Upload
donagh
View
116
Download
1
Tags:
Embed Size (px)
DESCRIPTION
Protein Secondary Structure Prediction. ?. ?. TDVEAAVNSLVNLYLQASYLS. ?. Protein secondary structure prediction. Input: protein sequence Output: for each residue its associated Secondary structure (SS): alpha-helix, beta-strand, or loop. Servers for SS prediction. - PowerPoint PPT Presentation
Citation preview
Protein Secondary Structure Prediction
• Input: protein sequence• Output: for each residue its associated Secondary
structure (SS): alpha-helix, beta-strand, or loop.
Protein secondary structure prediction
Servers for SS prediction• AGADIR - An algorithm to predict the helical content of peptides• APSSP - Advanced Protein Secondary Structure Prediction Server• CFSSP - Chou & Fasman Secondary Structure Prediction Server• GOR - Garnier et al, 1996• HNN - Hierarchical Neural Network method (Guermeur, 1997)• HTMSRAP - Helical TransMembrane Segment Rotational Angle Prediction• Jpred - A consensus method for protein secondary structure prediction at University of Dundee• JUFO - Protein secondary structure prediction from sequence (neural network)• NetSurfP - Protein Surface Accessibility and Secondary Structure Predictions• NetTurnP - Prediction of Beta-turn regions in protein sequences• nnPredict - University of California at San Francisco (UCSF)• Porter - University College Dublin• PredictProtein - PHDsec, PHDacc, PHDhtm, PHDtopology, PHDthreader, MaxHom, EvalSec from Columbia
University• Prof - Cascaded Multiple Classifiers for Secondary Structure Prediction• PSA - BioMolecular Engineering Research Center (BMERC) / Boston• PSIpred - Various protein structure prediction methods at Bloomsbury Centre for Bioinformatics• SOPMA - Geourjon and Delage, 1995• Scratch Protein Predictor• DLP-SVM - Domain linker prediction using SVM at Tokyo University of Agriculture and Technology
SS prediction Methods
Most basic idea - probabilitiesChou-Fasman method (1974)
Most basic idea - probabilitiesChou-Fasman method (1974)
Conditional probabilitiesGOR method (1978)
Conditional probabilitiesGOR method (1978)
Machine learning techniquesSVM, Neural network (2004/5)Machine learning techniques
SVM, Neural network (2004/5)
Other improvementsEnvironment, solvent accessibility (ongoing)
Other improvementsEnvironment, solvent accessibility (ongoing)
~50%
~60%
~70%
~80%
Query
SwissProt
BLASTp
QuerySubjectSubjectSubjectSubject
psiBLAST,MaxHom MSA
Machine LearningApproach
HHHLLLHHHEEE
Known structures
Protein secondary structure prediction
Evaluating secondary structure prediction methods
• Assume you have a new method for SS prediction.• Given the following sequence you get the result:
GLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNIT---EEEEEEE---EEEE-------HHHHHHHH-----EEEE---------EEEEEEEEEE
How can you assess how good your result is?1)Compare it to the TRUTH, assuming this structure exists. (what if it doesn’t?)2)Calculate the percentage of amino acids whose secondary structure class (helix, coil, or sheet) is correctly predicted.(Q3)
Coil: - , Beta strand: E , Alpha helix: H
Original sequence:
GLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNIT
Prediction:
---EEEEEEE---EEEE-------HHHHHHHH-----EEEE---------EEEEEEEEEE
Truth (from a PDB file):
-----EE-------------HHHHHHHHHH--------EE--------HHHHHHH-----
Evaluating secondary structure prediction methods
GLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNIT---EEEEEEE---EEEE-------HHHHHHHH-----EEEE---------EEEEEEEEEE-----EE-------------HHHHHHHHHH--------EE--------HHHHHHH-----YYYNNYYNNNYYYNNNNYYYNNNNYYYYYYNNYYYYYNYYNYYYYYYYNNNNNNNNNNNN
Evaluating secondary structure prediction methods
What can be the problem with such calculation?
•Overall, there are 61 AA. •Number of correctly predicted (Y) is 31.•So the Q3 score of this method would be: 50.81%
Evaluating secondary structure prediction methods
What can be the problem with such calculation?
•Assume that alpha helix is the SS of 60% of the residues. •Then a constant prediction of alpha helices would yield a Q3 measurement of 60%.•This method rewards over prediction of more common secondary structure classes in the database.
• There are other ways to measure correlation between the result and the ‘truth’.
• Most of them rely on the ratio between 1. True positive (TP) = correctly identified
2. True negative (TN) = correctly rejected
3. False positive (FP) = incorrectly identified
4. False negative (FN) = incorrectly rejected
Evaluating secondary structure prediction methods
• For instance, for the α-helix: – TP: number of α-helix residues that are
correctly predicted. – TN: number of residues observed in β-strands
and loops that are not predicted as α-helix. – FP: number of residues incorrectly predicted in
α-helix conformation. – FN: number of residues observed in α-helices
but predicted to be either in β-strands or loops.
Evaluating secondary structure prediction methods
• Sensitivity and specificity are statistical measures of the performance of a binary classification test.
• Sensitivity measures the proportion of actual positives which are correctly identified as such (e.g. the percentage of sick people who are correctly identified as having the condition).
• Specificity measures the proportion of negatives which are correctly identified (e.g. the percentage of healthy people who are correctly identified as not having the condition).
Sensitivity and specificity
• Question:– If the predictor perfectly predicts the truth, what would
be the sensitivity rate? The specificity rate?
• Answer:– A perfect predictor would be described as ______%
sensitivity (i.e. predict all people from the sick group as sick) and ______% specificity (i.e. not predict anyone from the healthy group as sick).
Sensitivity and specificity
• For any test, there is usually a trade-off between the measures.
• For example: in an airport security setting in which one is testing for potential threats to safety, scanners may be set to trigger on low-risk items like belt buckles and keys (low specificity), in order to reduce the risk of missing objects that do pose a threat to the aircraft and those aboard (high sensitivity).
Sensitivity and specificity
Sensitivity and specificity
TPSensitivity
TP FN
TNSpecificity
TN FP
Exercise
Calculate the specificity and sensitivity of the alpha helix prediction in the following SS prediction:
Original sequence:
GLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNIT
Prediction:
---EEEEEEE---EEEE-------HHHHHHHH-----EEEE---------EEEEEEEEEE
Truth (from a PDB file):
-----EE-------------HHHHHHHHHH--------EE--------HHHHHHH-----
Answer
---EEEEEEE---EEEE-------HHHHHHHH-----EEEE---------EEEEEEEEEE-----EE-------------HHHHHHHHHH--------EE--------HHHHHHH-----
Alpha helix:– TP = 6 – FP=2 – FN=4+7=11 – TN=61-(6+2+11)=42
TP - Alpha helicesCorrectly identified
FP - Alpha helicesIncorrectly identified
FN - Alpha helicesincorrectly rejected
35.26
6 19%
1
TPSensitivity
TP FN
42
42 1179.24%
TNSpecificity
TN FP
Jpred 3 – SS prediction server
MSA
Buried/exposed prediction
Reliability score
Final SS prediction
Original sequence:
GLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNIT
Jpred Prediction + reliability:
-----HHHH------------HHHHHHHHHHH-------------------EEE------997500000026777567776017899988721577400467777777773000000699
Truth (from a PDB file):
-----EE-------------HHHHHHHHHH--------EE--------HHHHHHH-----
Jpred 3 – SS prediction server