s per-
sonalities, their likes and dislikes. “So we’re
not photographing everybody in the same
way,” Nissle says. In the Nissles’ playbook,
couples fall under four main categories
energetic, light; soft, flowing, relaxed,
blended; dynamic, sure, decision-mak
movers; and classic, stylized, tailored.
He encourages couples to bring in im
from any source to show him the look a
feel of pictures they prefer. “All we’re d
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 123/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 124/148
is building on who the couple is and what
they want,” Nissle says. “It’s not an ego-fest
for me to determine what we’re going to do.”
No matter the individuality of the wed-
ding, Nissle goes into every one with the same
long-established strategy. He divides the wed-
ding into four parts—pre-wedding pictures
of the wedding party and details of the clothes
and church, the ceremony, formal portraits,
the reception—and plans specifically for each.
“For me, it’s important to cover important
wedding basics, and I plan so I can do those
and intermingle the creative, expressionistic
photography outside that basic box.”
Somewhere in his timeline he will shoot
an establishing image: “It could be the full
church on the outside, the inside of the church
from the very back. It could be a location
we’ve selected, like a fountain. We find these
locations and pick the right time of day to
put the bride and groom in that location.” If
he is not familiar with the location, he scouts
it and checks sunset times. “I always sunset
my wedding days. I always do,” he says. He
recently shot a wedding at the Mormon
temple in San Diego scheduled for 9 a.m. on
a Saturday. With no viable sunset option on
the wedding day, Nissle met with the coupleat the temple the day before. “We got the
right kind of light and we got undisturbed
time with the bride and groom.”
In addition to the establishing image,
Nissle gets a medium shot, a close-up of the
bride and groom, and an extreme close-up,
such as details of the bride’s dress or the
groom’s boutonniere. The close-up of the
couple, which can be posed or candid, is essen-
tial, Nissle says. “My dad told me, ‘Get in and
get close-ups, get the feelings.’ So I move in,
get the expressions, get the personalities of the
people. I’ll do something to get them out of
their shell. With close-ups, the love comes out.”
After shooting at the temple, Nissle and
the couple headed to La Jolla Beach for sun-
set-on-the-sand poses. The bride was not
one for moving a lot, he says, so, “I put her
in one position, and I moved. I achieved the
scenery and look we wanted, but instead of
moving them I moved me.”
Within the four stages of the wedding
day, Nissle works the angles. “I’m high, I’m
low, I’m far away, I’m close. By doing that
diversity, you have a special wedding.” And
with his detailed attention to preparation,
he can more easily handle the unexpected,
from unscripted delights to hiccups in the
festivities. “A lot of photographers won’t do
weddings because they don’t want the stress.
I don’t worry about it because I’ve solved all
the problems before I get there,” he says. “It’s
all knowledge, preparation, planning, and hav-
ing the right equipment. Keeping it simple.”
Nissle, who cut his photographer’s teeth
on twin lens Mamiya cameras while working
for his father and switched to Hasselblad
when he took over the studio in 1978, has
been using the Nikon D300 DSLR for
past three years. He uses three f/2.8 Ni
zoom lenses: an 18-55mm, a 28-70mm
a 70-200mm. “If I could do an entire w
ding with available lighting, I woulddo i
says. For receptions he generally uses a
SB800 Nikon flash and sometimes his
year-old Norman 200B: “A workhorse
tough and powerful,” he says. “I’m still
school. I still use my SB800 and I’ll use
tle slave unit and plug it into my Norm
200B. I don’t have a radio-controlled u
On rare occasions, with a large wedding
large church, he will bring his White L
ning studio lights and umbrellas for th
mal portraits.
Ken Nissle started a photography st
in a large Los Angeles restaurant in 194
and met his future wife, Dorothy, when
hired her as a camera girl to photograp
people at the tables. After they married
124 • www.ppmag.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 125/148
Cases & Bags
Lenses
Take a virtual reality tour of Digital HTfilter effects at tiffen.com
s Digital Ultra Clear™
s Haze 86(with 86% UV absorption)
s Circular Polarizer
s 812® Warming Filter
s ND 0.6
s ND 1.2
s Soft/FX® 3
s Star 4 Point 2
s Color-Grad® ND 0.6
Tiffen’s Digital HT filters are available as:
In sizes 52mm-82mm withdistinctive soft pouch for storage.
Digital HT™
A Major Breakthrough
in Multi-Coated Filter
Technology
D80036.3MP professional HDSLR
that breaks new ground in
resolution and metering
technology.
Full 1080p HD broadcast
quality video and minimized
rolling shutter
View simultaneous Live View
output on external monitors
and record uncompressed
video via HDMI terminal
SLR Digital Cameras
5D Mark III22 megapixel CMOS sensor
ISO range 100-25600,
14-bit A/D conversion
Shutter speeds 1/8000-30
seconds, 63-zone dual layer
iFCL Metering, 61-point high-
density reticular AF with up to
41 cross-type points, 3.2-inch
3*+ÄUKLY^P[OTPSSPVU
dot resolution
OM-D E-M5
16.1Mp, TruePic VI Image
Processor, 3.0” Tilting OLEDMonitor, M.Zuiko Digital ED
12-50mm F3.5-6.3 Lens, Eye-
3L]LS=PL^ÄUKLY9(>17,.
Still File Formats, 200-25,600
ISO Sensitivity, TTL Flash
Compatibility, 1920 x 1080 HD
Video Capture
)XMLðOP;352
16.3 Megapixels, APS-C
X-Trans CMOS Sensor,3.0” LCD Monitor,
Hi-Speed USB 2.0
(7:*_TT-\QPÄST
X Mount Lens Mount
XF Lens Series Compatibility
/`IYPK4\S[P=PL^ÄUKLY
1920 x 1080 HD Video w/
Stereo Sound
SD/SDHC/SDXC Memory
Card Compatibility
6'0>VYSK»ZÄYZ[M\SSJVSVYPTHNL
sensor: Foveon X3
46 Megapixel image sensor
Splash proof design pre-
vents dust and water from
getting inside the camera
body
C h e c k
o u r
c u r r e
n t
p r o m o
t i o n s
C h e c k
o u r
c u r r e
n t
p r o m o
t i o n s
C h e c k
o u r
c u r r e
n t
p r o m o
t i o n s
:;(9;05.(;
$3499.00
:;(9;05.(;
$2999.95
:;(9;05.(;
$999.00 $1399 .00
AFTER $500
REBATE
$1799.00
85mm
f/1.4 Telephoto
Manual Focus Lens
for SLR Cameras
PP
f/2.8 Aspherical
>PKL(UNSL3LUZ
for SLR Cameras
8mm
f/3.5
Manual Focus,
Fish Eye Lens$349.00 $279.00 $279.00
DSLR SLT-A99V Body
Digital SLR Camera Body,
Full Frame 24 MP,
IP[9(>6\[W\[
Full 1080p
HDMI Output,
Dual AF System Stabilization,
Built-In Flash & Hot Shoe
:;(9;05.(;
$2798.00
3KRWR+DWFKEDFN
22L AWIs an excellent choice for
HKH`V\[PU[OLÄLSK
$107.95
Airport
6LJKW-V\Y>OLLS
Roller, Black
$249.95
*HDU3DFN'/
Backpack for DSLR with16-35mm f/2.8 Attached/2
Lenses/Flash
$59.99
PP
f/3.5-f/6.3 DI-II VC
PZD Piezo Drive Ultrasonic
Motor Aspherical (IF) AF
Zoom with Macro
PP
F/2.8 Di VC USD
(ZWOLYPJHS0- (->PKL
Zoom Lens
$549.00*
$1299.00*AFTER REBATE
PP
f/2.8 EX Aspherical
0-,?+./:4 AutoFocus
Zoom Lens
$824.00*
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 126/148
formed Belle n’ Beau, a banquet center and
photography studio in Monterey Park,
Calif. “I grew up in that environment,”
Steve Nissle says. After he graduated from
Brigham Young University in 1977 with a
degree in youth leadership/business, he
took over running the photography studio
the next year and purchased it in 1979,
diversifying into other types of photogra-
phy. After his father retired, Nissle moved
the studio to Arcadia, Calif., in 1986, and
then moved to Arizona in 1992. He bought
commercial property there for the studio 13
years ago, and in December 2011 with the
downturn of the economy, he moved the
studio back into his home. “The children
are gone, it’s a big home, and it’s paid for,
so I work out of my home.” He leases the
commercial property and uses its half-acre
of grass and trees for many of his portraits.
His son Nolan and daughter Shari are
photographers with their own businesses.
One or the other assists Nissle in his w
ding shoots, and he assists them in th
Nolan, whom Nissle calls a “Photosho
guru,” builds the wedding albums for
Nissle’s clients.
Nissle currently shoots about 15 we
dings a year, down from 50 to 60. Par
the drop is due to the economy, he say
advertising costs have “become kind o
prohibitive.” Now, he relies totally on
of mouth. He keeps busy with family a
other portraits, commercial assignme
and events.
When he does get a wedding assign
he brings two generations—now three
erations—of experience and a whole lo
love to the event. I
Steve Nissle’s portfolio is at nisslephoto
Eric Minton is a writer and editor withthan 35 years of experience.
126 • www.ppmag.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 127/148
ú[ú
'HVKDGRZ%R[
Portable still life studio-in-a-
bag with 16” x 16” soft light
box, halogen lamps, blue
background sweep, a custom
carrier and camera stand. An easy on-the-go lighting
solution
5LQJ/LJKWZV
:RUNVRQ'&EDWWHU\
Complete Kit
Unique light source ensuring
totally shadowless but con-
centrated illumination for high
contrast or high key lighting.
Accept almost any lens of anyformat camera, including 4” x
5” view cameras with digital
backs.
LQ&ROODSVLEOH'
5HñHFWRU
Translucent, white, black s
and gold surfaces. Perfect
reducing contrast, warmin
skin tones, eliminating sha
ows or just softening light.Can be held by hand or lig
stand. Available in three si
$29.95$395.00
:;(9;05.(;
$16.95
Budget Studio Monolight
Flash Basic Kit
ZV%DWWHU\3RZHUHG
)ODVK.LW3RZHU
Dial-down
FPBK1
$199.95FPBPL
$199.95
)\PS[PU:SH]L
8\PJR9LJ`JSPUN
(KQ\Z[HISL6\[W\[
Includes
>:-SHZO
Units
Light Stands,
Umbrellas &
Lighting Case
Comes complete with removable battery
Can be used in a softbox
400 w/s of power with dial down one stop kit
includes battery, charger & light unit Light Unit is
shoe mountable, ni-mh battery 12 volt 3300 mAh
Also Available
Soft boxes
Snoots
Barndoors
Gels & Filters
Remote Triggers
Video
Shootskate Kit
IRUL3KRQH
Swinging front and rear
axles can be locked
$79.95
at angles for curving or circular
iPhone movemtent
Skate can be moved in a tight
circle for full 360-degree close-up
iPhone video 1/4-20 tripod screw
allows mounting of a variety of
tripod heads and support arms
For Compact Digital Camera
Camcorders
HUK+:39»Z\W[VSIZ
Also Useful when using youSmartphone. Take the Video
Stabilizer wherever the actio
takes you - up and down sta
indoors and outside, throug
crowds - almost anywhere,
precise, elegant control
and ease
6WHDG\&LQH6WDELOL]H
$49.95$12.95
Weight Sand Bag
Holds 10 Lbs., Shipped
,TW[` 3HYNLOHUKSLVUIV[O
ZPKLZ 4HKLVMU`SVUMHIYPJ
with two heavy duty zipperson each side of the saddle
bag to increase strength and
resist leakage.
;OLZLIHNZTH`ILÄSSLKVU
location with sand, etc.
Always use a sand bag on the
tripod base or a light stand
when using a boom arm.
Easy-Shoot Solutions
Background Support System
for a full
line of
Muslin
EDFNJURXQGV
3RUWDEOH
Stand
â6WDQG â6WDQ
FPBS13B
$59.95FPBS10
$84.95FPBS13
$129.9
The background stand
comes with
interlocking 4 sec-tion crossbar. and a
handy carrying bag with
compartments.
The top of the stand
meets the crossbar th
is a screw and wing nto keep the crossbars
secured to the stands
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 128/148
BY STEPHANIE BOOZER
Though she’s been in b
ness for 14 years, Julie
Klaasmeyer, M.Photo
of Kansas City, Kan.,
some ways a photogra
just coming into her own. She ran a thr
studio all those years, with a distinctiv
style and smiling determination that
brought in a full clientele. Yet her non
drive and energy actually punished he
little. She landed practically every pot
client who crossed her path, but her li
zoomed past in a blur. Waking from w
she calls a “photo coma,” Klaasmeyer
now focused, poised, and in control.
“I was doing everything everyone as
me to do,” she says. “I was moving in th
same direction as everyone else. That w
how I wanted to work—I wasn’t being to myself. Now, I can think more clearl
I ever have in my life. I’ve learned a val
lesson by doing things the wrong way.
What Klaasmeyer calls “the wrong
looks very right on paper. She’d pulled
enough sales to move from a 1,000-sq
foot home studio to a 9,000-square-foo
space with three bays of 16x20-foot win
and a remote-controlled turntable of e
photo sets she calls her “rotating dollho
She was sought after by peers for advic
teaching, and after answering countles
inquiries from other photographers ab
her props, fabrics, and backdrops, she
off another successful business, Design
olution, which sells elements of her sig
ture look. Sales weren’t her problem.
All images ©Julie Klaasmeyer
Freedom to let goLimiting bookings enhanced Julie Klaasmeyer’s exclusivity
T
P O R T R A I T S
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 129/148
With four children between the ages of 7
and 21 (the youngest was her husband’s ploy
to slow her down, she jokes), Klaasmeyer felt
she was missing out on a few important
things, like her life. Last year she made
the decision to limit herself, not in terms of
sales, but in precious time.
NARROWING THE NICHE
“It was kind of like ripping off a Band-Aid,”
says Klaasmeyer, who narrowed her niche to
babies and children and jettisoned the fam-
ily and senior sessions that were bogging her
down creatively. “We did it in one month. We
didn’t want our schedules filling up with things
we weren’t happy doing, so we took action.”
First, Klaasmeyer raised the fees for her
family and senior sessions and the mini-
mum purchase amounts, which made the
few sessions she agreed to do worth her
time. She viewed the measure as a floodgate:
If she reached the new maximum bookings
for the week, family portrait seekers would
find that the only sessions available carried
higher prices. If she was under-booked for
the week, she could make the originally
priced sessions available.
“That is what saved me,” says Klaasmeyer.
“The simple realization that I don’t ne
to photograph everyone. I need this m
sessions per week at this minimum,
period. We can open and close the flo
gate as needed.”
Dialing in control over bookings al
enhanced her perceived value to poten
clients. She’d successfully built up her
brand, and now her new focus adds an
aura of exclusivity.
“We tell them all of the pricing up fr
I don’t want them to have any surprise
they have qualms with that, it’s taken c
right then,” says Klaasmeyer. “And it tells
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 130/148
there’s a difference between me and every-
one else. It says we’ll do a great family por-
trait, not one they could get just anywhere.”
In another strategic change, Klaasmeyer
partnered with photographer and former
employee Missy Gharst to share her studio
space and overhead. Gharst continues to
market herself independently and is Klaas-
meyer’s prime referral for wedding, senior,
and family photography. “We don’t work for
each other, and we don’t owe each other
anything,” notes Klaasmeyer, who says the
new arrangement is working out splendidly.
SUCCESS TRAP
Like many photographers starting out,
Klaasmeyer fell into a system of working
ever harder to be successful. But the momen-
tum of the constant push became a trap. She
felt she needed to maintain a breakneck
pace just to hold her stake in the market. It’s
an issue she addresses when she’s teaching
classes to other photographers.
“You can be good at a lot of things, but
you can’t be great at everything,” she says.
“It’s so easy these days to make a website
and throw up a Facebook page. But I hear it
all the time, people finding out that this
[emphasis on doing it all] is not for them.
The people who live and breathe this, the
people who really care about this, those are
the people I’m trying to educate, to remind
that you have to be passionate about some-
thing else, too, or you’ll be consumed.”
Recharged and refocused, Klaasmey
finally has the balance she sought. She
able to take Mondays off in the summe
be with her kids, for example, and her
life feels like it’s under control.
“I thought being that busy made me
happy, but it didn’t,” says Klaasmeyer.
was scary at first, but I’m digging the w
things are going right now. We got rid
lot of anxiety, and I know now it’s OK
that something isn’t my specialty. That
me back my control.” I
See more of Julie Klaasmeyer’s work at jklaasmeyer.com.
Stephanie Boozer is a writer in Charleston
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 131/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 132/148
Celebration of Smiles is a nationwide fundraiser for Operation Smile, presented by PPA Charities in cooperation withMarathon Press. Participating photographers host an event where clients donate a minimum of $24 for a portrait mini
session and desk-sized portrait, and 100% of donations go to support Operation Smile.
Register & Learn More Now: PPAcharities.com
For every 10 sessions a studio photographs during this Celebration of Smiles event, one child will receive the life-changing gift
surgery from Operation Smile, a worldwide children’s medical charity focusing on facial deformities. Think how many smiles you co
help save by joining in this one-day event! Think how your name recognition and repeat business could grow!
Join in the “Celebration of Smiles” April 6, 2013
y Celebration of Smiles Marketing Guide & promotional materials you can use.
y Studio name & website listed on CelebrationOfSmiles.com.
y Weekly reminder emails to keep your marketing on track for the event.
y Uplifting goodwill!
P h o t o s c o u r t e s y o f O
p e r a t i o n S m i l e
The Professional Photographer’s Marketing Partner
Join for Only
$25& Receive:
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 133/148
Happy
New
Year!
March 1 begins
the new year
for the board of
directors and
RIʏFHUVRI\RXU
organization. I
am very excitedWRZHOFRPHRXU
newest board
member and
WRFRQWLQXHWR
serve with those
I have had the
SOHDVXUHRIZRUNLQJZLWKRYHUWKHSDVWHLJKW\HDUV7KH
RSSRUWXQLW\WRQRZVHUYHDV\RXU33$3UHVLGHQWIRUWKHQH[W
12 months is both an honor and privilege.
:KHQ,MRLQHG33$LQ5LFKDUG1L[RQZDVSUHVL-
GHQWDJDOORQRIJDVRQO\FRVWFHQWVDQGDJDOORQRIPLON
7KLQJVKDYHFHUWDLQO\FKDQJHGVLQFHWKHQ:KHQ MRLQLQJ,ZDVDȍQHZELHȎDSDUWWLPHZHGGLQJSKRWRJ-
UDSKHUZLWKRXWDOLFHQVHZKREDUHO\NQHZWKHGLIIHUHQFH
EHWZHHQDQIVWRSDQGDEXVVWRS0\ʏUVWLQWURGXFWLRQWR
SKRWRJUDSK\ZDVLQWKH1DYDO$FDGHP\DQGRQO\WZR\HDUV
RXWRI1DY\3KRWR6FKRRO,NQHZ,ZDQWHGWREHDSURIHV-
sional photographer.
:KDW,IRXQGZKHQ,MRLQHG33$PDGHDOOWKHGLIIHU-
HQFH7RPH33$LVIULHQGVKLSV33$LVHGXFDWLRQ33$
LVIDPLO\33$LVDERXWSURYLGLQJDLGLQ\RXUVHDUFKIRU
VXFFHVVLQRXUJUHDWSURIHVVLRQ
7REHVXFFHVVIXOWKUHHWKLQJVDUHQHFHVVDU\SURJUHVV
JURZWKDQGFKDQJH7KHRQO\WKLQJFRQVWDQWLVFKDQJH
7KDWJDOORQRIJDVKDVLQFUHDVHGLQSULFHVLQFH,
ʏUVWMRLQHG33$0DQ\WKLQJVKDYHFKDQJHGLQRXULQGXVWU\
DVZHOOODUJHIRUPDWFDPHUDVFKDQJHGWRPHGLXPIRUPDW
WKHQWRPPFDPHUDVZLWKTXDOLW\ʏOPV7KHQWKHGLJLWDO
UHYROXWLRQEHJDQXVKHULQJLQPDQ\PRUHFKDQJHVUHTXLULQJ
SKRWRJUDSKHUVWREHFRPHFRPSXWHUH[SHUWVDQGPRUH7KH
ʏUVWGLJLWDOFDPHUD,SXUFKDVHGFRVWWKHVDPHDVWKHDYHUDJH
QHZKRPHGLGLQDQGKDGIHZHUPHJDSL[HOVWKDQP\
smartphone does now.
7REHDQGUHPDLQVXFFHVVIXOZHPXVWQRWRQO\SUHSDUH
RXUVHOYHVIRUVXFKFKDQJHZHPXVWHPEUDFHLW7KHGLJLWDO
DJHKDVOHGWRWKHLQIRUPDWLRQDJHZKLFKPHDQVRXU
FRPPXQLFDWLRQLVLQVWDQWDQHRXV2XUUHDFKLVORQJHUDQG
FKHDSHUWKDQLWKDVHYHUEHHQ)XVLRQLVXSRQXVRIIHULQJWKH
FRPELQDWLRQRIVWLOOVDQGYLGHR:HPXVWOLVWHQWRRXUFOLHQWVDQGVHOOWKHPZKDWWKH\ZDQWZKDWWKH\QHHGDQGZKDWWKH\
QHYHUNQHZWKH\QHHGHG
Yet the paper portrait is not dead! It lives on the walls
RIRXUFOLHQWVȊKRPHV(PEUDFLQJFKDQJHWKRXJKPHDQV
\RXKDYHWKHRSSRUWXQLW\WRVHOOPRUH<RXFDQGLIIHUHQWL-
DWH\RXUVHOIE\VHOOLQJQHZDQGH[FLWLQJSURGXFWV<RXFDQFRQWLQXH\RXUHGXFDWLRQDQGHQVXUH\RXDUHWKHDXWKRULW\
RQSKRWRJUDSK\WR\RXUFOLHQWV<RXUFOLHQWVFRPHWR\RX
EHFDXVHRI\RXUH[SHUWLVHVRPDNHVXUHWKDWLVZKDWWKH\
receive.)
,WUXO\EHOLHYHWKDWFRQWLQXLQJHGXFDWLRQLVWKHFKDQJH
UHTXLUHGIRUXVWRDOZD\VVKLQHDVSURIHVVLRQDOV,WLV
not expensive and can be as simple as following some-
RQHȊVZHEVLWHRUMRLQLQJIRUXPVOLNHWKHFRPPXQLWLHVRQ
33$ȊVWKH/RRS1HYHUPLVVRQHZRUGRIRXU Professional
PhotographerPDJD]LQHZKLFKLVIXOORISURʏWDEOHLGHDV
DQGDQVZHUVWRDOOW\SHVRIVLWXDWLRQV'RQȊWPLVVDJXLOG
meeting or a state or district convention and never miss the
RSSRUWXQLW\WRDWWHQG,PDJLQJ86$
0\ZLIH&LQG\DQG,LQWHQGWRYLVLWDVPDQ\RI\RXDV
SRVVLEOHWKLV\HDU,DPH[FLWHGDERXWWKHRSSRUWXQLW\WRVHH
DOOWKHGLIIHUHQWVXFFHVVHVRI33$PHPEHUV:HZLVK\RX
health and prosperity in this new year. Keep smiling!
PPATODAYMARCH 2013
PRESIDENT’SMESSAGERalph Romaguera Sr., M.Photog.Cr., CPP, API, F-ASP. :: 2013-2014 PPA President
FRP
“To be and remain successful,we must not only prepare ourselves for such change, we must embrace it!”
YOUR SUCCESS IS OUR BUSINESS
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 134/148
TO OWN A BUSINESSOR NOT TO OWNHOW TO MAKESMART CHOICES
FOR YOUR SUCCESSBy Angela Wijesinghe
II\RXWKLQNDERXWSURIHVVLRQDOSKRWRJUDSKHUV\RXWHQGWR
WKLQNDERXWSHRSOHZKRRZQVPDOOEXVLQHVVHV7KDWȊVWKHRQO\
ZD\WRHVWDEOLVK\RXUVHOIDVDSURDQGEHVXFFHVVIXOULJKW"
1RWH[DFWO\0DQ\SKRWRJUDSKHUVGRZDQWWRUXQWKHLURZQVWXGLRV
DQGUHOLVKWKHʐH[LELOLW\RIWLPHDQGGHFLVLRQPDNLQJLWJLYHV
WKHP7KH\JHWWRVKRZWKHLUYLVLRQWRWKHZRUOGDQGUXQWKHLU
VWXGLRVWKHLUZD\+RZHYHUWKDWȊVQRWWKHRQO\ZD\WRʏQGVXFFHVV
DQGIXOʏOOPHQWDVDSURSKRWRJUDSKHU
0D\EH\RXGRQȊWZDQWWRGHDOZLWKDOOWKDWEHLQJDEXVLQHVV
RZQHUHQWDLOV0D\EHWKDWWKRXJKWPDNHV\RXTXHDV\0D\EH
\RXȊGUDWKHUIRFXVVROHO\RQZKDW\RXGREHVW7KHQPD\EHEHLQJ
DSURIHVVLRQDOSKRWRJUDSK\HPSOR\HHLVPRUHXS\RXUDOOH\
%HLQJDVWXGLRRZQHURUZRUNLQJIRURQHDUHERWKYDOLG
RSWLRQV,WMXVWGHSHQGVRQZKDWVXLWV\RXEHVW$QGIRUWKDW\RX
KDYHWRGRVRPHVRXOVHDUFKLQJWRGHWHUPLQHZKDWȍVXFFHVVȎ
UHDOO\PHDQVWR\RX33$PHPEHUV0LFKHOOH7LEELOVDQG-HQQLIHU
(QJOHUW)UDQFLV03KRWRJHDFKPDGHGLIIHUHQWFKRLFHVVROHDUQ
ZK\LWZRUNVIRUWKHPDQGZKDW\RXPD\ZDQWWRFRQVLGHU
Studio Ownership: Is It for You?
6RPHWLPHVUXQQLQJ\RXURZQSKRWRJUDSK\EXVLQHVVLVZKDW
\RXIDOOLQWRGRLQJ7LEELOVIRUH[DPSOHZRUNHGIXOOWLPHDWD
high-tech job in California and spent increased personal time with
SKRWRJUDSK\RQFHKHUVRQ7DQQHUQRZZDVERUQ6RRQVKH
ZDVSKRWRJUDSKLQJRWKHUSHRSOHȊVFKLOGUHQDQGIDPLOLHV%\WKH
WLPH7DQQHUZDVDQGVKRUWO\DIWHUKHUVHFRQGFKLOG0D[ZDV
ERUQVKHVWDUWHGDSKRWREXVLQHVVRQWKHVLGH,Q\HDUVVKH
JUHZWKDWSDUWWLPHEXVLQHVVWRWKHSRLQWVKHQHHGHGWRFKRRVHMXVW
RQHSURIHVVLRQ*XHVVZKLFKVKHSLFNHG
7LEELOVȊVWXGLRRZQHUVKLSZDVWKHULJKWFKRLFHIRUKHUIRUD
YDULHW\RIUHDVRQV$OORIKHUSUHYLRXVZRUNH[SHULHQFHOLNHVDOHV
VNLOOVKHOSVKHUUXQWKHEXVLQHVVWRGD\7HVWLQJLWSDUWWLPHDOVR
DOORZHGKHUWREXLOGDVROLGFOLHQWEDVHDQGHOLPLQDWHDQ\ʏQDQFLDOVWUDLQ%XWZKDWUHDOO\PDNHVLWDIXOʏOOLQJFDUHHUFKRLFHLVWKDW
VKHȊVKDSS\
ȍ,IHHOOLNH,KDYHWKHXOWLPDWHʐH[LEOHFDUHHUȎ7LEELOVVD\V
ȍ,FDQVHWP\RZQVFKHGXOHȆDERRQZLWKP\EXV\IDPLO\OLIHȆ
DQGWKHYDULHW\DQGTXDQWLW\RIZRUNLVSHUFHQWXSWRPHȎ
$ERYHDOOVKHORYHVWKDWVKHZLOOOHDYHDPDUNEHKLQGRQSHRSOHȊ
KHDUWVZKHQVKHSDVVHVRQȍ,ORYHFUHDWLQJVRPHWKLQJ,NQRZ
P\FOLHQWVZLOOWUHDVXUHDQGJHWSOHDVXUHIURPIRUPDQ\\HDUVWR
FRPHȎ
6WLOO7LEELOVNQRZVʏUVWKDQGWKDWWKHUHDUHWRXJKFKDOOHQJ
WREHLQJLQFKDUJH$ORQJZLWKDGHJUHHRIXQFHUWDLQW\DERXW
ZKHWKHURUQRW\RXZLOOEHVXFFHVVIXOȍWKHUHȊVQRRQHWRKDQGWKH
ZRUNRIIWRȎ:KHQKHUPRWKHUEHFDPHFULWLFDOO\LOODQGSDVVHG
DZD\ODVWVSULQJ7LEELOVKDGWRWDNHDERXWIRXUZHHNVRIIȓKDOWLQ
HYHU\WKLQJȍ,KDGDIXOOPRQWKȊVFDOHQGDUWRUHVFKHGXOHSRVWSRQ
FDQFHORUSDVVRIIWRSHHUVDQG,KDGWRPDNHVHYHUDOFOLHQWFDOOV
IURPWKHKRVSLWDOȊVZDLWLQJURRPȎ
,I\RXGRGHFLGHWRVWDUWDEXVLQHVVDQGZRUNIRU\RXUVHOI
WKHUHDUHVRPHVNLOOV7LEELOVVD\V\RXVKRXOGFXOWLYDWH7LPH
PDQDJHPHQWLVNH\Ȇ\RXQHHGWRVWUXFWXUHDQGVWUHDPOLQHKRZ
WRUXQWKHEXVLQHVVLWVHOIFUHDWHDQHIʏFLHQWZRUNʐRZHYHU\WKLQJ
%XWSULRULWL]LQJGRHVQȊWPHDQ\RXȊOOJHWWRHYHU\WKLQJRQWKHOLV
<RXȊOOEHZHDULQJORWVRIKDWVZKLFKPHDQVWKLQJVFDQVOLSE\
7LEELOVDOVRWRXWVWKHLPSRUWDQFHRIEHLQJDVKUHZGEXVL-
QHVVSHUVRQȍ%HLQJJUHDWFUHDWLYHO\GRHVQȊWPHDQLWȊVWLPHWR
VWDUWDEXVLQHVVȎVKHH[SODLQVȍ'R\RXXQGHUVWDQGQXPEHUVDQ
EXGJHWV"'R\RXNQRZZKDWLWWDNHVWREHSURʏWDEOH"Ȏ6LPLODUO\
\RXQHHGWRUHFRJQL]HWKHQHHGIRUFKDQJHDQGGRLWȍ,KDWH
FKDQJHEXW,NQRZLWȊVDQHFHVVLW\LI,ZDQWWRVWD\LQDQLQGXVWU\
WKDWȊVFRQVWDQWO\HYROYLQJȎ
0RVWRIDOO7LEELOVVD\VLWȊVLPSRUWDQWWRGHʏQHZKDWVXFF
LVWR\RXEHIRUHPDNLQJFKRLFHVȍ)LQDQFLDOO\,KDGDJUHDW\HDU
LQEXW,HQGHGXSZRUNLQJPRUHWKDQ,ZDQWHGWRȎVKHVD\
ȍ)RUPHVXFFHVVLQLVQȊWJRLQJWREHUHDFKLQJDKLJKHUVDOH
UHYHQXHLWȊVJRLQJWREHKDYLQJPRUHSHUVRQDOWLPHDQGEDODQFLQ
P\KRPHDQGZRUNOLIHȎ$VWKHRZQHU\RXKDYHWRGHFLGHZKHUWRWDNH\RXUEXVLQHVVHDFK\HDUDQG\RXZDQWWRWDNHLWLQDGLUHF
WLRQWKDWOHDGVWR\RXUKDSSLQHVV
Studio Employment: Is It for You?
$QRWKHUFDUHHUSDWKLVWKHFKRLFHWRJRLWDVDSURIHVVLRQDOSKRWR
UDSKHUȓZKRVLPSO\ZRUNVIRUVRPHRQHHOVH7KDWȊVWKHURXWH
(QJOHUW)UDQFLVGHFLGHGWRWDNHDIWHUEHLQJVFRXWHGLQFROOHJHE\
$QJHOD.XUNLDQRZQHURI(VVHQ]D6WXGLRLQ2KLR
ȍ2ULJLQDOO\,WKRXJKWP\RQO\RSWLRQZDVRSHQLQJD
VWXGLR7KHUHȊVDORWRISUHVVXUHLQWKHLQGXVWU\WRGRWKDWȎ
QRWHV(QJOHUW)UDQFLVȍ2YHUWKHODVW\HDUV,ȊYHRIWHQEHH
DVNHGZK\,QHYHUVWDUWHGP\RZQVWXGLR3HRSOHWKLQNWKDWȊZKDW,QHHGWRGRWRPDNHPRQH\RUEHKDSS\DQGVXFFHVV -
IXOȎ%XWWRGD\VKHȊVD0DVWHURI3KRWRJUDSK\33$GHJUHH
DQGWKHSURGXFWLRQPDQDJHUIRU(VVHQ]D6WXGLRIRFXVLQJRQ
VHQLRUSKRWRJUDSK\DQGPDQDJLQJWKHVWXGLRȊVSURGXFWLRQ
FRPYOUR SUCCESS IS OUR BUSINESS
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 135/148
WHDPȓDQGVKHDEVROXWHO\ORYHVZKDWVKHGRHV
1RWHYHU\RQHZRXOGEHKDSS\LQWKLVSRVLWLRQMXVWDVQRW
HYHU\RQHZRXOGEHKDSS\UXQQLQJDVWXGLREXW(QJOHUW)UDQFLV
VD\VWKHKRQHVW\DQGRSHQQHVVRIKHUHPSOR\HUPDNHVLWZRUN
ȍ,WȊVDUHDOO\IXQDQGSRVLWLYHFUHDWLYHZRUNHQYLURQPHQWZKHUH
LGHDVDUHHQFRXUDJHGHJRVDUHSXWDVLGHDQGFUHGLWLVJLYHQZKHUH
FUHGLWLVGXHȎVKHVD\Vȍ7KDWZDVHVVHQWLDOLQKHOSLQJPHGHFLGH
WRZRUNKHUHȎ)URPWKHJHWJRKHUHPSOR\HUZDVYHU\RSHQ
DERXWWKHEXVLQHVVDQGZKHUHVKHZDQWHGWRWDNHLWVKDULQJDOOWKHSHUNVGRZQIDOOVHYHQWKHQXPEHUVȍ6KHVKRZHGPHWKHUHDO
UDZVLGHRIUXQQLQJDEXVLQHVVZKLFKZDVVPDUW,WUXVWHG$QJHOD
EHFDXVHVKHVKRZHGPHHYHU\WKLQJ%HFDXVHVKHLQYHVWHGLQPH
,LQYHVWHGLQWKHEXVLQHVVZLWKP\H[WUDWLPHDQGWDOHQW6KHWKHQ
KDGDGHGLFDWHGOLIHWLPHHPSOR\HHZKRFRXOGKHOSPRYHWKHEXVL -
QHVVIRUZDUGDQGPDNHJUHDWGHFLVLRQVȎ
3OXV(QJOHUW)UDQFLVLVDEOHWRIRFXVRQZKDWVKHORYHVWR
GRSKRWRJUDSK\SURGXFWLRQDQGPRVWRIDOOVSHQGLQJWLPHZLWK
KHUKXVEDQGȍ5XQQLQJDEXVLQHVVLVQRWVRPHWKLQJ,ZDQWWR
VSHQGP\OLPLWHGVSDUHWLPHGRLQJȎVKHODXJKVȍ0RVWSHRSOH
GRQȊWUHDOL]HWKLVXQWLOWKH\ȊYHZRUNHGWKHLUEXWWRIIRQWKHLURZQ
,ȊPIRUWXQDWHWRZRUNP\EXWWRIIZLWKDQDZHVRPHFUHDWLYHWHDPZKHUH,ȊPIXOʏOOHGDQGKDSS\Ȏ
<HWHPSOR\PHQWLVQRWDOONLWWHQVDQGUDLQERZV3KRWRJUDSK\
LVDQHPRWLRQDOLQGXVWU\VRDORWRILWGHSHQGVRQWKHSHUVRQ\RX
ZRUNIRUȆ\RXUSHUVRQDOLWLHVRUYLVLRQVFRXOGFODVKOHDGLQJWR
IUXVWUDWLRQRUGLVVDWLVIDFWLRQ,I\RXIHHOVWURQJO\DERXWDFHUWDLQ
LGHDEXW\RXUHPSOR\HUGRHVQȊWDJUHH\RXȊUHRXWRIOXFN$QG\HV
\RXUSD\FRXOGEHOHVV
3URVDQGFRQVDVLGHLWDJDLQFRPHVGRZQWRKRZ\RXGHʏQH
VXFFHVV,VLWEHLQJDQRZQHUZLWK\RXUQDPHRQWKHERDUGDQG
WKHȍIDPHDQGIRUWXQHȎ\RXUVWRVHHN",IQRWGRQȊWWKLQNLWȊV
EHFDXVH\RXFDQȊWGRDOOWKDWDVWXGLRRZQHUZRXOGKDYHWRGR
ȍ<RXcanGRLWDOOEXWGR\RXZDQWWR"ȎDVNV(QJOHUW)UDQFLVȍ$
YHU\LPSRUWDQWTXHVWLRQWRDVN\RXUVHOILVȉ:KDWGR\RXZDQWWR
VSHQG\RXUWLPHDQGOLIHGRLQJ"Ȋ7KHUHȊVQRWHQRXJKWLPHWRKDYH
HYHU\WKLQJVRSULRULWL]HDQGPDNHSHDFHZLWK\RXUGHFLVLRQVȎ
6RKRZGR youGHʏQHVXFFHVV":RXOGQȊWLWEHQLFHLIWKLVDUWLFOHHQGHGZLWKDGHʏQLWLYHDQVZHU"+RZHYHU\RXȊUHWKH
RQO\RQHZKRNQRZV\RXUWUXHVWUHQJWKVZHDNQHVVHVZDQWVDQG
GHVLUHV6HDUFK\RXUVRXOZHLJKWKHSURVDQGFRQVDQGVHHNWKH
SDWKȆWRRZQRUQRWWRRZQDEXVLQHVVȆWKDWZLOOOHDGWR\RXU
KDSSLQHVV-XVWGRQȊWHYHUIHHO\RXKDYHRQO\RQHRSWLRQ
Michelle Tibbils owns and operatesBugs and Butterflies Photography inCampbell, Calif.bugsandbutterfliesphotography.com
Jennifer Englert-Francis, M.Photog., isthe production manager at EssenzaStudio in Milford, Ohio.essenzaseniors.com
FLIP THEPAGE TOMEETOUR NEWBOARD O
DIRECTOR
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 136/148
WELCOME TO THENEW BOARD2013-2014 BOARDOF DIRECTORSBy Angela Wijesinghe
WKDWGR\RXJHWZKHQ\RXEULQJWRJHWKHUDJURXS
RIVXFFHVVIXODFWLYHWDOHQWHGDQGEXVLQHVV
VDYY\SKRWRJUDSKHUV"<RXJHWWKH33$ERDUGRI
GLUHFWRUV7KLVHVWHHPHGHQVHPEOHLVKHUHWRKHOSJXLGH\RXU
DVVRFLDWLRQLQSURYLGLQJWKHUHVRXUFHV\RXQHHGWRRYHUFRPH
the daily challenges of being a professional photographer
DQGNHHSJURZLQJ7KHLUJRDOLVWRKHOS youEHVXFFHVVIXO
-RLQXVLQZHOFRPLQJWKLV\HDUȊVERDUGRIGLUHFWRUVZKR
WDNHRIʏFHIURP0DUFKWR0DUFK
FRP
Ralph Romaguera Sr.
PresidentM.Photog.Cr., CPP, API, F-ASP
Susan MichalVice PresidentM.Photog.Cr., CPP, ABI
Michael GanTreasurerM.Photog.Cr., CPP
Tim WaldenChairman o the BoardM.Photog.Cr.Hon.M.Photog.,F-ASP
Don MacGregorM.Photog.Cr., API
Stephen Thetord
M.Photog.Cr., CPP
Michael TimmonsM.Photog.Cr., F-ASP
Lori Craf
Cr.Photog.
Rob BehmM.Photog., CPP
Audrey WancketM.Photog.Cr., CPP
Richard NewellM.Photog.Cr.
Mike FultonCr.Photog.
1HZ%RDUG0HPEHU
Lou GeorgeIndustry AdvisorBWC Photo Imaging
1HZ%RDUG0HPEHU
YOUR SUCCESS IS OUR BUSINESS
/HDUQPRUHDERXWDOOWKHERDUGPHPEHUVLQFOXGLQJWKHQHZHVWDGGLWLRQVRQOLQH
PPA.com/ppabod
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 137/148
Strengthen your business and boost those numbers when you turn to PPA’s Studio
Management Services (SMS). Our industry leading business workshops will help you
make sense of your numbers, make more money…and take back your life.
PPA.COM/SMS | 888.851.040
6 W D U W OR Y LQJ Z K D W \ RXP D N H
5 H J L V W H UQR Z W RF K D QJ H \ RX U
S KR W RJ U D S K\ EX V LQ H V V O L I H
Business Basics – Get up to speedon building a successful studio.
r .BSDI %VSIBN/$r +VOF "UMBOUB("r "VHVTU 4QSJOHΟFME."r 4FQUFNCFS $IJDBHP*-r 0DUPCFS )PVTUPO59r /PWFNCFS "UMBOUB("
Business Breakthroughs –5BLFZPVSQIPUPHSBQIZCVTJOFTTUPUIFOFYUMFWF
r +VMZ $JODJOOBUJ0)r /PWFNCFS "UMBOUB("
:063&-*7*/(8)"5:06-07& BUT ARE YOU LOVING WHAT YOU MAKE
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 138/148
LabTab
138 • www.ppmag.com
WHERE THE PROS GO FOR THE BEST IN REPRODUCTION SERVICES
LabTab 2013 ad rates:
• AD SIZE: 31⁄2 X 21⁄2
• 12X RATE: $510 PER MONTH
• 6X RATE: $650 PER MONTHSign a 12x contract and receive a double size feature ad tduring your contract year at no extra charge.
For more information, contact your advertising representa
TARA TRUITT, Eastern Region
404-522-8600, x230; [email protected]
MARINA ANDERSON, Central Region937-902-8217; [email protected]
AMY WALLS, Western Region ,
404-522-8600, x279; [email protected]
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 139/148March 2013 • Professional Photographe
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 140/148
LabTab WHERE THE PROS GO FOR THE BEST IN REPRODUCTION SERVICES
140 • www.ppmag.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 141/148March 2013 • Professional Photographe
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 142/148142 • www.ppmag.com
WHERE THE PROS GO FOR THE BEST IN REPRODUCTION SERVICES LabTab
2013 Affiliate Schools Schedule PPA members receive bothand the best published pric
April 28-May 3
Texas School of Professional
Photography, Dallas, texasschool.org
May 5-10
Mid-Atlantic Regional School of
Photography, Cape May, N.J.,
marsschool.com
June 2-6
Florida School of Photography, Daytona
Beach, Fla., fpponline.org
June 2-6
Mid-America Institute of Professional
Photography, Cedar Falls, Iowa,
maipp.com
June 16-19
Winona School of Photography,
Nashville, Ind., winonaschool.org
June 16-21
West Coast School, San Diego, Calif.,
www.westcoastschool.com
July 21-25
Image Explorations, Shawnigan Lak
British Columbia, imageexploration
July 21-26
PPSNYS Photo Workshop, Geneva
N.Y., ppsnysworkshop.com
Send additions to [email protected]
CLASSIFIED ADVERTISINGPlace a classified ad in the next issue oProfessional Photographer to reach ove
55,000 qualified buyers.For information contact:
Professional Photog rapher Classified Ads
229 Peachtree NE, Ste. 2200Atlanta, GA 30303
800-339-5451, ext. 221
PROFESSIONAL
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 143/148
Buyer’sGallery
THIS SECTION IS
THE MONTHLY
RESOURCE
PHOTOGRAPHERS
USE TO FIND
THE PRODUCTS
THEY NEED. PUT
YOUR MESSAGE
PROMINENTLY
IN FRONT OF
INDUSTRY PROS
AND START
TURNINGBROWSERS
INTO BUYERS.
March 2013 • Professional Photographe
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 144/148144 • www.ppmag.com
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 145/148
ACCOUNTING
NSF CHECK MANAGEMENT SERVICES. Since 1998 increasingprofitability, simplifying management responsibilities, and accel-erating cash flow for Sports, School, and Event Photographers.1-877-SureTrust (1-877-787-3878) Satisfaction guaranteed.
BACKGROUNDS
DENNY MANUFACTURING revolutionized the photo-graphic industry with the introduction of “Freedom Cloth”Wrinkle-Free Colorfast backdrops! Hundreds of innovativeand timeless designs are available. Complete the setwith a Roll Up Floor which is printed on a neoprenenon-skid backed material with edges that do not curlup. Visit www.dennymfg.com to view our vast arrayof photographic props and accessories, too!
www.facebook.com/dennymfg
ALBA BACKGROUNDS the leader in stock and custom back-drops for event photography—PROMS • HOMECOMINGS• THEMED DANCES • SPORTS • CORPORATE •WEDDINGS & CUSTOM DESIGN. 8.5f t x 9ft back -grounds starting at only $210. Over 500 from which tochoose. www.albabackgrounds.com • 888-666-4616.
CANVAS MOUNTING
CANVAS MOUNTING, STRETCHING, FINISH LAC-QUERING. Original McDonald Method. Considered bestAVAILABLE. Realistic canvas texture. Large sizes aspecialty. WHITMIRE ASSOCIATES, YAKIMA, WA. 509-248-6700. WWW.CANVASMOUNT.COM
COMPUTER/SOFTWARE
SUCCESSWARE®—Studio Management Software
available for both Windows® and Macintosh®.Recommended by Ann Monteith, the nation’s foremoststudio management consultant. Call today for a FREESuccessWare® Tour 800-593-3767 or visit our Web sitewww.SuccessWare.net.
HELP WANTED
HELP WANTED: Assistant photographer for contem-porary photojournalistic wedding coverages in OrangeCounty, CA area. Must have digital equipment. Email Johnat [email protected].
INCORPORATION SERVICES
INCORPORATE OR FORM an LLC today! Yourart is a business. Treat it like one. The Company Corporationcan help you incorporate or form a limited liability company inas little as ten minutes. We are fast, accurate and affordable.Provide additional credibility to your photography studio or
business at the fraction of the cost of using an attorney. Call 1-800-206-7276 or visit www.incorporate.com today!
LOOKING TO SELL SOMETHING? Then look no fartherthen the classified advertising section of Professional
Photographer magazine to get your service or productsold. For just a few cents per word you can reach 55,000+potential customers each month in our printed and digitialissues. Closing for the April issue is February 25th.For more information, or to submit your classifiedadvertisement, contact Monique Martin [email protected] or 404-522-8600, ext 221. All adsmust be prepaid. Rates: $1.50 per word; $2.00 per wordfor caps and bold face. Confidential reply box ads(optional) $10.00 per issue. Minimum $30.00 per ad.
PACKAGE CHOICE Insurance Program for photoby Hill & Usher. Available Natonwide. Completquestionnaire, receive customized insurance pAccidental Breakage, Theft, Rented GeaReplacement, Errors & Omissions, Free Certwww.PackageChoice.com; 866.977.4725.
LAB SERVICES
ACADEMY PRODUCTIONS INC.INNOVATIVE PRINTING SOLUTION
Complete Imaging Service for today’s
professional photographerProcessing—Proofing—Film—Digital Files
—SOS—
Self Ordering System powered by ROES
• High Volume Packages—Kodak Product
• Schools—Daycares—Sports—Proms—Sen
• Studios—Store Promotions—Fundraisers—We
• Composites—Collages—Other Unique Prod
• High Tech Printing Equipment—Scanning Ser
• Free Marketing Seminars—Expert Product Des
• Superior Customer Service—Detailed Technical
• Competitive Pricing—Quick Turn Around
CALL US TODAY:800-421-3523
6100 ORR ROADCHARLOTTE, NC 28213www.PicAcademy.com
COLOR CORRECTION/RAW CONVERSION - $0image, 36 hour turnaround time. Try us free. Twww.ColorPoet.com
PHOTO RESTORATION
1st PHOTO RESTORATION FREE! Try us, you’lPoint & click easy. No sign up cost. 100% guOnline leader since 1993. Wholesale only to profewww.hollywoodfotofix.com. Call 888-700-3686 [email protected]
ONLINEPHOTOFIX.COM—Make more money witrestoration. High-quality, wholesale prices, aturnaround time. Send your file today for a free eonlinephotofix.com
PHOTOGRAPHY LEGAL FORM
PHOTOGRAPHY LEGAL FORMS—Written practicing lawyer and professional photographcustomizable for your photography businessDiscount: CL20. www.photographylegalforms.com
PRESENTATION BOXES
BOXES—FREE SAMPLE PRESENTATION BOX—THE ORIGINAL BLACK BOX MANUFACTURdelivery, Finest quality 4"x5", 5"x5", 4"x6", 11"x14", 16"x20", 20"x24". AUFENGER BOXCOLLEY AVE., NORFOLK, VIRGINIA 23508; 751147 (phone); 757-440-1149 (fax); 888-440-11free). www.aufengerbox.com
PRESENTATION BOXES available for immediate sh19 sizes—4 stock colors. For FREE catalog & sam800-969-2697 or fax request 800-861-4528DIRECT AND SAVE. NPD Box Company, 11760Rd., Cleveland, OH 44111. www.NPDBox.com
SALES AIDS
BOXES—FROM THE ORIGINAL BLACK BOX MATURE—FREE SAMPLE—Fast delivery, Finest quali5”x5”, 4”x6”, 8”x10”, 11”x14”, 16”x20”, 20”x24”. AUFBOX, 4807 COLLEY AVENUE, NORFOLK, V23508; 757-440-1147 (phone); 757-440-1149888-440-1146 (toll free). www.aufengerbox.co
ClassifiedAdvertisinClassified rates: • $1.50 per word; • $2.00 perword/words with all caps or bold face. • $10.00 perissue—Confidential Reply Box Ads (Optional)—$30minimum per ad. Contact: Pro fessional Photog -rapher Classified Ads, 229 Peachtree NE, Ste. 2200,Atlanta, GA 30303; 800-339-5451.
March 2013 • Professional Photographe
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 146/148
On Oct. 29, 2012, Hurri-cane Sandy made land-
fall near Atlantic City,
N.J., and the south
shore of Long Island,
N.Y., whipping ashore as a Category 1 hurri-
cane with wind speed up to about 94 miles per
hour. As massive flooding, fires, and billions
of dollars in storm-borne destruction spread
across the Eastern seaboard, more than 50
people lost their lives. Countless others were
forced to flee their homes, leaving behind all
their earthly possessions and mementos.
In the aftermath of what many meteorol-
ogists dubbed a “superstorm,” residents of
the affected areas began picking up, drying
out, and reassembling their lives. Among the
first things people searched the sodden
wreckage for were their priceless family pho- tographs. Unfortunately, the storm had done
many of those photos irreparable damage. For
people who lost their only prints, this was dev-
astating. Could any of the images be salvaged?
Some members of the Professional Pho-
tographers Society of New York State (PPSNYS)
began receiving calls about photo restoration.
As the volume of inquiries ticked up, PPSNYS
president Owen Kassimir, M.Photog.Cr.,
CPP, was tapped by members to launch a
society-wide initiative to help restore and pre-
serve these keepsakes. Kassimir loved the idea
and put in motion a program to offer com-
plimentary photo scanning and restoration for
people with storm-damaged photographs.
“It was the right thing to do,” says Kassimir.
“Many of these images would be lost forever
without some restoration. We’ve seen
prints with curled edges, torn prints. O
woman brought in an old album with
images still in the sleeves, but the prin
were soaked and already growing mol
in addition to scanning and restoratio
we’re providing people with advice on
to protect their images.”
Participating PPSNYS members sc
and restore up to 10 images per perso
free. So far, those with brick-and-mor
studios have received the most work in
project due to their physical presence.
spread out the workload, Kassimir an
others are using Dropbox, which allow
photographers to scan and upload ph
to a shared folder for other participati
photographers to down- load and resto
Participating members have also held
eral scanning events, during which pe
from the community bring in photos f
scanning and preservation.
To help the efforts, a company calle
Preserve has hosted multiple scanning
events, offering free scans of 100 photo
are then directed to PPSNYS members
restoration. Local labs Alkit and Fine A
Albums have chipped in to donate prin
to 8x10 inches to help people replace th
damaged family heirlooms.
PPSNYS originally set the deadline
the project in February, but organizers
extended the work to help those who w
able to take advantage of the services in
immediate aftermath of the storm.
To learn more about the project and
efforts of PPSNYS or to volunteer your
ices, visit ppsnys.com. I
146 • www.ppmag.com
goodworks | Images wield the power to efect change. In this monthly eature,Professional Photographer spotlights proessional photographersusing their talents to make a diference through charitable work.
After the stormPPSNYS MEMBERS CHIP IN TO PRESERVE PRICELESS MEMORIES
Share your good works experience witby emailing Joan Sherwood at
A amily photo damaged in the storm The photo afer restoration by a PPSNYS volunteer
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 147/148
7/27/2019 Professional Photographer 2013 03
http://slidepdf.com/reader/full/professional-photographer-2013-03 148/148
Professional quality at an extraordinary price, the new Travel
Angel II has it all. It’s a solid tripod and head that quick ly
converts to a full-size monopod. And it’s lightweight and
compact enough to fit into a backpack or carry-on.
Adjustable leg angle stopsConverts into a f ull-size
monopod without toolsNEW!
Watch video at BenroUSA.com /Travel
The perfect travel companion.
Travel Angel II Tripod. Monopod. Ballhead.