Upload
shinichikesian6117
View
53
Download
19
Embed Size (px)
DESCRIPTION
jhhl
Citation preview
1 SOALAN ULANGKAJI SPM 2013
Bahasa MelayuAnalysis
[1103/1][1103/2]
ANALISIS SOALAN RUMUSAN SPM 2008 -2012
ANALISIS SOALAN 2008 -2012
SENARAI NOVEL TINGKATAN 4 DAN TINGKATAN 5 MENGIKUT ZON
TINGKATAN 4 TINGKATAN 5 ZONAZFA HANANI
(Halis Azhan Mohd Hanafiah)KEMBARA AMIRA
(Amer Hamzah L. Kadir)ZON 1: Perlis, Kedah, Pulau Pinang,
PerakPAPA...AKHIRNYA KAU TEWAS
JUA(Deana Yusof )
KONSERTO TERAKHIR(Abdullah Husain)
ZON 2: Selangor, Wil. Persekutuan Kuala Lumpur, Wil. Persekutuan Putrajaya,
Negeri Sembilan
RENYAH(Gunawan Mohamad)
SUTERA DALAM LUKISAN
(Abd Talib Hassan)
ZON 3: Melaka, Pahang, Terengganu, Kelantan
MELUNAS RINDU(Hartini Hamzah)
KABUS DI PERBUKITAN(Muhamad Kholid Hamzah)
ZON 4 : Johor, Sabah, Sarawak, Wilayah Persekutuan Labuan
TAHUN 2008 2009 2010 2011 2012
TAJUKFaedah-faedah
penerokaan angkasa lepas
Tidur dari segi saintifik
Faedah-faedah makan choklat
Kepentingan bahasa
kebangsaan
Kepentingan bahasa
kebangsaan
Tahun Soalan (a) Soalan (b)
Nov 2008 Dua sebab bahagian permulaan novel menarik minat anda
Bandingkan persamaan dan perbezaan satu latar masyarakat dalam dua buah novel
yang dipelajari
Nov 2009 Ketabahan watak utama Nilai kasih-sayang berdasarkan dua buah novel
Nov 2010 Sebab-sebab novel memberi kesedaran
Nilai keberanian berdasarkan dua buah novel
Nov 2011 Perwatakan watak utama PersoalanNov 2012 Latar masa Nilai kemanusiaan
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
2 SOALAN ULANGKAJI SPM 2013
Bahasa Melayu Kertas 1 [1103/1]
Bahagian A[30 markah]
[Masa dicadangkan 45 minit]
Lihat gambar di bawah dengan teliti.Huraikan pendapat anda tentang tanggungjawab seseorang terhadap komuniti. Panjangnya huraian anda hendaklah antara 200 hingga 250
patah perkataan.
TANGGUNGJAWAB TERHADAP KOMUNITI
Bahagian B[100 markah]
[Masa dicadangkan 1 jam 30 minit]
Pilih satu daripada soalan di bawah dan tulis sebuah karangan yang panjangnya lebih daripada 350 patah perkataan.
1. Generasi remaja hari ini didapati kurang berminat untuk menyertai aktiviti-aktiviti serta program keagamaan dan kemasyarakatan. Fenomena ini dikaitkan dengan kewujudan teknologi komunikasi.
Tuliskan satu rencana yang lengkap bertajuk ‘Mendekatkan Remaja dengan Program Keagamaan dan Kemasyarakatan melalui Teknologi Komunikasi’.
2. Unit beruniform sekolah anda telah mengadakan aktiviti perkhemahan di Taman Negara Pahang. Selaku setiausaha persatuan, anda diminta menulis laporan berkenaan aktiviti tersebut.
Tulis laporan itu selengkapnya.
3. Kesesakan lalulintas merupakan satu isu yang sering menghantui penduduk terutama di bandar-bandar besar. Salah satu usaha untuk mengatasinya ialah dengan meningkatkan keupayaan dan kecekapan sistem pengangkutan awam.
Bincangkan usaha-usaha yang telah dilaksanakan oleh pihak yang bertanggungjawab untuk merealisasikan hasrat tersebut.
4. Akhir-akhir ini isu kebanjiran buruh asing yang datang bekerja tanpa permit semakin serius dibincangkan kerana telah mengundang banyak masalah terutama yang melibatkan kegiatan jenayah. Pelbagai langkah dilakukan oleh kerajaan untuk menyekat kebanjiran kumpulan ini, namun banyak kekangan yang dihadapi.
Huraikan kekangan-kekangan yang dihadapi oleh pihak kerajaan untuk mengatasi masalah tersebut serta langkah-langkah untuk mengatasinya.
5. Tulis sebuah cerita berdasarkan nilai murni kejujuran.
Membantu golongan yang memerlukan Bergotong-royong meringankan beban
Prihatin kepada yang kurang bernasib baik
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
3 SOALAN ULANGKAJI SPM 2013
Bahasa Melayu Kertas 2 [1103/2]
Soalan 1 : Rumusan [30 Markah]
Baca petikan di bawah dengan teliti, kemudian buat satu rumusan berkenaan langkah-langkah untuk memartabatkan bahasa Melayu dan kekangan penggunaannya di Malaysia.
Sejak beberapa dekad yang lalu, Malaysia telah melalui beberapa fasa pembangunan. Bermula daripada Dasar Ekonomi Baru, Dasar Pembangunan Negara, Dasar Wawasan Negara, dan mutakhir Model Ekonomi Baru. Namun hakikat yang menyedihkan, perkembangan dan penggunaan bahasa Melayu seolah-olah dipinggirkan daripada pakej pembangunan tersebut. Walaupun pembangunan negara berjaya membawa perubahan dari aspek sosiopolitik, sosioaekonomi, dan tuntutan masyarakat, namun bahasa Melayu masih tidak berubah walaupun suatu ketika dahulu pernah menjadi bahasa sarwajagat terhebat di Nusantara. Tuntutan ekonomi kapitalisme telah menghanyutkan perjuangan nasiolisme sehingga Universiti Kebangsaan Malaysia yang suatu ketika dahulu menjadi pemangkin dalam memartabatkan bahasa Melayu kini sama seperti universiti lain di Malaysia. Era digital dan globalisasi tanpa sempadan menyaksikan bahasa Melayu terpaksa bersaing hebat dengan bahasa lain terutamanya bahasa Inggeris. Aplikasi dan dasar liberalisasi sejak 1980-an melihat penggunaan bahasa Inggeris semakin meluas dan bahasa Melayu pula seolah-olah perlu bersedia untuk diturunkan ke liang lahat. Melihat kepada senario yang berlaku pada hari ini, usaha bersepadu perlu dilakukan untuk mengembalikan semula semangat nasiolisme dan jati diri negara bangsa. Langkah pertama adalah dengan meletakkan keagungan bahasa dan sastera Melayu pada tempat selayaknya. Dewan Bahasa dan Pustaka (DBP) yang mempunyai kematangan, sumber, kepakaran, dan kemampuan perlu melaksanakan hasrat ini tanpa membataskan sasaran terhad kepada sekolah kerajaan semata-mata. Sekolah-sekolah persendirian, sekolah Cina dan sekolah Tamil yang mempunyai silibus bahasa kebangsaan yang berbeza dengan sekolah kerajaan sepatutnya diberi perhatian yang lebih dalam memantapkan penggunaan bahasa Melayu. Dalam usaha negara mencapai status negara maju, adunan bahasa Kebangsaan dan jati diri bangsa perlu diacu serentak memandangkan usaha memartabatkan bahasa Melayu harus melalui satu anjakan paradigma. DBP sebagai badan induk yang bertanggungjawab perlu melipatgandakan promosi di segenap lapisan masyarakat, malah penglibatan semua kaum dalam usaha membudayakan bahasa Melayu perlu giat dijalankan bagi menyemai semangat dan rasa cinta terhadap bahasa Melayu kepada semua kaum Penubuhan Bahagian Pengembangan Bahasa Pelbagai Kaum yang dilakukan DBP merupakan satu langkah awal yang sungguh baik kerana usaha mengembangkan bahasa Melayu, khususnya kepada masyarakat bukan Melayu perlu diperhebatkan. Antara isu pertama yang perlu diselesaikan ialah menangani 20% daripada kanak-kanak yang ketinggalan dari segi literasi. Ukuran bagi kejayaan ini dinilai dengan melihat keyakinan ibu bapa sebagai penanda aras untuk menghantar anak-anak ke sekolah kerajaan dan bukan sekolah swasta. “Satu Bahasa, Satu Malaysia” yang dicetuskan oleh Perdana Menteri, Dato’ Sri Mohd Najib Tun Abdul Razak dilihat sebagai satu langkah yang meyakinkan untuk mengembalikan peranan Asia sebagai generasi dunia. Jepun sebagai contoh yang paling berjaya membentuk negaranya melalui acuan sendiri melalui budaya dan bahasa. Tidak mustahil Malaysia mampu mengikut langkah Jepun sekiranya rakyat berbilang bangsa di negara ini bersatu untuk memulihhara budaya bansa. Perlu ditegaskan bahawa bahasa Kebangsaan bukan milik mutlak DBP, tetapi milik bersama masyarakat Melayu dan rakyat Malaysia kerana bahasa adalah jiwa bangsa.
(Dipetik daripada “Bahasa Melayu Hak Rakyat Malaysia” Dewan Masyarakat, September 2010)
Soalan 2 : Pemahaman[35 markah]
Soalan 2 (a) - Petikan Umum
Berdasarkan petikan Soalan 1, jawab soalan-soalan yang berikut dengan menggunakan ayat anda sendiri.
i. Berikan maksud mengembalikan peranan Asia. [2 markah]
ii. Nyatakan faktor-faktor bahasa Melayu dipinggirkan [3 markah]
iii. Cadangkan dua langkah untuk mermartabatkan bahasa Melayu dalam kalangan murid sekolah rendah. [4 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
4 SOALAN ULANGKAJI SPM 2013
Soalan 2 (b) - Petikan Prosa Moden
Baca petikan cerpen di bawah dengan teliti dan kemudian jawab soalan-soalan yang berikutnya dengan menggunakan ayat anda sendiri “Abang tak mahu pergi kebun? Apa kata abang pergi sebelum abang jadi ahli korporat nanti,” rayu Mikraj. “Tak perlu!” Israk mengayun kata-kata. “ Mengapa? Abang takut nyamuk? Agas? Atau seram dengan nyanyian cengkerik? Mengapa abang terlalu berlagak akhir-akhir ini? Suara Mikraj makin lama makin meninggi. Israk menarik nafas dalam-dalam, dan berkata, “Mengapa kau terlalu menjaga tepi kain orang?” Saya kasihan melihat Wah. Abang menghina, mengeji, menyakiti Wah. Paha kanan tercubit paha kiri turut berasa sakit. Abang sedar tak, Wah lebih tua daripada abang!” “Saya ajak pa dan ma bawa abang balik kampung semata-mata mahu abang mengenali Wah yang membela abang sejak berusia satu hari lagi. Abang tahu, Wah benar-benar terhiris sewaktu atuk ‘Perth’ bawa abang lari. Sejak itu abang langsung tak mengenali Wah. Saya mahu abang belajar erti kepayahan, kekecewaan, dan ketabahan seorang wanita. Wah orangnya...,” butir bicara Mikraj diiringi mutiara mata. “Sudah hujan,” perli Israk. “Abang jangan terkejut kalau saya mampu membuatkan abang menangis nanti!” Israk bersahaja. Dia mencapai gitarnya lalu lagu sumbang itu kembali beralun. Perasaan meluat mula bersarang dalam kalbu Mikraj. Kalau tersilap jolok, pasti terjolok sarang itu. Bahaya. “Kalau bercakap dengan abang mesti ada kompromi,” katanya, memandang tepat ke wajah Israk. Fikirannya di awang-awangan.
(Dipetik daripada cerpen Israk oleh Erda Roslan khairi, dalam Harga Remaja, DBP)
i. Apakah reaksi Israk apabila Mikraj mengajaknya ke kebun? [2 markah] ii. Berikan beberapa cadangan untuk mendekatkan golongan muda agar berminat untuk menyertai aktiviti-aktiviti yang melibatkan kegiatan kekeluargaan.
[3 markah]
iii. Nyatakan satu pengajaran yang terdapat dalam petikan, dan satu pengajaran lain yang terdapat dalam keseluruhan cerpen.
[4 markah]
Soalan 2 (c) – Petikan Tradisional
Baca petikan prosa tradisional di bawah dengan teliti, kemudian jawab soalan-soalan yang berikutnya menggunakan ayat anda sendiri.
Maka Tuan Puteri Seri Ratna Gemala Nehran pun tersenyum mendengar sembah bidadari itu. Maka ujar, tuan puteri, “Kita telah bermain-main semalam tadi dengan biti-biti itu. Maka kita tidur lalu bermimpi hampir dinihari juga rasanya. Maka datang seekor naga maka dipagutnya pinggangku, tiada lekat pada tubuhku rasanya dan aku lihat rupa naga itu terlalu indah-indah sekali. Seketika kita berselimut bau bunga rasanya, dan bau bunga itu pun datang sekarang kepada hidungnya kita rasanya. Hatta maka naga itu pun melancar ke atas kemuncak mahligai ini. Maka ditelannya gemala yang di atas kemuncak mahligai ini. Sebab itulah mukaku pucat ini.” Segala bidadari itu pun berdatang sembah seraya tertawa, “Segera rupanya tuan puteri ini akan kahwin dengan paduka kakanda itu Raja Dewa Lela Mengerna itu.” Tuan puteri pun tersenyum tunduk malu rupanya dan segala bidadari itu pun tertawa seraya ia berpantun demikian bunyinya: Burung bayan terbangnya tinggi, Terbang melayang berpangkat-pangkat; Jikalau malam termimpi-mimpi, Jika siang terlihat-lihat. Setelah tuan puteri mendengar pantun itu adalah muka tuan puteri itu antara masam dengan tiada berseri. Maka tuan puteri pun berkata kepada inangdanya, “Hai inangda, bilamana kita akan pergi mandi ke Tasik Semendera Jin itu?” Maka sembah inangdanya, “Ya tuanku tuan puteri, esoklah kita akan pergi mandi.”
(Dipetik daripada cerita Hikayat Indera Nata dalam Antologi Harga Remaja DBP)
i. Mengapakah muka bidadari pucat? [2 markah]
ii. Nyatakan gambaran naga yang terdapat dalam mimpi bidadari seperti yang diceritakan kepada Tuan Puteri Seri Ratna Gemala Nehran? [3 markah] iii. Pada pendapat anda, apakah bekalan yang perlu ada dalam diri seseorang remaja untuk mengelakkan diri daripada diperdaya oleh orang yang tidak bertanggungjawab. [3 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
5 SOALAN ULANGKAJI SPM 2013
Soalan 2 (d) GurindamBaca gurindam di bawah dengan teliti, kemudian jawab soalan-soalan yang berikutnya dengan menggunakan ayat anda sendiri.
Gurindam 12 Fasal yang KeenamCahari olehmu akan sahabat,
Yang boleh dijadikan ubat.
Cahari olehmu akan guru,Yang boleh tahukan tiap seteru.
Cahaya olehmu akan isteri,Yang boleh menyerahkan diri.
Cahari olehmu akan kawan,Pilih segala orang setiawan.
(Abu Hassan Sham (Penyelenggara) Puisi-puisi Raja Ali Haji,
Dalam antologi Harga Remaja, 1993 DBP) i. Apakan yang dimaksudkan dengan: Cahari olehmu akan sahabat Yang boleh dijadikan ubat [3 markah]
ii. Sahabat amat penting pada masa susah maupun senang. Cadangkan ciri-ciri yang perlu ada pada seseorang sahabat yang setia. [3 markah] iii. Nyatakan dua nilai yang terdapat dalam gurindam di atas. [3 markah]
Soalan 3: Pengetahuan dan Kemahiran Bahasa[30 markah]
Jawab semua soalan.
(a) Tulis satu ayat bagi setiap kata kerja di bawah ini untuk menunjukkan bahawa anda faham akan maksud dan penggunaannya. Anda boleh menambahkan imbuhan tetapi tidak boleh menggunakan perkata itu sebagai kata nama khas.
i. tonton ii. tengokiii. keluar iv. terbitv. halus vi. teliti [6 markah]
(b) Baca ayat di bawah dengan teliti, kemudian tentukan subjek dan predikat dalam ayat tanpa mengubah maksud asal.
i. Melukis telah menjadi kegemarannya sejak kecil lagi.
ii. Warna oren merupakan warna pilihan Hani untuk majlis perkahwinannya .
iii. Ibu pejabat syarikat tersebut terletak di Labuan, Sabah. [6 markah]
(c) Dalam setiap ayat di bawah terdapat satu kesalahan ejaan dan satu kesalahan penggunaan imbuhan. Senaraikan dan betulkan kesalahan-kesalahan itu. Bagi setiap ayat, anda tidak boleh menyenaraikan lebih daripada satu kesalahan ejaan dan satu kesalahan penggunaan imbuhan. Anda tidak perlu menyalin petikan itu semula.
i. Kebanyakkan pengguna memilih untuk berbelanja di pusat membeli belah berbanding di kedai runcit.
ii. Puan Halimah dan Encik Halim cadangan untuk menyambut ulangtahun perkahwinan mereka di Hotel Kasturi pada hari Ahad nanti.
iii. Di mana harus saya mengantungkan gambar pemandangan ini. Aqil bertanya kepada Irfan. [6 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
6 SOALAN ULANGKAJI SPM 2013
Soalan 4: Novel[15 markah]
Jawab soalan di bawah. Jawapan anda hendaklah berdasarkan novel-novel yang anda pelajari.
(i) Azfa Hanani karya Halis Azhan Mohd Hanafiah(ii) Papa...(akhirnya kau tewas jua!) karya Deana Yusof(iii) Renyah karya Gunawan Mohamad(iv) Melunas Rindu karya Hartini Hamzah(v) Konserto Terakhir karya Abdullah Hussain(vi) Kabus di Perbukitan karya Muhamad Kholid Hamzah(vii) Kembara Amira karya Amer Hamzah L. Kadir(viii) Sutera Dalam Lukisan karya Abd. Talib Hassan
(a) Watak utama banyak memaparkan nilai-nilai murni yang boleh dijadikan teladan oleh pembaca. Berdasarkan novel yang telah anda kaji, huraikan dua nilai murni yang terdapat pada watak utama.
[7 markah]
(b) Huraikan dua persoalan yang dikemukan oleh pengarang dalam novel yang anda kaji. [8 markah]
KERTAS SOALAN TAMAT
(d) Dalam setiap ayat di bawah, terdapat satu kesalahan penggunaan kata atau istilah dan satu kesalahan tatabahasa. Senaraikan dan betulkan kesalahan-kesalahan itu. Bagi setiap ayat anda tidak boleh meyenaraikan lebih daripada satu kesalahan pengunaan kata atau istilah dan satu kesalahan tatabahasa. Anda tidak perlu menyalin ayat itu semula.
i. Bendera-bendera yang berwarna-warni itu bertebaran di sepanjang jalan.
ii. Masalah yang institusi pengajian tinggi hadapi adalah kekurangan pendapat yang cerdas.
iii. Beliau sering diajak untuk membentangkan kertas kerja di dalam beberapa seminar. [6 markah]
(e) Nyatakan maksud peribahasa di bawah ini.
i. Di mana ada kemahuan di situ ada jalan
ii. Tak lapuk dek hujan, tak lekang dek panas
iii. Bermandi peluh [6 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
7 SOALAN ULANGKAJI SPM 2013
EnglishAnalysis
[1119/1][1119/2]
Paper Section 2008 2009 2010 2011 2012
PAPE
R 1
A Directed Writing Article Report Informal letter Talk Informal letter
B Continuous writing
Descriptive/Narrative
Descriptive/Narrative Descriptive Descriptive Descriptive
Argumentative Argumentative Argumentative Argumentative DiscussionReflective Reflective Reflective Reflective ReflectiveNarrative Narrative Narrative Narrative Narrative
Descriptive/Narrative
Descriptive/Narrative
Descriptive/Narrative
Descriptive/Narrative Descriptive/Narrative
PAPE
R 2
A
Advertisement - 1 1 1 1Charts, Tables &
Graphs 2 1 - 1
Comic strips, Maps & Pictures 2 1 2 - 1
Short Texts 4 5 5 4 4Notices & Signs - - - 2 2
B Information Transfer
Short passage Book review Poster Poster Descriptive
Table & question Table & Question Graphic Organiser
Graphic Organiser Table
C Comprehension & Summary Narrative Narrative Descriptive Narrative Narrative
D
Poem If Monsoon History
There’s Been a Death in
the Opposite House
In the Midst of Hardship Nature
Short Story The Sound Machine The Necklace The Drover’s
Wife - -
Novel Ending of the story
Difficult decision made by a character
Important incident in the
story
Favourite part of the story
Part of the story that make them angry
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
8 SOALAN ULANGKAJI SPM 2013
English Paper 1 [1119/1]
Time: One hour and forty-five minutesThis question paper consists of two sections : Section A and Section B. Answer both sections. You are advised to spend 45
minutes on Section A and one hour on Section B.
Section A: Directed Writing(35 marks)
As the head of the Student’s Disciplinary Board, you are very concerned over the increasing number of complaints filed by students about those who are involved in gangsterism in schools. Write an article for your school newsletter on how to prevent gangsterism in schools.
Use the notes below to write your article.
• motivationaltalks • campaigns • recreationalactivities • weekendactivities • communitywork • closemonitoringbyteachers • regularspotchecks • counsellingsessions • peerobservation • fines • harshpunishment • rewards
When writing the article, you should remember:
• togiveitasuitabletitle
• tomentionthewriter’sname
• touseall the notes given
• thatyourreadersaremainlystudents Note: For your article, you will receive up to 15 marks for the format and content points, and up to 20 marks for the quality of your writing.
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
9 SOALAN ULANGKAJI SPM 2013
Section B: Continuous Writing(50 marks)
Write a composition of about 350 words on one of the following topics.
1 Describe a school activity that you have participated in.
2 Tuition – is it really necessary? Discuss.
3 Write a story ending with “Wait for me! I’m coming too.”
4 Libraries no longer have a place in society.
5 Traditions
KERTAS SOALAN TAMAT
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
10 SOALAN ULANGKAJI SPM 2013
English Paper 2 [1119/2]
Time: Two hours and fifteen minutesThe question paper consists of four sections: Section A. Section B, Section C and Section D. Answer all sections in this
question paper. Questions in Section A have four options.
1 The most suitable title for the tips above is A Beware of Strangers B Keeping Your Cash Safe C How to Use Public Transport D Protecting Yourself from Pickpockets
2 According to the advertisement, Delights A prepares their own bread B has chefs from five different countries C charges RM25 for each plate of burger D import the patties from five different countries
Section A(15 marks)
ExciteyourtastebudswithDelights’sensationalchoiceofburgers.OurchefshavepreparedfivevariationsofburgerfromtheUnitedStates,Australia,Mexico,GermanyandtheUnitedKingdom.Allburgersareservedwithhomemadebread.Eachburgerpattyispreparedusingseasoninguniquetothecountryoforigin.
PricesrangefromRM25toRM35perplate
3 The poem probably describes A a messy classroom B an untidy bedroom C a chaotic living room D a cluttered dining room
4 What is the purpose of the notice? A to warn the public about the dangers of fire B to warn the public about potential fire hazards C to remind the public what to do in case of a fire D to inform the public about fire prevention methods
Hissweater’sbeenthrownonthefloor,HisscarfandoneskiarebeneaththeTV,Andhispantshavebeencarelesslyhungonthedoor.Hisbooksarealljammedinthecloset,Hisvesthasbeenleftinthehall.AlizardnamedEdisasleepinhisbed,Andhissmellyoldsockhasbeenstucktothewall.
ExtractfromaShelSilversteinpoem
FIRE KILLS: PREVEnTITBePreparedToFace
Emergencies
Ensurethatyourfamilyispreparedandknowstheescaperouteincaseofafire
REMEMBER 994www.bomba.gov.my
• Slingyourbaginfrontofyousothatyoucankeepaneyeonit.Alsomakesurethatitisproperlyfastenedorzippedup.
• Donotleavehandbaginashoppingbasketortrolley.
• Checkyourwalletorhandbagimmediatelyifsomeonejostlesorbumpsintoyou.
• Donotdozeoffinthebusortrainandleaveyourbelongingsunattended.
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
11 SOALAN ULANGKAJI SPM 2013
5 Which of the following is true about the joke? A the boy answered the teacher correctly B the teacher did not understand the boy’s answer C the teacher was revising some Mathematics symbols D the teacher was trying to teach the students how to operate
a DVD player
6 Tigers are different from one another as A their body shape and size differ greatly B they have stripes on the sides of their body C the colour of their stripes differs in intensity D the stripes on the sides of their body do not form the same
patterns
7 From the extract, we know that A fats in all chocolates are cholesterol free B eating chocolate can make someone feel less depressed C cocoa powder is the highest natural source for magnesium D calcium in cocoa powder will worsen the hypertension
patients
WhilereviewingMathsymbolswithmyForm1students,Idrewagreater-than(>)andaless-than(<)signontheblackboardandasked,“Doesanyonerememberwhatthesemean?” Afewmomentspassed,andthenaboyconfidentlyraisedhishand,“Onemeansfast-forward,”heexclaimed,“andtheothermeansrewind!”
nOTWOTIGERSHAVESIMILAR
BODYMARKInGS
Chocolatecontainsessentialnutrientssuchasiron,calcium,magnesium,potassiumandvitamins.Magnesiumcontentincocoapowderisbeneficialfortheheartandhypertensionpatients.Thefatinhighqualitypurecocoachocolatecanbeconsideredcholesterolfreeasstudiesindicateitdoesnotfurupthearteriesorcontributetohighcholesterollevels.Eatingchocolatealsoreleasestheseagentsintothesystem,thusitcanprovidealiftwhenwearefeelingdown.
8 The sign above is found outside a A photo studio B police station C hospital D cybercafé
Questions 9 – 15 are based on the following passage.
9 A myself B herself C yourself D ourselves
10 A a B an C the D some
11 A this B that C these D those
12 A order B advise C stipulate D prescribe
13 A start B starts C started D starting
14 A in B on C at D from
15 A has B had C have D having
“Shootyourdaughtersandframeyour
mother-in-law!”
Haveyoueverhadabadhabityouwantedtogetridoffbutfailed?nowyoucansuccessfullykickyourbadhabitusingthefollowingsteps.
First,youmustbeawarethatyourhabitisbadandislimitingyourperformance.Second,ask 9 whyyouwantthishabittobereplaced.Themoregoodreasonsyoucanthinkof,thehigherthechanceofreplacingit.Writingdownyourreasonswillforceyoutothinkandmake 10 commitment.
Third,setasuitabletimeframetoreplace 11 habit.Mostexperts 12 aminimumof21days.
Fourth,13anewhabitthatwillcounterthebadhabityouwanttokick.
Fifth,youmustbeveryconsciousofyournewhabit 14 thebeginning.Ifyourepeatthebadhabit,remembertotellyourselfthatyoualready15anotherhabittoreplaceit.
Finally,enjoyyournewhabitanditwillsoonbecomepartofyouandtheoldhabitwillsoonbeforgotten.
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
12 SOALAN ULANGKAJI SPM 2013
Section B(10 marks)
Read the following information on the different fares and answer the questions that follow.
Question 16 - 25Using the information given, write the most appropriate fares in the boxes below
Questions 21 – 25Complete the sentences below using the information given.
21 Joshua pays RM2 650 for a one-way ticket to Guangzhou because ______________________________________________________________________________________________________________________________
22 Marilyn paid RM149 for a one-way ticket to Brisbane but she must travel ____________________________________________________________________________________________________________________________
23 The fares advertised exclude ___________________________________________________________________________________________________________________________________________________________
24 Tom cannot get an offer ticket to Perth for Christmas because ____________________________________________________________________________________________________________________________________
25 When Ana visits her pen-pal in Manila, she pays ____________________________________________________________________________________________________________________________________
Folksairlines.comFlyfromKLtoBrisbane/Perth
FromRM149oneway!Everydaylowfares!
International HongKongRM2200nowfromRM99oneway GuangzhouRM2650nowfromRM149oneway ShanghaiRM3709nowfromRM149oneway
-----------------------------------------------------------------------------------------------------------------------------------------Bookearly.Bookonline.norefunds.Bookingperiod:9to22June2013
TravelPeriod:PerthandBrisbane1november2013to30April2014
Otherdestinations15Julyto14October2014
Theaboveeconomyfaresexcludefuelsurchargeinsurancelevy,airporttaxandotherapplicablecharges.Lowfaresarenotavailableduringpeakperiods.Termsandconditionsapply.
> >
> >
> >
>
ASEAN JakartaRM1279nowfromRM50oneway ManilaRM1375nowfromRM10oneway PhuketRM747nowfromRM50oneway HanoiRM2200nowfromRM99oneway
Description One-Way Fare16. May May and her parents are going to Hong Kong for a holiday. How much must they pay?
From
17. Minh Ho wants to buy a ticket to Hanoi
From
18. Rahim wants to buy a ticket to Perth
From
19. Ari wants to buy a ticket to Phuket From20. Sassy wants to go to Shanghai From
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
13 SOALAN ULANGKAJI SPM 2013
Section C(25 marks)
1 Today’s youth will be tomorrow’s leader. But the scenario of today’s youth is a dismal one as they are plagued with so many social ills.
2 Firstly, what are the social ills? An alarming large number of youths are involved in smoking, taking drugs and alcoholism. Many youths are destroying their future because they are under the influence of drugs and alcohol. Drink-driving, reckless driving and illegal racing have become popular pastimes for youths. AIDS and HIV are diseases that have surfaced with drug abuse. Young teenagers like to roam the city streets, especially at night. In school, they play truant and skip classes and are disruptive. They prefer to loiter around shopping complexes instead of studying. Teenagers under peer pressure also vandalise public property in order to gain acceptance of their peers. They form gangs and take part in violent fights and criminal activities. These are the various social ills that are plaguing the youths.
3 What are the causes of this dreary situation? One of the factors responsible for the rise of ills among young children is parents. Parents play a pivotal role in the raising of their children and moulding their characters. However, due to the pursuit of material wealth and career advancement, parents have made their children feel neglected and unloved. Youths then turn to their friends and start to misbehave in order to get their parents’ attention.
4 The deteriorating discipline in schools is a contributing factor. Schools are given limited power to wield the cane and mete out punishment to errant students. Schools have also becoming boring to many students. They find playing truant more interesting. Besides, the school curriculum does not put equal emphasis on instilling moral and religious principles as well as nurturing the intellect.
5 Many children run away from poverty, broken families and abusive parents. An alarming number of youths are physically and mentally abused by their parents. Marital disharmony due to divorce, unemployment and financial problems contributes to family breaks-up and the children end up feeling lost and unloved. They leave the house and mix with the bad hats.
6 Something must be done fast or our youths will ruin their future and become a destructive factor that will undermine nation building. Parents play a crucial role in bringing up their children. There should be communication between children and parents. Parents should keep track of their children’s friends and their movements. Daily discussions about schools, checking their exercise books and going on holiday together will go a long way in creating a strong emotional bond between children and their parents.
7 Schools should play more caring role too. Teachers and counsellors play an important role in teaching discipline and imparting knowledge. They should collaborate with their students’ parents and let the parents know if their children misbehave, play truant or have problems. Cooperation between schools and parents is important to overcome many disciplinary problems. They should instil religious and moral values in youths so that they can think rationally and evaluate their actions correctly.
8 The government also play an effective role in curbing social ills. The setting up Rakan Muda camps, summer camps and motivational camps can teach youths to be independent and constructive and encourage team spirit. These will contribute to multiracial integration and unity. A disciplined society can contribute to the development of the nature.
9 To put it in a nutshell, the youths of today have to stand up, hold hands with other youths and rise to the challenge of becoming more productive and useful citizens.
[5]
[10]
[15]
[20]
[25]
[30]
[35]
[40]
Questions 26 -31 are based on the following passage.
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
14 SOALAN ULANGKAJI SPM 2013
26 From paragraph 2, (a) state one social ill those youths involved in. __________________________________________________________________________ (1mark)
(b) state one disease associated with drug abuse. __________________________________________________________________________ (1 mark)
27 From paragraph 3, give two reasons why parents neglect their children.
Reason 1: ______________________________________________________________________ (1 mark)
Reason 2: ______________________________________________________________________ (1 mark)
28 From paragraph 4, give two reasons why are schools become boring to many students.
Reason 1: ______________________________________________________________________ (1 mark)
Reason 2: ______________________________________________________________________ (1 mark)
29 From paragraph 5,
(a) which phrase has the same meaning as ‘escape’? __________________________________________________________________________ (1 mark)
(b) which phrase tells you that people who deliberately stir up problems? __________________________________________________________________________ (1 mark)
30 From paragraph 7,
(a) define the role of school counsellors. __________________________________________________________________________ (1 mark) (b) explain why it is good for cooperation between schools and parents. __________________________________________________________________________ __________________________________________________________________________ (1 mark)
31 Based on the passage given, write a summary of: • socialillsfacebytoday’syouths • theroleofparentsandschoolstohelptheyouths
Credit will be given for use of own words but care must be taken not to change the original meaning.
Your summary must: • beincontinuouswritingform(notinnoteform) • usematerialsfrom line 3 to line 37 • notbelongerthan130 words, including the 10 words given below
Begin your summary as follows:
Today’s youths are plagued with so many social ills which…
(15 marks)
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
15 SOALAN ULANGKAJI SPM 2013
Section D(20 marks)
32 Read the poem below and answer the questions that follow.
Areyoustillplayingyourflute?WhenthereishardlytimeforourloveIamfeelingguiltyTobelongingforyoursongThemelodyconcealedintheslimhollowofthebambooUncoveredbythebreathofanartistComposedbyhisfingersBlownbythewindTothedepthofmyheart
Areyoustillplayingyourflute?InthevillagesoquietanddesertedAmidstthesickricefieldWhilehereithasbecomealuxuryTospendtimewatchingtherainGazingattheeveningraysCollectingdewdropsOrenjoyingthefragranceofflowers
Areyoustillplayingyourflute?Themoreitdisturbsmyconsciencetobethinkingofyouinthehazardofyoumyyoungerbrothersunemployedanddesperatemypeopledisunitedbypoliticsmyfriendsslaughteredmercilesslythusworldistoooldandbleeding
ZurinahHassan
(a) Which phrase in stanza 1 refers to the flute? _________________________________________________________________________ (1 mark)
(b) In stanza 1, (i) what is hidden in the flute? _______________________________________________________________________ (1 mark)
(ii) who uncovers it? _______________________________________________________________________ (1 mark)
(c) What do you think is a ‘luxury’ for you as a student? Give a reason to support your answer. Luxury: ___________________________________________________________________ (1 mark)
Reason: ___________________________________________________________________ (1 mark)
33 The following are the novels studied in the literature component in English Language. The Curse - Lee Su Ann
Step By Wicked Step - Anne Fine
Catch Us If You Can - Catherine MacPhail
Choose any one of the novels above and answer the question below.
Based on the novel that you have read, describe an element of love that is shown in the novel. Support your answer with close reference from the text.
(15 marks)
KERTAS SOALAN TAMAT
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
16 SOALAN ULANGKAJI SPM 2013
MathematicsAnalysis
[1449/1][1449/2]
TOPICPAPER 1 PAPER 2
08 09 10 11 12 08 09 10 11 12
FORM
1-3
1 Polygon I, II 7 6,7 7 7 7,8
2 Transformations I, II 9,10 9,10 9,10 9,10 10,11
3 Trigonometry I 11
4 Algebraic Expressions I,II,III 19 19 19 19
5 Algebraic Formulae 21 20 20 21 21
6 Algebraic Fractions 20 21 21 20 20
7 Linear Equations 22 22 22 22 22 4 2 2 2 48 Indices 23 23,24 23,24 23,24 24,25
9 Linear Inequalities 24 25 25 25 25,26 3
10 Graph of Functions I
11 Solid Geometry I,II,III 5 11 4 7 6
12 Circles I,II 8 6 7 9 9
13 Statistics I,II 25,26,27 26,27 26,27 26,27 27,28
FORM
4
1 Standard Form 1,2,3,4 1,2,3 1,2,3,4 1,2,3,4 1,2,3,4
2 Quadratic Expressions and Equations
19 3 3 3 3 3
3 Sets 29,30,31 29,30,31 29,30,31 29,30,31 31,32 1 1 1 1
4 Mathematical Reasoning 6 7 5 5 5
5 The Straight Line 32,33 32,33 32,33 32,33 33,34 10 5 6 6 76 Statistics III 29 14 16 14 14 14
7 Probability I 34,35 34,35 34,35 34,35 35,36
8 Circles III 8 8 8 8 9
9 Trigonometry II 12,13 11,12,13 11,12,13 11,12,13 12,13
10 Angles of Elevation and Depression
15 15,16 15,16 15,16 15,16
11 Lines and Planes in 3-Dimensions
14 14 14 14 14 2 5 11 4 2
FORM
5
1 Number Bases 5,6 4,5 5,6 5,6 5,6
2 Graph of Functions II 28 28 28 28 30 13 1,12 12 12 123 Transformations III 12 15 13 13 13
4 Matrices 39,40 39,40 39,40 39,40 39,40 11 9 8 8 115 Variations 36,37,40 36,37,40 36,37,40 36,37,38 37,38
6 Gradient and Area under a Graph
9 10 9 11 8
7 Probability II 7 8 10 10 10
8 Bearing 17 16 17 17 17
9 Earth as a Sphere 18 17,18 18 18 18 15 13 15 16 1610 Plans and Elevations 16 16 16 15 15
TOTAL 40 40 40 40 40 16 16 16 16 16
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
17 SOALAN ULANGKAJI SPM 2013
Mathematic Paper 1 [1449/1]
1 Round off 6.059 correct to two significant figures. A 6.05 C 6.1 B 6.06 D 6.0 2 State 0.0003008 in standard form A 3008 x 107 C 3008 x 10-7 B 3.008 x 104 D 3.008 x 10-4
3 A cube with sides of 43 mm. Find its volume, in cm3, correct to three significant figures.
A 80.0 C 79.50 B 79.5 D 79.500
4
A 1.98 x 103 C 6.6 x 103
B 1.98 x 104 D 6.6 x 104
5 101002 – 11112 =
A 1012 C 10012 B 1112 D 10112
6 What is the value of digit 3 in base five in the number 49 32810 ? A 1200 C 2200 B 2020 D 2220
7 In Diagram 7, PQRST is a regular polygon. PUT is a straight line. VP = VU
Find the value of x. A 36 C 60 B 54 D 72
( )=
23
2
1031094.5
om
o50
P
Q
R
ST
U
DIAGRAM 7
DIAGRAM 8
9 Diagram 9 shows a circle with centre O. LM and LN are tangents to the circle at points M and N respectively. Find the value of x.
A 30 C 50 B 40 D 60
10 In the diagram, the straight line PQ is the image of the line RS under a reflection.
The axis of reflection is A x = 2 C y = 2 B x -axis D y-axis
11 The point A’ (-5, 7) is the image of point A under a translation . Find the coordinates of point A
A (3, 1) C (1, 3) B (-3,-1) D (-13, 13)
DIAGRAM 9
68
Answer all questions 8 In Diagram 8, PQRTU is a regular pentagon and RST is a straight line. Find the value of m.
A 36 C 65 B 58 D 72
N
L
xo
50o
40o
M
O
2 S
QR
P4
0-2
-2
2-4
-4
4
S
QR
P
0-2
-2
-4
2-4 4
-4
2
4
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
18 SOALAN ULANGKAJI SPM 2013
13 Diagram 13 shows the graph of y = sin x.
The value of p is A 90° C 270° B 360° D 180 °
14 Diagram 14, shows a pyramid PQRS. The horizontal base PQR is a right-angled triangle. Vertex P is vertically above S.
Name the angle between the line PR and the plane PSQ. A C
B D
DIAGRAM 13
DIAGRAM 14
S
P
QR
RPS PRSRPQ PRQ
Q
R
DIAGRAM 15
DIAGRAM 12
S
R
U
P Q
T
20� y�
1213
12 In Diagram 12, SPQ and PRU are right angle triangles. STQ and PTU are straight lines.
It is given that cos yo = and PQ = QR . Calculate the length in cm, of PTU
A 70.17 C 27.67 B 65.94 D 25.54
15 In Diagram 15, Q and S are two points on a horizontal plane. R is the top of a vertical flagpole SR.
The angle of elevation of R from Q is 520 . The distance between Q and S is 14 m. Calculate the height, in m, of flagpole RS.
A 10.94 C 11.03 B 15.59 D 17.92
16 Diagram 16 shows two towers on a horizontal plane
P and Q are two points on the top of the towers as shown. R is a point vertically below Q. The angle of elevation of Q from P is 550 and the angle of elevation of R from P is 400. Calculate the distance, in m, from Q to R.
A 10.58 C 15.53 B 35.34 D 29.50
DIAGRAM 16
P
Q
R
60m
17 In Diagram 17, P, Q and R are three points on a horizontal plane such that PR = RQ = QP
Given that Q is due east of P, find the bearing of Q from R. A 330° C 120° B 150° D 060 °
18 P and Q are two points on the surface of the earth and the latitude of P is 55°N. Given that Q is located 15° south of P,
find the latitude of Q. A 40° S C 40° N B 70° S D 70 ° N
19
A C B D
P
R
QDIAGRAM 17
Q S
pOo
-1
1
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
19 SOALAN ULANGKAJI SPM 2013
31 Diagram 31 is an incomplete Venn diagram showing the number of elements in sets P, Q and R.
It is given that the universal set and . Find .
A 5 C 12 B 6 D 17
P Q
R
4 6
23 1
7
DIAGRAM 31
20 Express as a single fraction in its simplest from.
21 Given that , express r in terms of p.
22 Given that , calculate the value of a.
23 Given that , find the value of x.
24 Simplify
25 Which of the following inequalities satisfy the simultaneous
linear inequalities and ?
26 List all the integers x which satisfy the inequality . A 3, 4 C 2, 3, 4 B 2, 3, 4, 5 D 1, 2, 3, 4, 5
27 Table 27 is a frequency table which shows the scores of students in a test.
Calculate the mean score of the students. A 11.36 C 10.36 B 9.36 D 9.17
Score Frequency
1-3 8
4-6 9
7-9 11
10-12 16
13-15 14
16-18 12
TABLE 27
28 Diagram 28 is a pie chart showing how Adam uses his income each month. Adam’s income is RM3 500 per month. Adam’s savings is RM350 and he spends 40% of his income on miscellaneous.
It is given that x : y = 2 : 3. Find the value of x. A 72 C 108 B 144 D 216
29 Table 29 shows the frequency distribution of the scores obtained by a group of pupils in a game.
If 2 is the modal score, the minimum value of k is A 6 C 10 B 9 D 11
30 Which of the following graphs represents ?
A C
B D
DIAGRAM 28
TABLE 29
ox Houseoy
Miscellaneous
Savings
Car
!0&)2!
Score 1 2 3 4 5 6
Frequency 6 k 9 9 8 6
O
y
xO
y
x
O
y
xJ
O
y
x5
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
20 SOALAN ULANGKAJI SPM 2013
32 Diagram 32 is a Venn Diagram showing the universal set , set P, set Q and set R.
Which region, A, B, C or D represents the set ?
33 In Diagram 33, POR is a straight line and O is the origin.
Find the gradient of POR.
34 The gradient of the straight line is
35 24 students in a class are computer club members. A student is chosen at random from the class. The probability of choosing a student who is not a computer club member is . Find the total number of students in the class
A 32 C 40 B 36 D 72
x y
4 8
25 20
TABLE 38
EnDOFQUESTIOnPAPER
37 It is given that y varies inversely as the cube root of x and y = 6 when x =8. Calculate the value of x when y = 4.
A 3 C 12 B 9 D 27
38 Table 38 shows some values of the variables x and y such that y varies directly as the square root of x.Find the relationship between y and x.
39 Given calculate the value of k . A -3 C 4 B -8 D 7
40 Find the value of h and of k in the following matrix equation:
DIAGRAM 32
PQ
R
A
B
C
D
DIAGRAM 33
( )5,3R
x
y
O
P
Pass Fail
Boys 8 4
Girls 20 x
TABLE 36
36 Table 36 shows the result of a Mathematics test for a group of students.
A student is chosen at random from the group. The probability of choosing a student who failed the test is . Find the value of x.
A 1 B 3 C 4 D 5
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
21 SOALAN ULANGKAJI SPM 2013
Mathematic Paper 2 [1449/2]
Section A[52 marks]
Answer all questions in this section.
1 on the graph in the answer space, shade the region which satisfies the three inequalities 2y ≥ x – 4, y ≤ 2x + 1 and y < 1. [3 marks] Answer :
2 Diagram 2 shows a right prism with a horizontal rectangular base JKLM. Trapezium JKQP is the uniform cross-section of the prism. The rectangular surface QRLK is inclined. KL = 12cm, RS = 5cm and JP = 8cm
Calculate the angle between the plane RSJ and the vertical plane RSML. [4 marks]
Answer :
!S! R!
QP!
M! L!8 cm
!
DIAGRAM 2
JK
8 cm
12 cm
5cm
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
22 SOALAN ULANGKAJI SPM 2013
3 Solve the quadratic equation [4 marks]
Answer :
4 Calculate the values of e and of f which satisfy the following simultaneous linear equations : [4 marks]
Answer:
5 (a) State whether the following sentence is a statement or a non-statement.
All multiples of 2 are divisible by 4
(b) Write down a true statement using both of the following statements: Statement 1 :
Statement 2 :
(c) Write down two implications based on the following sentence:
y < x if and only if [4 marks]
Answer:
(a) ______________________________________________________________________________ (b) ______________________________________________________________________________
(c) Implication I : _________________________________________________________________
_________________________________________________________________
Implication II: _________________________________________________________________
_________________________________________________________________
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
23 SOALAN ULANGKAJI SPM 2013
6 Diagram 6 shows a solid, formed by joining a cylinder to a right prism. Trapezium AFGB is the uniform cross-section of the prism. AB = BC = 9 cm. The height of the cylinder is 6 cm and its diameter is 7 cm. Calculate the volume, in cm3, of the combined solid.
Use . [4 marks]
DIAGRAM 6
7 In diagram 7, O is the origin.
The gradient of the line PQ is . Find,
(a) the value of k. (b) the equation of the straight line QR.
(c) the x-intercept of the straight line QR. [5 marks]
yQ (k, 8)
6
-4
x0
R
P
DIAGRAM 7
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
24 SOALAN ULANGKAJI SPM 2013
8 Diagram 8 shows the speed-time graph of a vehicle for a period of 15 seconds.
DIAGRAM 8
Calculate the (a) distance traveled during the first 12 second. (b) value of v, if the rate of change of speed during the last 3 seconds is 5 ms-2. [6 marks]
9 In diagram 9, LK is an arc of a circle with centre P and PQRS is an arc of a circle with centre O. PORL is a straight line.
Given KOL = 600, PK = 21 cm and OP = 7 cm. Using , calculate
a) the area , in cm2 of the shaded region b) the perimeter in cm, of the whole diagram. [7 marks]
Answer:
P O R L
S
K
Q
60* +!
DIAGRAM 9
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
25 SOALAN ULANGKAJI SPM 2013
10 Diagram 10 shows six labelled cards in two boxes, P and Q,
A card is picked at random from box P and then a card is picked at random from box Q. By listing the sample of all the possible outcomes of the event, find the probability that
(a) a card with an odd number and the card labelled J are picked,
(b) a card with a number which is multiple of 2 or the card labelled H are picked. [5 marks] Answer:
DIAGRAM 10
11 (a) It is given that matrix M = and matrix such that .
Find the values of p and q.
(b) Using matrices, calculate the values of x and y that satisfy the following matrix equation:
2x - 3y = 13 4x + y = 5 [7 marks]
Answer
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
26 SOALAN ULANGKAJI SPM 2013
Section B[48 marks]
Answer 4 questions from this section.
12 (a) Complete Table 12 in the answer space for the equation by writing down the values of y when x = –1 and x = 2. [2 marks]
(b) For this part of the question, use the graph paper provided. You may use a flexible curve. By using a scale of 2 cm to 1 unit on the
x-axis and 2 cm to 10 units on the y-axis, draw the graph of . [4 marks]
(c) From your graph, find: (i) the value of y when x = –2∙4, (ii) the value of x when y = –12 [2 marks]
(d) Draw a suitable straight line on your graph to find all the values of x which satisfy the equation for . State these values of x. [4 marks] Answer :
(a)
(b) Refer graph.
(c) (i) y = _________________________________________________________________
(ii) x = _________________________________________________________________
(d) x = ________________________________________________________________________
x -3 -2 -1 –0∙5 0.5 1 2 3
y 5∙33 8 32 –32 –16 -5.33
TABLE 12
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
27 SOALAN ULANGKAJI SPM 2013
Graph for question 12
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
28 SOALAN ULANGKAJI SPM 2013
13 (a) The transformation R represents a 900 anticlockwise rotation about the center (3, 2). The transformation T represents a translation . State the coordinates of the image of the point (−1, 1) under the following
transformations.
(i) R (ii) RT [3 marks]
Answer: (a) (i)
(ii)
(b) Diagram 13 shows three quadrilateral EFGH, ABCD and OFJK on a Cartesian plane. EFGH is the image of ABCD under the transformation U and EJKO is the image of EFGH under the transformation V .
Describe completely the transformation, (i) U, (ii) V. [6 marks]
(c) Given that the shaded area is 120 unit2 , find the area of ABCD. [3 marks]
Answer: (b) (i)
(ii)
(c)
DIAGRAM 13
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
29 SOALAN ULANGKAJI SPM 2013
14 The data in the table shows the weight of 40 students in a class.
60 45 50 56 66 51 44 46 54 47 53 48 49 49 48 65 52 50 51 51 52 52 42 51 41 54 46 54 56 60 58 39 53 59 58 63 47 64 43 59
(a) Based on the data in the table above, complete the table provided in the answer space using 5 kg as the size of the class interval. [4 marks]
(b) By using a scale of 2 cm to 5 kg on the x-axis and 2 cm to 5 students on the y-axis, draw an ogive for the data. [4 marks]
(c) Based on the ogive in (b), i) Find the inter quartile range. ii) Briefly explain the meaning of the third quartile in the graph. [4 marks]
Answer: (a)
c) (i) _________________________________________________________________
(ii) _________________________________________________________________
_________________________________________________________________
ClassInterval Frequency CumulativeFrequency
30 – 3536 – 40
41 – 45
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
30 SOALAN ULANGKAJI SPM 2013
Graph for question 14
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
31 SOALAN ULANGKAJI SPM 2013
15 (a) Diagram 15(i) shows a solid prism with rectangular base JKLM on a horizontal plane. ADEHJK is the uniform cross-section of the prism. The rectangles ABCD and AFGH are horizontal planes. AK, BI, CF, DE, GM and HJ are vertical edges. Draw to full scale, the plan of the solid.
[3 marks]
(b) A solid prism is joined to the prism in Diagram 15(i) at the vertical plane BCFGML to form a combined solid as shown in Diagram 15(ii). The trapezium MNRS is the uniform cross-section of the prism. TBL, SGM, RN and QP are vertical edges.
Draw to full scale,
(i) The elevation of the combined solid on a vertical plane parallel to KJ as viewed from X. [5 marks]
(ii) The elevation of the combined solid on a vertical plane parallel to JMN as viewed from Y. [4 marks]
DIAGRAM 15 (i)
DIAGRAM 15 (ii)
G(.- (
A
B
3 cm
4 cm
5 cm
3 cm
2 cmL
H
G
J
KM
N
P
T
S
R
D
FC
E
YX
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
32 SOALAN ULANGKAJI SPM 2013
16 J (70°S,37°E), K and L are three points on the surface of the earth such that JK is the diameter of the parallel of latitude 70°S. An aeroplane takes off from J and flies due east along its parallel of latitude until it reaches town K. Upon arrival in town K the plane
changes its crew and flies back to J using the shortest distance measured along the surface of the earth. After refueling in J , the aeroplane is instructed to fly to town L which is located 5400 nautical miles due north of J.
(a) Find the longitude of town K. [2 marks]
(b) Find the latitude of town L. [3 marks]
(c) Calculate the distance, in nautical miles, traveled by the plane,
(i) From J to K , measured along the parallel latitude.
(ii) From K back to J. [5 marks]
(d) Calculate the average speed, in knots, for the whole journey of the plane if the time taken to reach L is 22 hours. [2 marks]
Answer: (a)
(b)
(c) (i)
(ii)
(d)
EnDOFQUESTIOnPAPER
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
33 SOALAN ULANGKAJI SPM 2013
N o Tajuk
2008 2009 2010 2011 2012K1 K2 K1 K2 K1 K2 K1 K2 K1 K2TINGKATAN 4
1 Kemunculan Tamadun awal dunia 1 5 2 2 1 2 1 22 Peningkatan tamadun 3 1 2 1 2 23 Tamadun Awal Asia Tenggara 2 2 3 3 2 2 14 Kemunculan Tamadun Islam
dan perkembangan di Makkah 2 6 2 2 4 2 1 2
5 Kerajaan Islam Madinah 2 2 1 2 2 36 Pembentukan Kerajaan Islam dan Sumbangannya 2 3 6 2 2 5 2 57 Islam di Asia Tenggara 2 2 2 2 3 28 Pembaharuan dan Pengaruh Islam di Malaysia
Sebelum Kedatangan Barat 2 2 1 2 2 2 2
9 Perkembangan di Eropah 2 2 2 2 6 2 2 610 Dasar British terhadap Ekonomi Negara 2 8 2 8 3 2 6 2
TINGKATAN 51 Kemunculan dan Perkembangan Nasionalisme
Di Asia Tenggara 3 2 1 2 7 3 3
2 Nasionalisme di Malaysia sehingga Perang Dunia Kedua 1 7 3 7 4 7 2 4 2 7
3 Kesedaran Pembinaan Negara dan Bangsa 2 2 2 3 2 24 Pembinaan Negara dan Bangsa Malaysia 3 3 2 3 2 2 8 3 85 Pembinaan Negara dan Bangsa Merdeka 2 2 2 2 16 Pengukuhan Negara dan Bangsa Malaysia 2 4 2 2 3 47 Sistem Pemerintahan dan
Pentadbiran Negara Malaysia 2 1 3 8 3 3 2
8 Pembangunan dan Perpaduan untuk Kesejahteraan 2 8 1 9 4 2 29 Malaysia dalam kerjasama Antarabangsa 3 4 3 4 3 9 2 9 2 9
JUMLAH 40 9 40 9 40 9 40 9 9
K1 - Bilangan soalanK2 - No soalan
SejarahAnalysis
[1249/1][1249/2]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
34 SOALAN ULANGKAJI SPM 2013
Sejarah Kertas 1 [1249/1]Arahan:
Jawab semua soalan yang diberikan. Soalan aneka pilihan sila jawab di bahagian yang telah disediakan manakala soalan struktur, perlu jawab dalam ruangan jawapan setiap soalan.
1 Petempatan kekal merupakan satu ciri penting kemunculan tamadun
Apakah unsur penting yang menentukan pemilihan sesuatu kawasan sebagai petempatan kekal dalam tamadun tersebut?
A Kelangsungan bekalan makanan B Kewujudan sistem kepercayaan C Kepadatan penduduk D Keluasan tanah 2 Maklumat berikut berkaitan dengan tamadun Mesopotamia • Mempunyai pintu gerbang pelbagai bentuk
Apakah kepentingan pintu gerbang tersebut? A Lambang Kekayaan B Panduan laluan kapal C Sempadan empayar D Simbol keagamaan 3 Agora merupakan sebahagian daripada institusi polis dalam
Tamadun Yunani.
Apakah fungsi agora tersebut? A Kawasan pertanian C Tempat pertemuan rakyat B Pusat keagamaan D Tempat bangunan kerajaan 4 Mengapakah dilantik dua orang konsul dalam sistem
pemerintahan republik Rom ? A Mengimbangi kuasa B Mematuhi dasar negara C Melicinkan pentadbiran D Meringankan beban tugas 5 Apakah bukti yang menunjukkan kerajaan Kedah Tua pernah
menjadi sebuah pelabuhan entrepot A Tembikar Qing Pai B Candi di Lembah Bujang C Gendang Gangsa Dongson D Batu Besurat Terengganu 6 Maklumat berikut berkaitan dengan kemahiran masyarakat
kerajaan maritim.
• Pada zaman kerajaan awal, masyarakat kerajaan maritim merupakan pelaut yang unggul di Asia Tenggara
Mengapakah masyarakat tersebut mampu menjadi pelaut yang
unggul? I Perebutan tanah jajahan II Mendapat galakan pemerintah III Memiliki kemahiran membina kapal layar IV Memiliki semangat menjalankan perdagangan jarak jauh
A I dan II C II dan III B I dan IV D III dan IV
7 Mengapakah dakwah Islamiah pada peringkat awal di Makkah dilakukan secara rahsia?
I Tindakan itu adalah suatu strategi dalam penyebaran Islam
II Ajaran Islam masih belum lengkap III Ini adalah untuk mengelakkan daripada diketahui oleh orang
ramai IV Bilangan umat Islam masih kecil
A I dan II C III dan IV B II dan IV D I dan IV 8 Senarai berikut merupakan individu yang telah memberikan
sumbangan penting terhadap agama Islam.
• SitiKhadijah • UmmuSalamah • AisyahbintiAbuBakar Apakah sumbangan individu tersebut? A Membantu perjuangan Islam B Memperkukuhkan ekonomi Islam C Menyusun perundangan Islam D Menubuhkan pusat kegiatan Islam 9 Pada zaman pemerintahan Khulafa al-Rasyidin , seseorang
khalifah dilantik melalui sistem syura. Apakah kebaikan sistem tersebut? A Meneruskan tradisi masyarakat Arab B Memastikan kesenambungan pemerintahan C Mendapat sokongan orang bukan Islam D Menjamin pemilihan pemimpin berkelayakan 10 Mengapakah Cordova dianggap penting kepada dunia Islam dan
Eropah pada abad ke-10 M?
I Pusat kebudayaan III Pusat penterjemahan II Pusat pertahanan IV Pusat pengajian tinggi
A I dan II C II dan III B I dan IV D III dan IV
11 Apakah sumbangan Ibn al-Nafis terhadap terhadap peradaban dunia?
A Teori algebra C Teknik pembedahan B Perundangan D Penetapan hukum syarak 12 Apakah faktor yang mengakibatkan kemerosotan kuasa politik
dan ekonomi Empayar Turki Uthmaniyah pada abad Ke-16? A Pertambahan penduduk yang pesat B Kebangkitan golongan monarki C Pengaruh pahlawan tentera D Kejatuhan ekonomi dunia
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
35 SOALAN ULANGKAJI SPM 2013
14 Mengapakah Sultan Mansur Shah menghantar kitab al-Dur al-Manzum ke Samudera-Pasai?
A Untuk dibahaskan C Untuk diterjemahkan B Sebagai mas kahwin D Sebagai tanda persahabatan 15 Perkara yang manakah menunjukkan kedatangan Islam ke Asia
Tenggara mempengaruhi cara hidup masyarakat tempatan? A Amalan bersemah C Adat persandingan B Persaudaraan ummah D Cara bercucuk tanam 16 Pada tahun 1833, Akta kilang telah digubal bagi melindungi
kepentingan pekerja di Britain.
Antara pernyataan berikut yang manakah berkaitan dengan akta tersebut?
A Penggunaan mesin ditegah B Pengambilan buruh mahir dipertingkatkan C Melarang wanita bekerja di lombong arang batu D Melarang kanak-kanak bawah sembilan tahun bekerja
PadazamanRevolusiPerindustrianAktaAntipenggabunganmelarangpenubuhan
Kesatuan Sekerja
17 Merujuk kepada pernyataan di atas, apakah implikasinya kepada pekerja?
A Kenaikan gaji disekat B Wanita dilarang bekerja C Pergaulan pekerja disekat D Eksploitasi pekerja dilarang 18 Bagaimanakah Akta Tanah Simpanan Melayu yang
diperkenalkan oleh British pada 25 November 1913 memanfaatkan orang Melayu?
A Memperkenalkan sistem perladangan B Mengekalkan hak milik C Mempelbagaikan jenis tanaman D Meneruskan ekonomi tradisional
19 Apakah implikasi daripada sistem pendidikan di atas? A Pengasingan kaum B Sukatan pelajaran selaras C Pegawai kerajaan bertambah D Pengurusan tenaga pengajar mudah
20 Pada tahun 1917, undang-undang perkhidmatan syarikat insurans telah mengasingkan insurans nyawa daripada insurans
A kesihatan C kenderaan B kebakaran D perkhidmatan 21 Jadual berikut berkaitan dasar pendidikan Belanda di Indonesia
Mengapakah Belanda mengasingkan sistem pendidikan tersebut?
A Mengelak masalah pemberian bantuan B Menyekat penghijrahan penduduk C Memecah belah perpaduan penduduk D Menghapuskan amalan tradisi tempatan 22 Mengapakah corak gerakan nasionalisme di Asia Tenggara
berubah daripada sederhana kepada radikal? A Sekatan pengaruh luar B Perjuangan tidak berkesan C Kekurangan sumber kewangan D Sokongan pemerintahan tempatan 23 Akhbar berikut digunakan oleh Kaum Muda sebagai wadah
perjuangan mereka di Tanah Melayu pada 1930-an.
• Al-Imam • Neracha • Saudara
Apakah isu yang dimuatkan oleh akhbar tersebut A Peranan golongan pembesar B Mengkritik kelemahan raja C Penghapusan amalan penghambaan D Menggalakkan pendidikan barat 24 Dialog berikut mungkin berlaku antara ahli Kaum Muda
Mengpakah perkara tersebut berlaku? A Kekurangan kewangan B Sekatan undang-undang C Sikap dingin masyarakat D Kesukaran sistem perhubungan 25 Bagaimanakah Bismarck berjaya memenangi dan membangkit
semangat rakyat Prussia di Medan peperangan? A Melaksanakan pelbagai taktik kotor B Melancarkan sistem kediktatoran C Mengadakan kerjasama dengan ahli D Menggunakan isu membenci kuasa asing
Sistem pendidikan di Indonesia awal abad ke-19Bandar Anak golongan priyayi
Kampung Anak orang kebanyakan
AZMI : Kita tidak dapat bergerak dinegeri-negeriMelayuYUSUF : Ya,memangbetul
13 Mengapakah undang-undang Islam sukar dilaksanakan sepenuhnya oleh pemerintah Islam di Asia Tenggara?
A Pembesar kurang memberi galakan B Mendapat tentangan daripada penduduk C Masih terikat dengan undang-undang adat D Perang saudara di kalangan pemimpin tempatan
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
36 SOALAN ULANGKAJI SPM 2013
27 Rajah berikut berkaitan dengan negeri-negeri warisan Kesultanan Melayu Melaka.
Mengapakah negeri-negeri tersebut dianggap sebagai warisan Kesultanan Melayu Melaka?
I Negeri naungan II Mengahwini kerabat diraja III Menggunakan gelaran sultan IV Sistem pembesar Empat Lipatan
A I dan II C II dan III B I dan IV D III dan IV
PiagamAtlantik1945
28 Apakah gesaan Pertubuhan Bangsa-Bangsa Bersatu ( PBB) yang terkandung dalam piagam di atas?
A Dasar liberalisasi B Amalan realpolitil C Dasar Dekolonisasi D Amalan monarki 29 Senarai berikut menerangkan pertubuhan yang ditubuhkan di
Tanah Melayu selepas Perang Dunia Kedua
• AngkatanPemudaInsaf(API) • AngkatanWanitaSedar(AWAS) • BarisanTaniMalaya(BATAS) Apakah persamaan pendirian ahli pertubuhan tersebut? A Menyokong Malayan Union B Menyetujui pendidikan sekular C Menentang kemasukan imigran D Membubarkan Sistem Ahli 30 Apakah manfaat yang diperoleh orang Melayu melalui Perjanjian
Persekutuan Tanah Melayu 1948? A Kedudukan istimewa dilindungi B Menentukan kerakyatan C Menguasai pentadbiran D Kebebasan berpolitik
26 Apakah peranan Buapak dalam sistem pemerintahan yang berasaskan Adat Perpatih di Negeri Sembilan?
I Menasihati Undang II Memilih Anak Buah III Mengetuai Perut IV Melantik Lembaga
A I dan II C II dan III B I dan IV D III dan IV
31 Mengapakah parti berikut ditubuhkan?
A Menyekat pengaruh komunis B Mewujudkan perpaduan kaum C Mempertahankan hak peribumi D Mengurangkan pengaruh golongan radikal
32 Mengapakah penyerahan tersebut ditentang oleh pemimpin dan persatuan kaum tempatan Sarawak?
A Penentangan Majlis Negeri B Penipuan terhadap pembesar C Penghapusan hak istimewa peribumi D Percanggahan dengan Perlembagaan 1941
33 Jawatankuasa berikut ditubuhkan pada bulan Julai 1961
Apakah peranan jawatankuasa tersebut? A Merangka perlembagaan tersebut B Menetapkan tarikh pilihan raya umum C Menjelaskan tentang gagasan Malaysia D Merintis kerjasama pelbagai parti politik 34 Situasi berikut merujuk kepada masalah yang dihadapi oleh
seorang rakyat Malaysia
• DisabitkandengankesalahanJenayaholehmahkamah • Diisytiharkanmuflis Dalam sistem pilihan raya di Malaysia, individu tersebut tidak
berhak A Membuang undi B Menganggotai parti politik C Menyediakan manifesto D Menjadi calon 35 Rajah di bawah menerangkan langkah kerjasama untuk
memajukan ekonomi negara.
Apakah kesan langkah tersebut? A Pembukaan tanah pertanian secara besar-besaran B Perkembangan pesat kemudahan asas C Peningkatan produktiviti sektor perkilangan D Penglibatan bumiputera dalam sektor perusahaan
PARTI Parti Kemerdekaan MalayaPENGASAS Dato’Onn bin Jaafar
TAHUN PENUBUHAN 1951
TARIKH PERISTIWA8 Februari 1946 Vyner Brooke menyerahkan Sarawak
kepada kerajaan British
JAWATANKUASA PENGERUSI
Jawatankuasa Perunding Perpaduan Kaum Donald Stephens
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
37 SOALAN ULANGKAJI SPM 2013
36 Kerajaan telah memperkenalkan program pembangunan in-situ melalui Dasar Pertanian Negara (DPN)
Apakah tujuan program tersebut? A Membuka petempatan baru B Menambah peluang pekerjaan C Memperkemaskan sistem pemasaran D Memulihkan kawasan berproduktiviti rendah
37 Jadual di atas menunjukkan perubahan dasar luar Malaysia Mengapakah berlaku perubahan dasar di atas? A Suasana aman di Vietnam B Bantuan pertahanan dari komanwel C Pengaruh Britain di Timur berkurangan D Perjanjian Inggeris-Tanah Melayu ditandatangani 38 Apakah faktor pembubaran Liga Bangsa? A Kemelesetan ekonomi dunia B Perluasan pengaruh komunis C Kegagalan menghalang peperangan D Pengisytiharan kemerdekaan kebanyakan negara
39 Apakah masalah yang dihadapi oleh negara bekas tanah jajahan Barat selepas Perang Dunia kedua?
I Membentuk kerajaan baru II Mewujudkan perpaduan ekonomi III Membangunkan sektor ekonomi IV Menghapuskan warisan penjajah A I, II dan III C I, III dan IV B I, II dan IV D II , III dan IV • PersatuanNegara-negaraAsiaTenggara(ASA)-1961 • PersatuanNegara-negaraAsiaTenggara (ASEAN)-1967 40 Kedua-dua pertubuhan di atas mempunyai matlamat yang sama
iaitu A Menyelaraskan sistem pentadbiran B Mengadakan pakatan ketenteraan C Mewujudkan kebudayaan serantau D Menjalinkan kerjasama dalam pelbagai bidang
KERTAS SOALAN TAMAT
DASAR LUAR MALAYSIASebelum 1971 Pro-BaratSelepas 1971 Berkecuali
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
38 SOALAN ULANGKAJI SPM 2013
Sejarah Kertas 2 [1249/2]
BAHAGIAN A( 40 markah)
Jawab semua soalan
1 Peningkatan ekonomi merupakan tulang belakang kemajuan sesebuah tamadun.
a Nyatakan kegiatan ekonomi yang dilakukan oleh tamadun India dan China
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah] b Senaraikan dua sumbangan tamadun China dalam bidang pertanian
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah] c Nyatakan 2 peranan sresthin dalam peningkatan ekonomi tamadun India
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah] d Pada pandangan anda, mengapakah kemajuan ekonomi penting kepada sesebuah negara?
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah] e Sebagai seorang pemimpin, bagaimanakah anda memajukan sektor pertanian negara
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
39 SOALAN ULANGKAJI SPM 2013
2 Rajah di bawah merujuk kepada kesan yang berlaku di Asia Tenggara akibat daripada pengaruh Islam
Pengaruh Islam terhadap perkembangan ekonomi di Asia Tenggara --------------------> Mata wang
a Apakah pengaruh Islam dalam aspek perdagangan di Asia Tenggara?
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah] b Nyatakan ciri-ciri Islam yang terdapat pada mata wang di Asia Tenggara.
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah] c Jelaskan peraturan-peraturan cukai yang dikenakan kepada pedagang dan orang asing di Melaka
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah] d Berdasarkan pengetahuan sejarah anda, apakah yang akan terjadi sekirannya urusan perdagangan dijalankan tanpa menggunakan mata wang ?
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah] e Malaysia merupakan sebuah kuasa perdagangan yang penting di Asia Tenggara. Pada Pendapat anda, apakah langkah-langkah yang boleh diambil bagi menjadikan negara kita terus unggul sebagai kuasa perdagangan terpenting di Asia Tenggara?
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
40 SOALAN ULANGKAJI SPM 2013
3 Gerakan Islah adalah satu gerakan yang menyarankan agar orang Islam memperbetulkan pandangan terhadap ajaran Islam yang sebenarnya. Gerakan ini dipelopori oleh Kaum Muda yang mendapat pendidikan aliran agama.
a Namakan dua tokoh gerakan di atas
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah]
b Berikan dua akhbar dan majalah yang menyebarkan idea gerakan tersebut
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah]
c Apakah idea-idea yang diperjuangkan oleh gerakan ini?
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah]
d Nyatakan halangan-halangan yang dihadapi oleh oleh Kaum Muda dalam perjuangan mereka?
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah]
e Malaysia bercita-cita akan menjadi sebuah negara maju pada tahun 2020. Pada pendapat anda, apakah cabaran-cabaran yang mesti ditempoh bagi menjadikan Malaysia sebuah negara maju.
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
41 SOALAN ULANGKAJI SPM 2013
TARIKH PERISTIWA TINDAKAN
Jun 1961 Tunku Abdul Rahman membuat lawatan ke Sabah dan Sarawak
Menerangkan matlamat penubuhan Malaysia
4 a Apakah langkah-langkah yang dijalankan untuk menjayakan pembentukan Malaysia?
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah] b Senaraikan dua orang tokoh yang terlibat dalam Suruhanjaya Cobold i ________________________________________________________________________ ii ________________________________________________________________________ [2 markah]
c Nyatakan dua laporan hasil tinjauan pendapat yang dijalankan oleh Suruhanjaya Cobold i ________________________________________________________________________ ii ________________________________________________________________________ [2 markah] d Berikan dua cadangan yang dikemukakan oleh Suruhanjaya Cobbold i ________________________________________________________________________ ii ________________________________________________________________________ [2 markah] e Berdasarkan pengkajian anda, mengapakah penduduk Sabah dan Sarawak menerima cadangan pembentukan Malaysia?
i ________________________________________________________________________
ii ________________________________________________________________________ [2 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
42 SOALAN ULANGKAJI SPM 2013
Bahagian B[ 60 markah ]
Jawab mana-mana tiga soalan daripada bahagian ini 5 Pembentukan Kerajaan Islam di Madinah pada tahun 622M telah menimbulkan perasaan iri di kalangan orang Arab Quraisy
a) Jelaskan strategi yang digunakan oleh Nabi Muhamad s.a.w untuk memperkukuhkan kedudukan negara Islam. [8 markah]
b) Berdasarkan pengetahuan anda, nyatakan prinsip peperangan mengikut ajaran Islam [6 markah]
c) Pada pendapat anda, apakah langkah yang sewajarnya anda lakukan untuk mempertahankan kedaulatan negara. [6 markah]
6 a) Apakah maksud Reformation. [2 markah]
b) Apakah idea-idea penting yang diperjuangkan oleh Martin Luther? [6 markah]
c) Jelaskan kesan-kesan Zaman Reformation terhadap Eropah. [12 markah]
7 a) Masyarakat Melayu mula menggunakan sistem mata wang sejak zaman Kesultanan Melayu Melaka lagi. Jelaskan jenis mata wang yang digunakan di Tanah Melayu sejak zaman tersebut hingga awal abad ke 20. [6 markah]
b) Kepesatan ekonomi Tanah Melayu telah membawa kepada penubuhan institusi kewangan. Terangkan perkembangan institusi kewangan di Tanah Melayu sehingga awal abad ke 20. [8 markah]
c) Berdasarkan pengetahuan sejarah anda, apakah kesan pengenalan institusi kewangan ke atas ekonomi di negara kita ? [6 markah]
Suruhanjaya Reid Mac 1956Perjanjian Persekutuan Tanah Melayu Ogos 1957
8 Maklumat berikut berkaitan dengan langkah ke arah mencapai kemerdekaan Persekutuan Tanah Melayu 1948
a) Apakah isu yang menjadi perhatian Suruhanjaya Reid? [4 markah]
b) Jelaskan isi kandungan Perjanjian Persekutuan Tanah Melayu 1957. [8 markah]
c) Sebagai rakyat PTM yang merdeka pada masa itu, nyatakan kepentingan yang diperolehi apabila termeterainya Perjanjian PTM 1957? [8 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
43 SOALAN ULANGKAJI SPM 2013
10 Rajah berikut berkaitan dengan langkah-langkah kerajaan meningkatkan perpaduan di Malaysia
a) Jelaskan langkah-langkah yang diambil oleh kerajaan untuk memartabatkan bahasa Melayu sebagai Bahasa Kebangsaan. [10 markah]
b) Apakah kepentingan Dasar Kebudayaan Kebangsaan ? [5 markah]
c) Pada pendapat anda bagaimana aktiviti sukan menjadi alat perpaduan di Malaysia. [5 markah]
11 a) Jelaskan matlamat penubuhan ASEAN [6 markah]
b) Huraikan sumbangan dan peranan Malaysia dalam ASEAN [10 markah]
c) Pada pengetahuan sejarah anda, apakah kelebihan dasar luar Malaysia yang berbaik-baik dengan semua negara ? [4 markah]
KERTAS SOALAN TAMAT
9 Malaysia permerupakan sebuah negara yang melaksanakan pemerintahan bercorak Demokrasi. Pilihan raya aspek penting dalam sebuah negara Demokrasi. Pilihan raya membolehkan rakyat terlibat secara langsung dalam pemilihan pemimpin negara.
a) Jelaskan proses pilihan raya [7 markah]
b) i. Nyatakan syarat-syarat yang perlu dipatuhi oleh calon yang hendak bertanding dalam pilihan raya [4 markah]
ii. Syarat-syarat untuk menjadi pengundi [4 markah]
c) Pada pandangan anda, apakah kepentingan pilihan raya di Malaysia [5 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
44 SOALAN ULANGKAJI SPM 2013
ScienceAnalysis
[1511/1][1511/2]
CHAPTER2008 2009 2010 2011 2012
P1P2
P1P2
P1P2
P1P2
P1P2
A B C A B C A B C A B C A B C1. Scientific Investigation2. Body Coordination 3 1 3 1 3 1 1 5 3 13. Heredity & Coordination 5 4 1 5 3 1 3
4. Matter & Substances 4 1 4 5 1 4 4 15. Energy & Chemical Changes 4 1 3 1 3 1 3 4 1
6. Nuclear Energy 4 2 1 2 1 2 1 1 2 17. Light, Color & Sight 3 1 5 1 3 1 5 3 18. Chemicals In Industry 3 - - - 2 - 1 - 2 - - 1 2 1 - 1 3 - - -NO. OF QUESTION
FOR FORM 4 26 1 1 2 23 2 3 2 23 2 3 1 24 2 2 1 22 2 2 1
9. Microorganisms and their Effects On Living Things
5 1 4 1 5 1 1 3 1 5 1
10. Nutrition & Food Production 3 1 4 2 1 2 1 4 1
11. Preservation & Conservation of the Environment
3 1 5 2 4 4 1
12. Carbon Compound 2 1 1 4 1 4 1 5 1 3 113. Motion 5 1 4 1 5 1 5 1 5 114. Food Technology & Production 2 1 2 1 4 1 2 1 1 2 1
15. Synthetic Materials In Industry 2 2 3 2 2 1
16. Electronics & Information & Communication Technology
2 1 2 1 2 1 3 1 3
NO. OF QUESTION FOR FORM 5 24 3 4 1 27 2 2 1 27 4 5 3 26 2 3 2 28 2 3 2
TOTAL 50 4 5 3 50 4 5 3 50 4 5 3 50 4 5 3 50 4 5 3
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
45 SOALAN ULANGKAJI SPM 2013
Science Paper 1 [1511/1]
This question paper consists of 50 questions. Each question is followed by four options A, B, Cand D. Choose one correct answer for each question. Answer all the questions.
1. The following information shows a step in the scientific method.
Woodlicepreferlivinginmoistsoiltolivingindrysoil.
What is the step ? … A a variable. B a hypothesis. C a problem statement. D the aim of an experiment.
2. The following statement shows some of the steps in a scientific method.
J - Forming a conclusionK - Control the variablesL - Analyse and interpret dataM – Identify the problem
Which of the following is the correct sequence of the scientific method ?
A J, K, L, M B K, M, L, J C M, K, L, J D M, L, K, J
3. Diagram 1 show a type of nerve cell.
What is the type of neurone shown in Diagram 1 ?
A Relay neurone B Sensory neurone C Motor neurone D Middle neurone
4. Which of the following actions is a reflex action ? I We can button our shirts without looking at buttons. II Blinking the eyes to avoid an object entering an eye. III Jumping up in pain on stepping on a sharp nail accidentally.
A I and II only B I and III only C II and III only D I, II and III
5. Diagram 2 shows the pathway of impulses in an action.
DIAGRAM 1
DIAGRAM 2
What is P ? A Brain B Receptor C Hormones D Spinal cord
6. The functions of the brain may be disturbed because of … I injury of the brain II mental stress III malnutrition
A I and II only B I and III only C II and III only D I, II and III
7. Diagram 3 shows one of the endocrine glands in the body.
What will happens to a person if his gland M secretes excessive hormones into the blood ?
A The metabolic rate increases B The blood pressure increases C The salt level in the blood decreases D The glucose level in the blood decreases
8. Diagram 4 shows the positions of some endocrine glands in the body.
Which gland produced the hormones that sometimes known as the fight, flight or fright hormones?
A P C R B Q D S
DIAGRAM 3
M
P
Q
S
R
Pituitary gland
DIAGRAM 4
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
46 SOALAN ULANGKAJI SPM 2013
9. Withdrawal symptoms due to drugs include .. I diarrhea and shivering II having hallucination III pain in the abdomen and limbs
A I and II only B I and III only C II and III only D I, II and III
10. What is the harmful effect of taking alcoholic drinks excessively ? A Diarrhoea B Brain cancer C Liver cirrhosis D Sickle-cell anaemia
11. Why is meiosis important to humans? A Increasing the number of cells B Injured organs can be repaired C For replacing dead or worn out cells D Number of chromosomes is maintained from generation to
generation 12. An imbalance of hormones in women can .. I hinder the development of secondary sex characteristics II encourage pregnancy III cause foetal abortion
A I and II only B I and III only C II and III only D I, II and III
13. Diagram 5 shows the sex determination in humans.
Which of the children are girls ? A U and V B U and W C V and W D V and X 14. Diagram 6 shows the process occurs in a cell division.
DIAGRAM 5
DIAGRAM 6
DIAGRAM 7
What is the process shown in Diagram 6? A Mitosis B Meiosis II C Fertilisation D Crossing- over
15. Diagram 7 shows the development after the fusion of sperm and ovum.
Name the process of X and Y ?
16. Encik Wahid and Puan Sarah has two sons. What is the probability that their third child will still be a boy?
A 100% C 25% B 50% D 75%
17. Which of the following atoms contains 11 protons, 11 electrons and 12 neutrons?
18. Crystals can be obtained from a A. diluted solution B. miscible solution C. saturated solution D. concentrated solution
19. Diagram 8 shows an incomplete Periodic Table.
Element S is a .. A. gas B. metal C. non- metal D. transition element
DIAGRAM 8
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
47 SOALAN ULANGKAJI SPM 2013
DIAGRAM 10
DIAGRAM 11
20. Diagram 9 is best to describes the process of ...
A. evaporation B. condensation C. sublimation D. vaporization
21. Diagram 10 shows the electrolysis of copper chloride solution using carbon electrodes as the anode and cathode.
What will be obtained in electrodes X and Y ?
22. Diagram 11 shows how radioactive radiations penetrate through different material. What are the radiations P, Q and R ?
P Q R A. Alpha Beta Gamma B. Gamma Alpha Beta C. Beta Alpha Gamma D. Alpha Gamma Beta
23. Diagram 12 shows the process of ...
A. nuclear fusion B. nuclear fission C. nuclear decay D. nuclear effect
24. Diagram 13 shows the process of formation of a rainbow.
What are the processes involved? A. Refraction and diffraction. B. Diffraction and reflection C. Reflection and dispersion D. Scattering and refraction
25 Diagram 14 shows the location of the object in front of a convex lens.
The image formed by the lens is .. A. Real, upright and smaller than object. B. Real, inverted and larger than object C. Virtual, upright and is the same size as the object. D. Virtual, inverted and is the same size as the object.
DIAGRAM 12
DIAGRAM 13
DIAGRAM 14
DIAGRAM 9
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
48 SOALAN ULANGKAJI SPM 2013
DIAGRAM 15
DIAGRAM 16
26. Diagram 15 shows a pinhole camera
Predict what will happen to the image on the screen if the pinhole is enlarged and the camera is brought closer to the object?
A. The image becomes bigger and brighter but less clear. B. The image becomes bigger, brighter and clearer. C. The image becomes smaller but brighter and clearer D. The image becomes smaller, brighter but less clearer .
27. Diagram 16 shows a beam of white light passing through a yellow and magenta filter.
What colours are lights X and Y passing through the filters ?
A B C D
28. Colour is used by animals .. I. for growth II. as warning signals III. to attract the attention of their mates
A. I and II only B. I and III only C. II and III only D. I,II and III
29. Which of the following are the uses of colours in daily life ? I. traffic lights II. electrical wiring III. colour printing
A. I and II only B. I and III only C. II and III only D. I,II and III
X YYellow, red and green Green and red
Red and green Cyan and redYellow, red and green Green and blue
Red and green Cyan and blue
31. Greenhouse effect in the atmosphere is caused by I. Respiration II. Transpiration III. Photosynthesis
A. I and II only B. I and III only C. II and III only D. I,II and III
29. Diagram 17 shows the structure of bronze.
What are K and L ?
A B C D
32. Diagram 18 shows a situation in a river. Many fishs in a river died.
Which of the following pollutants in the water are likely to have killed them ?
I. Toxic waste II. Mercury III. Oil spill
A. I and II only B. I and III only C. II and III only D. I,II and III
DIAGRAM 17
K LCopper ZincCopper TinCopper Aluminium
Tin zinc
DIAGRAM 18
X Y
Magentafilter
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
49 SOALAN ULANGKAJI SPM 2013
33. Diagram 19 shows the life cycle of a female Aedes mosquito.
Give a method to control the mosquito at stages Q. I. using chemicals. II. spreading oil over the surface of water III. using biological control such as rearing fish
A. I and II only B. I and III only C. II and III only D. I, II and III
34. Which of the following can be treated by antifungal drugs? A. Ringworm B. Malaria C. Common cold D. Gonorrhoea
35. A farmer observed symptoms as stated below on his crops.
• Veryfewflowersandfruits • Darkgreenleaveswithredspotsonthem
Which of the following macronutrients needs to be added to the soil?
A. Nitrogen B. Sulphur C. Calcium D. Phosphorus
36. Diagram 20 shows the roots of a long bean plant.
How does the presence of root nodules benefit leguminous plants ?
A. The root nodules provide shelter for nitrifying bacteria which are beneficial to the plants.
B. More nitrates are available for the plants to synthesise proteins.
C. Denitrification can occur more easily D. Putrefaction can occur more easily.
DIAGRAM 19
DIAGRAM 20
37. Diagram 21 shows the carbon cycle.
What are process X and Y ?
X Y A. Respiration Respiration B. Respiration Decomposition C. Photosynthesis Respiration D. Photosynthesis Excretion
37. Diagram 22 shows the symbol of recycling.
What is the important of recycling? A. Reduce air pollution B. Increase economic resources C. Protect extinction of marine life D. Reduce the use of natural resources
38. Which of the following are inorganic compounds? I. Alcohol II. Carbon dioxide III. Calcium carbonate
A. I and II only B. I and III only C. II and III only D. I, II and III
39. The equation below shows a polymerisation process.
What is polymer Z ?
A. Rubber B. Starch C. Protein D. Polythene
DIAGRAM 21
DIAGRAM 22
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
50 SOALAN ULANGKAJI SPM 2013
40. Without using a spark plug, how does a four-stroke diesel engine ignites its fuel?
A. By friction B. By chemical reaction C. By using electrical energy D. By compressing the air in the cylinder to a very high
pressure and temperature
41. A car traveling on a straight road takes 5 s to increase its speed from 10 m/s to 50 m/s. What is its acceleration?
A. 2 ms-2
B. 6 ms-2
C. 8 ms-2
D. 14 ms-2
42. What are the factors affecting the pressure acting on a surface? I. Size II. Force III. Surface area
A. I and II only B. I and III only C. II and III only D. I, II and III
43. The statement below explains how fresh milk is preserved.
FRESH MILK IS HEATED TO 63°C FOR 30 MINUTES, AND QUICKLY COOLED
Based on the above statement, which of the following methods is used to preserve fresh milk?
A. Cooling B. Sterilisation C. Dehydration D. Pasteurisation
43. Which of the following will happen if the human population increases faster than food production?
A. More R&D activities will be carried out. B. People will suffer from starvation C. People will suffer from disease D. Land will be wasted
45. Which of the following is an example of thermosetting plastics? A. Perspex B. Polythene C. Polystyrene D. Bakelite
46. Plastics cause environmental pollution because I. they are non-biodegradable II. they block the drainage system III. the burning of plastics produces toxic gases.
A. I and II only B. I and III only C. II and III only D. I, II and III
47. Which of the following pairs is incorrectly matched?
48. Waves are generated by A. electricity B. solar energy C. compression D. forces that cause vibrations or oscillations
49. A communication satellite functions as I. a receiver II. a transmitter III. an amplifier
A. I and II only B. I and III only C. II and III only D. I, II and III
50. In radio transmission system, sound waves are changed into audio signals by
A. an oscillator B. a microphone C. a modulator D. an aerial
EnDOFQUESTIOnSPAPER
Synthetic Polymer UseA Polythene Plastic bags
B Polyvinyl chloride (PVC) Electric plugs and sockets
C Polystyrene Protective packaging for electronic goods
D Perspex Windows of aeroplanes
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
51 SOALAN ULANGKAJI SPM 2013
Science Paper 2 [1511/2]
Section A[20 marks]
Answer all the questions in this section. (You are advised to spend 60 minutes on this section.)
1. Diagram 1 shows an experiment to study the melting point of substance Q.
The result of the experiment are recorded in Table 1.
(a) Based on Table 1, draw a graph of temperature against time. [2 marks]
(b) Based on the graph in (a), determine the melting point of substance Q. Mark the melting point of substance Q on the graph. _________________________________________________________________________ [1 mark]
(c) What is the relationship between the temperature of substance Q and time in the first 10 minutes. _________________________________________________________________________ [1 mark]
(d) State one responding variable in this experiment? _________________________________________________________________________ [1 mark]
DIAGRAM 1
TABLE 1
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
52 SOALAN ULANGKAJI SPM 2013
2. Diagram 2 shows an experiment to compare the reactivity of metals X, Y and Z with dilute acid.
(a) Write down one observation for the above experiment _________________________________________________________________________ [1 mark]
(b) Write down one inference that can be made from the above observation _________________________________________________________________________ [1 mark]
(c) State the manipulated variable in this experiment _________________________________________________________________________ [1 mark]
(d) Predict what are metals X and Y in Diagram 2 using the following information:
Aluminium Magnesium
[2 marks]
3. Diagram 3 shows an object K in front of a convex lens
(a) Draw a ray diagram of the image formed by object P in Diagram 3 [2 marks]
(b) Measure and write down the size of the image
__________________ cm [ 1 mark ]
(c) State one characteristic of the image formed in Diagram 3. _________________________________________________________________________ [ 1 mark ]
(d) Name one optical instrument which uses the principle shown in Diagram 3? _________________________________________________________________________ [ 1 mark ]
DIAGRAM 2
DIAGRAM 3
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
53 SOALAN ULANGKAJI SPM 2013
4. Diagram 4.1 shows the apparatus set up to study the hardness of copper and brass
Diagram 4.2(a) and Diagram 4.2(b) shows the effect on the copper and brass when weights of the same mass are dropped on them
(a) State one fixed variable in this experiment? _________________________________________________________________________ [1 mark]
(b) State one inference that can be made based on the observation _________________________________________________________________________ [1 mark]
(c) Based on Diagram 4.2(a), measure and write down the depth of the dent made by the copper block __________________ cm [1 mark]
(d) State the composition of brass. _________________________________________________________________________ [1 mark]
(e) What is the operational definition of a copper block _________________________________________________________________________ [1 mark]
DIAGRAM 4.1
DIAGRAM 4.2a DIAGRAM 4.2b
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
54 SOALAN ULANGKAJI SPM 2013
Section B[30 marks]
Answer all questions. (You are advised to spend 50 minutes on this section.)
5. Diagram 5 shows a section through the human brain
(a) Name Q and R in the space provided in Diagram 5 Q: _______________________________________________________________________ R: _______________________________________________________________________ [2 marks]
(b) State one function of the part labelled P _________________________________________________________________________ [1 mark]
(c) P has folded surfaces. What is the reason for having folded surface? _________________________________________________________________________ [1 mark]
(d) Tick(√ ) the actions controlled by part R of the brain
6. Diagram 6 shows chromosome sets in a Child Q with a genetic disorder
(a) What type of mutation is formed in Diagram 6? _________________________________________________________________________ [1 mark]
(b) Name the disease that Child Q may be suffering from? _________________________________________________________________________ [1 mark] (c) How many chromosomes did Child Q have? _________________________________________________________________________ [1 mark]
(d) Which pair of chromosome can cause the child to suffer from the disease named in (b) _________________________________________________________________________ [1 mark]
(e) Give one characteristic features of Child Q _________________________________________________________________________ [1 mark]
(f ) Based on Diagram 6, what would be the sex of Child Q? _________________________________________________________________________ [1 mark]
DIAGRAM 5
DIAGRAM 6
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
55 SOALAN ULANGKAJI SPM 2013
7 Diagram 7 shows the apparatus set-up to obtain pure ethanol from a solution
(a) Name the method shown in Diagram 7. _________________________________________________________________________ [1 mark]
(b) Why is water let into the condenser from the lower tube? _________________________________________________________________________ [1 mark]
(c) Suggest one use for the pieces of porcelain? _________________________________________________________________________ [1 mark]
(d) The method of purification is a combination of two processes. What are they? _________________________________________________________________________ [2 marks]
(e) Based on Diagram 7, name the distillate? _________________________________________________________________________ [1 mark]
8. Diagram 8 shows three radioactive rays, each with different penetration force.
(a) On Diagram 8, name the radioactive rays P, Q and R? _________________________________________________________________________ [3 marks]
(b) Which ray does not deflect in an electric field _________________________________________________________________________ [1 mark]
Radioisotopes in Table 8 are important for human beings
(c) Based on Table 8, write down the radioisotopes used for agriculture purposes? _________________________________________________________________________ [2 marks]
DIAGRAM 7
DIAGRAM 8
TABLE 8
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
56 SOALAN ULANGKAJI SPM 2013
9. Diagram 9 shows an apparatus set-up to study the reaction of different metals with oxygen.
(a) On Diagram 9, name K and L using the following information:
GlasswoolPotassiummanganate(VII)
Metalpowder [2 marks]
(b) State the function of potassium manganate(VII) in this experiment? __________________________________________________________________________ [1 mark]
Table 9 shows the observation of this experiment
(c) Based on Table 9, state
(i) the most reactive metal ___________________________________________________________________
(ii) the least reactive metal ___________________________________________________________________
[2 marks]
(d) Arrange the metals descendingly occording to their reactivity with oxygen __________________________________________________________________________ [1 mark]
DIAGRAM 9
TABLE 9
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
57 SOALAN ULANGKAJI SPM 2013
Section C[20 marks]
Answer Question 1 and any of Question 2 or Question 3. (You are advised to spend 40 minutes on this section.)
10. Study the following statement :
Differentcolourfilterstransmitdifferentcolouredlightswhenwhitelightpassesthroughit
You are given red filter, blue filter, green filter and other apparatus.
(a) Suggest a suitable hypothesis for this scientific investigation [1 mark]
(b) Using red filter, blue filter, green filter and other apparatus, describe an experiment based on the following criteria
• Aimoftheexperiment [1mark]
• Thevariables [2marks]
• Listofapparatusandmaterials [1mark]
• Procedure [4marks]
• Tabulationofdata [1mark]
11. (a) State four differences between physical change and chemical change. [4 marks]
(b) Figure 11 shows examples of several metals
Study the above figure. Explain how you would develop a concept based on the information in Figure 11. Your answer should be based on the following steps:
• Identifytwocommoncharacteristics [2marks]
• Developinitialconcept [1mark]
• Giveanotherexampleandnon-exampleinrelationtotheconcept [2marks]
• Explaintheactualconcept [1mark]
FIGURE 11
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
58 SOALAN ULANGKAJI SPM 2013
12. (a) State three purposes of alloying and give one example of alloy [4 marks]
(b) Sungai Pasir Industrial Park has become heavily polluted with toxic gases released by factories. After several years, acid rain takes place at the industrial park.You, as an environment officer, have been asked to explain to the factory managers how to overcome this problem
Your answer should include the following:
• Identifytheproblem [1mark]
• Clarificationoftheproblem [1mark]
• Solvingmethods [3marks]
• Choosethebestmethodandexplainyourchoice [1mark]
EnDOFQUESTIOnSPAPER
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
59 SOALAN ULANGKAJI SPM 2013
Additional Mathematics Analysis
[3472/1][3472/2]
NO TOPICSPAPER 1 PAPER 2
2006 2007 2008 2009 2010 2011 2012 2006 2007 2008 2009 2010 2011 2012
1 Functions 1,2 1,2,3 1,2,3 1,2,3 1,2,3 1,2,3 1,2,3 2 - - - - - -
2 Quadratic Equations 3 4 4 4 5 5 5 - - - 2a,2c - - 2
3 Quadratic Functions 4,5 5,6 5,6 5,6 4,6 4,6 4,6 - - 2 2b - - -
4 Simultaneous Equation - - - - - - - 1 1 1 1 1 1 1
5 Indices and Logarithms 6,7,8 7,8 7,8 7,8 7,8 7,8 7,8 - - - - - - -
6 Coordinate Geometry 12 13,14 13,14 15 13,14 13,14 13,14 9 2 10 9 5 5 10
7 Statistics 24 22 22 24 22 22 22 6 5 5 - 6 6 4
8 Circular Measures 16 18 18 12 17 17 17 10 9 9 10 11 11 9
9 Differentiation 17,18,19
19,20
19,20
19,20
20,21
19,20,21
19,20,21 - 4a,
4b 7a 3a,7a 8 4b,
8 8
10 Solution of Triangles - - - - - - - 13 15 14 12 13 13 14
11 Index Number - - - - - - - 15 13 13 13 15 15 13
12 Progressions 9,10 9,10,11
9,10,11
9,10,11
9,10,11
9,10,11
9,10,11 3 6 3 6 3 3 3
13 Linear Law 11 12 12 12 12 12 12 7 7 8 8 7 7 7
14 Integration 20,21 21 21 18,20,21 19 - - 8 4c,
10 7b,7c 3b,7 4 4a -
15 Vectors 15, - - - - 15,16 15,16 - - - - - 9 5
16 Trigonometric Functions 15 17 17 16,17 18 18 18 4 3 4 4 2 2 6
17Permutations
And Combinations
22 22 23 22 23 23 23 - - - - - - -
18 Probability 23 24 24 23 24 24 24 - - - - - - -
19 Probability Distributions 25 25 25 25 25 25 25 11 11 11 11 10 10 11
20 Motion Along A Straight Line - - - - - - - 12 12 12 15 12 12 12
21 Linear Programming - - - - - - - 14 14 15 14 14 14 15
TOTAL 25 25 25 25 25 25 25 15 15 15 15 15 15 15
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
60 SOALAN ULANGKAJI SPM 2013
Additional Mathematic Paper 1 [3472/1]
Answer all questions.Jawab semua soalan.
1 The Cartesian graph above represents a relation of set A = {1, 3, 5, 6} and set B = {1, 2, 3, 4}. State Graf pada rajah di atas menunjukkan hubungan set A = {1, 3, 5, 6} dan set B = {1, 2, 3, 4}. Nyatakan (a) the image of 1, imej bagi 1,
(b) whether the relation is a function or not. samada hubungan ini merupakan fungsi atau tidak. [2 marks]
Answer : (a) ______________________________ (b) ______________________________
2 Given that , find .
Diberi fungsi , cari . [2 marks]
Answer : ________________________________
3 Find the value of p if the quadratic equation p(x2 + 1) = 6x has two equal roots.
Carinilaipjikapersamaankuadratikp(x2+1)=6xmempunyaipunca-puncayangsama. [2 marks]
Answer : ________________________________
4 Given that , find the range of values of x which satisfy the inequality
Diberi , cari julat nilai x yang memuaskan ketaksamaan [2 marks]
Answer : ________________________________
5 Given that , find the value of k and of m.
Diberi , cari nilai k dan nilai m. [3 marks]
Answer : (k) _____________________________ (m) _____________________________
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
61 SOALAN ULANGKAJI SPM 2013
6 Solve the equation .
Selesaikan persamaan . [2 marks]
Answer : ________________________________
7 Given that 4 logx 2 + 2 logx 7 – logx 98 = 3, find the value of x.
Diberi 4 logx 2 + 2 logx7–logx98=3,carinilaix. [3 marks]
Answer : x = _____________________________
8 Given that 11, p + 1, 19 are three consecutive terms of an arithmetic progression and (p + 1) is the sixth term, find the value of
Diberi11,p+1,19ialahtigasebutanberturutandalamsatujanjangaritmetik dan (p + 1) ialah sebutan keenam, cari nilai (a) p, (b) the first term. sebutan pertama. [3 marks]
Answer : (a) p = __________________________
(b) _____________________________
9 Express the recurring decimal 2·133333……. as a fraction in its simplest form.
Ungkapkan perpuluhan jadi semula 2·133333… dalam bentuk pecahan yang termudah. [3 marks]
Answer : (a) m = __________________________
(b) _____________________________
10 The common ratio of a geometric progression is and the sum to infinity is 21. State the first three terms of the progression.
Nisbah sepunya suatu janjang geometri ialah dan hasil tambah sehingga ketakterhinggaannya ialah 21. Nyatakan tiga sebutan pertama janjang ini. [3 marks]
Answer : ________________________________
11 Given the straight line 4x + 3y − 6 = 0 is parallel to the straight line y = ax + b which passes through the point (−12, 5), find the value of a and of b.
Diberigarislurus4x+3y−6=0adalahselaridengangarislurusy=ax+byangmelaluititik(−12,5), cari nilai a dan nilai b. [3 marks]
Answer : (a) _____________________________
(b) _____________________________
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
62 SOALAN ULANGKAJI SPM 2013
12 The diagram above shows the straight line graph obtained by plotting against x.
Rajah di atas menunjukkan graf garis lurus yang didapati dengan memplotkan melawan x.
(a) Calculate the value of p. Hitungkan nilai p.
(b) Express y in terms of x. Ungkapkan y dalam sebutan x. [4 marks]
Answer : (a) _____________________________
(b) _____________________________
13 Given that O is an origin and M(3, −4). If MP = 2i − 3j,
Diberi O ialah titik asalan dan M(3, −4). Jika MP = 2i − 3j,
(a) Express OM in terms of i and j. Ungkapkan OM dalam sebutan i dan j.
(b) Find | OP |. Cari | OP |. [3 marks]
Answer : (a) _____________________________
(b) _____________________________
14 Given that a = 2i + (p + 1)j and b = –3i + 6j, find the value of p in each of the following cases :
Diberi a = 2i + (p + 1)j dan b=–3i+6j, cari nilai p bagi setiap kes yang berikut :
(a) a + b is parallel to x-axis. a + b selari dengan paksi-x
(b) a is parallel to b. a selari dengan b. [4 marks]
Answer : (a) p = __________________________
(b) p = __________________________
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
63 SOALAN ULANGKAJI SPM 2013
15 Find the equation of the curve which has the gradient function x2(x + 3) and passes through the point (2, 14).
Cari persamaan lengkung yang mempunyai fungsi kecerunan x2(x + 3) dan melalui titik (2, 14). [3 marks]
Answer : ________________________________
16 Given , find the value
Diberi , cari nilai
(a)
(b) k if
k jika [4 marks]
Answer : (a) ______________________________
(b) k = ___________________________
17 Given , find the value of f ″ (1).
Diberi , cari nilai bagi f ″ (1). [3 marks]
Answer : ________________________________
18 The volume of the liquid in a container, V cm3 is given by V = 2x3 + 4x2 + 5, where x cm is the depth of the liquid in the container. Given that V increases at a rate of 32 cm3s−1, find the rate of increase of x when x = 2.
Isipadu cecair dalam sebuah bekas V cm3 diberi oleh V = 2x3 + 4x2+5,dimanaxcmialahkedalamancecairdalambekasitu. Diberi bahawa V bertambah dengan kadar 32 cm3s−1, cari kadar pertambahan x pada ketika x = 2. [4 marks]
Answer : ________________________________
19 Find the equation of the normal to the curve at the point (2, 8).
Cari persamaan normal kepada lengkung pada titik (2, 8). [4 marks]
Answer : ________________________________
20 The right diagram shows a semi circle with centre O and diameter POR = 8 cm. Given that the arc length of PQ is 3·87 cm, calculate
Rajah kanan menunjukkan sebuah semi bulatan berpusat O dengan diameter POR = 8 cm. Diberi panjang lengkok PQ ialah 3·87 cm, hitungkan
(a) the value of θ in radian, nilai θ dalam radian, (b) the area of sector OQR, luas sektor OQR. (Use/Gunakan π = 3·142) [4 marks] Answer : (a) _____________________________
(b) _____________________________
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
64 SOALAN ULANGKAJI SPM 2013
21 Given that cos A = and sin B = where A and B are obtuse angles, find the value of
Diberi kos A = dan sin B = dengan sudut A dan B ialah sudut cakah, cari nilai
(a) sin 2A, (b) cos (B − A). kos(B–A). [4 marks]
Answer : (a) _____________________________
(b) _____________________________
22 Five letters from the word T S U N A M I is to be arranged in a row begins with a vowel. Find the probability that the arrangement begins with the letter U.
Lima daripada huruf-huruf dalam perkataan TSUnAMIdisusun sebaris bermula dengan suatu vokal. Cari kebarangkalian jika susunan itu bermula dengan huruf U. [3 marks]
Answer : ________________________________
23 The mean of a set of 25 numbers is 24. Minbagisatusetyangmempunyai25nomborialah24.
(a) If every number in the set is added by 2, determine the new mean of the set. Jika setiap nombor dalam set itu ditambah dengan 2, tentukan min baru bagi set itu.
(b) If two numbers k and k + 2 are taken out from the set, the new mean is 22, find the value of k. Jika dua nombor k dan k + 2 dikeluarkan daripada set itu, min baru bagi set itu ialah 22, cari nilai k. [4 marks]
Answer : (a) ______________________________
(b) k = ___________________________
24 In a chess competition, Peter plays five games. The probability that Peter wins one of the games is . Calculate the probability that Peter won
Dalam satu pertandingan catur, Peter bermain lima permainan. Kebarangkalian bahawa Peter memenangi mana-mana satu permainan ialah . Hitungkan kebarangkalian bahawa Peter memenangi
(a) three games after playing four games, tiga permainan selepas empat permainan,
(b) the first game and the last game. permainan pertama dan permainan terakhir. [4 marks]
Answer : (a) _____________________________
(b) _____________________________
25 X is a continuous random variable with X ~ N(μ, 25). If P(X < 9) = 0·7257, find the value of μ.
XialahpembolehubahrawakselanjardenganX~N(μ,25). JikaP(X<9)=0·7257,carinilaiμ. [4 marks]
Answer : ________________________________
EnDOFQUESTIOnSPAPER
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
65 SOALAN ULANGKAJI SPM 2013
Additional Mathematic Paper 2 [3472/2]
Section A / BahagianA[40 marks / 40markah]
Answer all questions from this sectionJawab semua soalan dalam bahagian ini.
1 Solve the equation 2p + k = p2 + k2 − 5 = 5 [6 marks]
Selesaikanpersamaan2p+k=p2+k2−5=5.
2 A function is defined by , for all values of x except x = h, and m is a constant.
Satu fungsi ditakrifkan oleh , bagi semua nilai x kecuali x = h, dan m ialah pemalar.
(a) Determine the value of h. Tentukan nilai h.
(b) Given that 2 maps onto itself under the function g, find Diberi nilai 2 dipetakan kepada dirinya sendiri di bawah fungsi g , cari
(i) the value of m, nilai m,
(ii) the value of
nilai bagi
(iii) the value of p if g(2p) = 5 nilaipjikag(2p)=5 [7 marks]
3 The straight line x + 4y = p is normal to the curve y = (2x – 1)2 + 1 at the point Q.
Garislurusx+4y=padalahnormalkepadalengkungy=(2x–1)2 + 1 pada titik Q.
Find / Cari
(a) the coordinates of Q, [4 marks] koordinat-koordinat Q,
(b) the value of p, [1 mark] nilai p,
(c) the equation of the tangent at the point Q. [2 marks] persamaan tangen pada titik Q.
4 In Diagram 1, the equation of the straight line PQR is 2x – y + 4 = 0. If PQ : QR = 2 : 3, find
Dalam Rajah 1, persamaan garis lurus PQR ialah 2x–y+4=0.JikaPQ:QR=2:3,cari
(a) the coordinates of R, [3 marks] koordinat-koordinat R,
(b) the equation of perpendicular bisector PR, [4 marks] persamaan pembahagi dua sama serenjang PR.
DIAGRAM 1
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
66 SOALAN ULANGKAJI SPM 2013
5 Solve each of the following equations : Selesaikan setiap persamaan berikut :
(a) [3 marks]
(b) log5 3x – log5 (x – 2) = 1 [3 marks]
6 (a) The sum of the first n terms of an arithmetic progression is given by Sn
Hasil tambah n sebutan pertama suatu janjang aritmetik diberi oleh Sn Find / Cari
(i) the first term and common difference, sebutan pertama dan beza sepunya,
(ii) the sum of the all the terms from the 5th term to the 10th term. hasiltambahsebutanke5hinggasebutanke10. [5 marks]
(b) Given that the 5th and the 8th terms of a geometric progression are 2 and respectively, find the common ratio of this progression.
Diberi sebutan kelima dan sebutan kelapan suatu janjang geometri masing-masing ialah 2 dan , carikan nisbah sepunya janjang tersebut.
[2 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
67 SOALAN ULANGKAJI SPM 2013
Section B / BahagianB[40 marks / 40markah]
Answer four questions from this sectionJawab empat soalan dalam bahagian ini.
7 Diagram 2 shows two sectors of a circle, sector OCBA with centre O and sector PCOA with centre P. Δ OAP and Δ OPC are two congruent equilateral triangle with sides 8 cm. Find
Rajah 2 menunjukkan dua sektor bulatan iaitu sektor OCBA yang berpusat di O dan sektor PCOA yang berpusat di P. Δ OAP dan Δ OPC adalah dua segi tiga sama sisi yang kongruen dan mempunyai sisi 8 cm. Cari
(a) the reflex angle AOC in radian, sudutrefleksAOCdalamradian, [1 mark] (b) the perimeter of the shaded region, perimeter kawasan berlorek, [3 marks] (c) the area of the major sector OCBA, luas sektor major OCBA, [2 marks]
(d) the area of the shaded region. luas kawasan berlorek. [4 marks] [Use/ Gunakan π = 3.142]
DIAGRAM 2
8 Table 1 shows the values of two variables, x and y which are related by the equation y = ax (x + b) , where a and b are constants.
Jadual 1 menunjukkan nilai bagi dua pembolehubah x dan y yang dihubungkan oleh persamaan y = ax (x + b) , dengan keadaan a dan b ialah pemalar.
(a) Reduce the equation y = ax (x + b) to the linear form. Tukarkan persamaan y = ax (x + b) kepada persamaan bentuk linear. [1 mark]
(b) Plot the graph of against x . / Lukiskan graf melawan x . [4 marks]
(c) Use the graph from (a) to find Gunakan graf anda dari (a) untuk mencari
(i) the value of a and of b nilai a dan nilai b,
(ii) the value of y when x = 6 nilaiyapabilax=6. [5 marks]
9 (a) A set of game score x1 , x2 , x3 , x4 and x5 has the mean 6 and standard deviation 1·2.
Satu set skor bagi suatu permainan x1 , x2 , x3 , x4 dan x5mempunyaimin6dansisihanpiawai1·2.
(i) Find the sum of the squares of the score, Σx2 Cari hasil tambah kuasa dua skor itu, Σx2 [2 marks]
(ii) If each score is multiplied by 3 and 2 is added to it, find the mean and variance of the new score. Jika setiap skor itu didarabkan dengan 3 dan ditambah dengan 2, cari min dan varians bagi set skor yang baru. [3 marks]
TABLE 1 / JADUAL 1
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
68 SOALAN ULANGKAJI SPM 2013
(b) Table 2 shows the marks obtained by a group of students in a particular test. Jadual 2 menunjukkan markah yang diperoleh sekumpulan pelajar dalam satu ujian.
(i) Without drawing an ogive, find the median marks. [3 marks] Tanpa melukis ogif, cari median bagi markah-markah itu.
(ii) Calculate the mean marks. [2 marks] Hitungkan markah min.
10 Given the quadratic function f(x) = − 4x2 + 8x − 1. Diberi fungsi kuadratik f(x) = − 4x2 + 8x − 1.
(a) Express the quadratic function f(x) in the form p(x + q)2 + r , where p, q and r are constants. Determine whether the function f(x) has a minimum or maximum value and state its value.
Ungkapkan fungsi kuadratik f(x) dalam bentuk p(x + q)2 + r dengan keadaan p, q dan r ialah pemalar. Tentukan sama ada fungsi f(x) mempunyai nilai maksimum atau nilai minimum dan nyatakan nilainya. [3 marks]
(b) Sketch the graph of the function f(x) for the domain − 1 ≤ x ≤ 3. State the corresponding range for this domain. Lakarkan graf fungsi f(x) untuk domain − 1 ≤ x ≤ 3. Nyatakan julat yang sepadan dengan domain ini. [3 marks]
(c) Find the range of values of k such that f(x) = kx has no real roots.
Cari julat nilai k supaya f(x) = kx tidak mempunyai punca nyata. [4 marks]
11 (a) Given that ABCD is a parallelogram where BC = 2i + 3j and CD = − 2i – 2j, find
Diberi ABCD ialah sebuah segi empat selari dengan BC = 2i + 3j dan CD = − 2i–2j, cari
(i) AC,
(ii) the unit vector in the direction of AB. / vektor unit pada arah AB. [4 marks]
TABLE 2 / JADUAL 2
(b) Diagram 3 shows a triangle ABC where CP = λ CB.
Given that AB = a and AC = b . Rajah 3 menunjukkan sebuah segi tiga ABC dengan CP = λ CB
Diberi AB = a dan AC = b .
(i) Show that AP = λ a + (1 − λ )b
Tunjukkan bahawa AP = λ a + (1 − λ )b
(ii) If BP = − 3a + 3b, find the value of λ.
Jika BP = − 3a + 3b, cari nilai λ. [6 mark]
DIAGRAM 3
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
69 SOALAN ULANGKAJI SPM 2013
Section C / Bahagian C[40 marks / 40 markah]
Answer two questions from this sectionJawab dua soalan daripada bahagian ini.
12 A particle moves along a straight line from a fixed point O. Its displacement, S m is given by S = 9t2 – t3 , where t is the time in seconds after leaving the point Q.
(Assume that motion to the right is positive)
Suatu zarah bergerak di sepanjang suatu garis lurus bermula dari satu titik tetap O. Sesarannya, S m, diberi oleh S = 9t2 – t3 , dengan keadaan t ialah masa, dalam saat, selepas meninggalkan titik Q.
(Anggapkan gerakan ke arah kanan sebagai positif)
Find / Cari
(a) the distance travelled the 2nd second, [2 marks] jarak yang dilalui dalam saat kedua,
(b) the time at which the velocity of the particle is uniform, masa ketika zarah mencapai halaju seragam, [3 marks]
(c) the value of t when the particle passes the point Q again, nilai t apabila zarah itu melalui titik Q semula, [2 marks]
(d) the range of values of t during which the particle is moving towards the point Q after instantaneous rest. julat nilai t apabila zarah menuju ke titik Q selepas rehat seketika. [3 marks]
13 Table 3 shows the price of a set of football jersey which has been worn by a particular team at Lion Championship tournament in the year 2003 and 2004.
Jadual3menunjukkanhargabagisatusetjersibolasepakyangdipakaiolehsatupasukandikejohananPialaLionuntuktahun2003dan2004.
(a) Calculate the values of x, y and z. Hitung nilai x, y dan z. [4 marks]
(b) Given that the index number of Adibas jersey is 120 in the year 2003 based on the year 2002, find the price in the year 2002. DiberiindekshargauntukjersiAdibasialah120padatahun2003berasaskantahun2002,cariharganyapadatahun2002. [2 marks]
(c) If the price of Nikas jersey increases at a constant rate every year, determine the price in the year 2005 to the nearest RM. JikahargajersijenamaNikasbertambahdengankadartetapsetiaptahun,tentukanharganyapadatahun2005kepadaRM
terdekat. [4 marks]
TABLE 3 / JADUAL 3
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
70 SOALAN ULANGKAJI SPM 2013
14 Given that x and y are positive integers with the following conditions : Diberi x dan y ialah dua integer positif dengan keadaan berikut :
I : The value of x is more than the value of y by 5 or more Nilaixmelebihinilaiysebanyak5ataulebih.
II : The minimum value of 2x + 3y is 60 Nilaiminimumbagi2x+3yialah60.
III : The maximum value of 4x + 3y is 5 times the minimum value of 2x + 3y Nilaimaksimumbagi4x+3yialah5kalinilaiminimumbagi2x+3y.
(a) Write down three inequalities which satisfy the above conditions. Tulis tiga ketaksamaan bagi setiap keadaan di atas. [3 marks]
(b) Construct and shade the region R that satisfies all of the above conditions. Bina dan lorekkan rantau R yang memuaskan syarat-syarat di atas. [3 marks]
(c) By using your graph from (b), answer the following questions : Dengan menggunakan graf anda dari (b), jawab soalan-soalan berikut :
(i) Find the minimum value of the sum of the integers. Cari nilai minimum bagi hasil tambah integer tersebut. [1 mark]
(ii) Given that x and y represents the number of item M and item N respectively which was sold by the company. Find the total maximum sale obtained if the price of one unit item M and N are RM15 and RM30 respectively.
Diberi bahawa x dan y masing-masing mewakili bilangan barang M dan barang N yang dijual oleh sebuah syarikat. CarijumlahjualanmaksimumyangdiperolehjikahargaseunitbarangMdanbarangNmasing-masingialahRM15 danRM30.
[3 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
71 SOALAN ULANGKAJI SPM 2013
15 (a) Diagram 4 shows a triangle PQR. Calculate QPR. Rajah 4 menunjukkan sebuah segi tiga PQR. Hitungkan QPR. [3 marks]
DIAGRAM 4 / RAJAH 4
DIAGRAM 5 / RAJAH 5
(b) In Diagram 5, ABC and BCD are two triangles which attached at BC. Calculate DalamRajah5,ABCdanBCDialahduabuahsegitigayangbertemupadagarisBC.Hitungkan
(i) the length of BC, / panjang BC,
(ii) BCD,
(iii) the area of whole diagram, / luas seluruh rajah. [7 marks]
EnDOFQUESTIOnSPAPER
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
72 SOALAN ULANGKAJI SPM 2013
PhysicsAnalysis
[4531/1][4531/2][4531/3]
CHAPTER 2008 2009 2010 2011 2012
FORM
4
Introduction Of Physics 3 3 2 3 4
Forces And Motion 7 8 9 9 8
Forces And Pressure 8 7 8 5 7
Heat 5 5 4 4 5
Light 5 5 4 5 5
FORM
5
Waves 6 6 8 7 6
Electricity 4 4 5 5 4
Electromagnetism 5 5 6 3 4
Electronics 4 4 1 6 3
Radioactivity 3 3 3 3 4
CHAPTERSECTION A SECTION B SECTION C
‘08 ‘09 ‘10 ‘11 ‘12 ‘08 ‘09 ‘10 ‘11 ‘12 ‘08 ‘09 ‘10 ‘11 ‘12
FORM
4
Introduction Of Physics - - 1 - 1 - - - - - 1 - - - -
Forces And Motion 1 1 1 1 1 1 - - 1 - 1 - 1 - 1
Forces And Pressure 1 1 - - - - 1 1 - 1 - - - 1 -
Heat 1 1 1 1 1 - - - - - - 1 - - -
Light 1 1 1 1 - - - - - - - - - - -
FORM
5
Waves 1 1 2 1 2 - - 1 - 1 - - - - -
Electricity 1 - - 1 - - - - - - - 1 1 - 1
Electromagnetism 2/3 1 - 1 1 - - - 1 - - - - - -
Electronics 1 ⅓ 1 1 1 1 - - - - - - - - - -
Radioactivity - 1 1 1 1 1 1 - - - - - - 1 -
CHAPTERSECTION A SECTION B
2008 2009 2010 2011 2012 2008 2009 2010 2011 2012
FORM
4
Introduction Of Physics 1 - 1 - - - - - -
Forces And Motion 1 - - - - 1 1 - -
Forces And Pressure - 1 - 1 1 1 - - - -
Heat - - - 1 - - - - 1
Light - - - - - - - 1 -
FORM
5
Waves - 1 1 - 1 - - - 1 -
Electricity - - - - - - - - 1
Electromagnetism - - - - 1 1 1 - -
Electronics - - - - - - - - -
Radioactivity - - - - - - - - -
PAPER 1
PAPER 2
PAPER 3
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
73 SOALAN ULANGKAJI SPM 2013
The momentum of the object is zero from A 0 s to 2 s C 2 s to 6 s B 2 s to 4 s D 6 s to 8 s
7. Diagram 5 shows a horizontal force of 100 N being exerted on a box of mass 20 kg.
Diagram 5
The box moves with an acceleration of 4.0 ms-2. Calculate the frictional force between the box and the floor.
A 20 N C 80 N B 40 N D 400 N 8. Diagram 4 shows two men are lifting a full of water pail with
forces F1 and F2 respectively.
Diagram 4
Which of the following represents the forces in equilibrium acting on the pail?
A C
B D
9. A coconut falling freely from a tree takes 1.2 s to reach the ground. What is the distance between the initial position of the coconut and the ground? (Acceleration due to gravity = 10 ms-2)
A 1.44 m C 10.0 m B 7.2 m D 12.0 m
Physics Paper 1 [4531/1]
1. Which of the following physical quantity is a derived quantity? A Mass C Length
B Temperature D Area 2. Sensitivity of a measuring instrument is the ability of the
instrument. A to avoid zero error. B to produce an accurate reading. C to detect a small change in the quantity to be measured. D to avoid parallex error. 3. Diagram 1 shows part of a micrometer screw gauge.
Diagram 1 What is the reading of the micrometer? A 4.28 mm C 4.78 mm B 4.32 mm D 4.82 mm 4. Which of the following displacements is the same as 234.6 Gm ? A 2.346 x 1011 m C 2.346 x 109 m B 2.346 x 1010 m D 2.346 x 108 m 5. Diagram 2 shows trolley A and B of same masses.
Diagram 2
Which comparisons are true for the momentum of trolleys A and B after collision?
Trolley A Trolley B A Increase Increase B Increase Decrease C Decrease Increase D Unchanged Unchanged
6. Diagram 3 shows a displacement-time graph for the motion of an object.
Diagram 3
Each question is followed by either three, four or five options. Choose the best option for each question and then blacken the correct space on the answer sheet.
F1
F1
W
W
F2
W
F1
F2
F2
F1
W
F2
F1 F2
Pail
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
74 SOALAN ULANGKAJI SPM 2013
10. Diagram 6 shows a 150 g ball is moving at a speed of 45 m s -1 when it is hit by a baseball bat. The ball rebounds at a speed of 55 m s -1 and its time of contact with the bat is 0.04 s.
Diagram 6
What is the impulsive force on the ball? A 37.5 N C 375.0 N B 60.0 N D 540.0 N
11. Diagram 7 shows two identical springs.
Diagram 7
Calculate the value of x. A 3 cm C 5 cm B 4 cm D 6 cm
12. Which of the instruments applies the Pascal’s principle? A Lift pump C Bunsen burner B Hydrometer D Hydraulic Jack
13. Gas in an enclosed container exerts a pressure inside the container. This is because the gas molecules
A are spherical in shape. B attract each other. C collide with each other. D collide with the walls of the container.
14. Diagram 8 shows a manometer is used to measure the pressure of the gas in the container.
Diagram 8
Which of the statements is true about the pressure of the gas in the container if the atmospheric pressure is 76.0 cm Hg?
A The gas pressure is zero B The gas pressure is equal to the atmospheric pressure C The gas pressure is 24.0 cm Hg less than atmospheric
pressure D The gas pressure is 24.0 cm Hg more than atmospheric
pressure
15. Diagram 9 contains incompressible liquid. A downward force of 12 N is exerted on piston K. What will be the magnitude of the upward force experienced by piston L?
Diagram 9
A Lift pump C Bunsen burner B Hydrometer D Hydraulic Jack
16. Diagram 10 shows the pressure-temperature graph for a fixed mass of gas at constant volume.
Diagram 10
Which statement is correct about the gas? A The gas pressure is zero at 0°C. B The gas molekul are stationary at 0K. C The kinetic energy of the molecules is maximum at 0K. D The gas pressure is inversely proportional to the
temperature.
17. Table 1 shows three solids and their respective specific heat capacity.
Table 1
By assuming all three solids have high melting points, which is suitable for making the base of a frying pan and which is suitable for making the handle of the frying pan?
Base of frying pan Handle of frying pan A R T B T R C S T D T S
18. What is the process that causes the smell of durians in the market to be detected from a faraway place?
A Vaporisation C Diffusion B Convection D Expansion
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
75 SOALAN ULANGKAJI SPM 2013
19. Diagram 11 shows a cuboids immersed in water. Which face of the cuboids is acted upon by the largest pressure?
Diagram 11
A PQRS C RSWV B TUVW D QRVU
20. A metallic sphere P, which has been heated to 70°C is submerged into a cooler liquid Q as shown in Diagram 12.
Diagram 12
Thermal equilibrium is achieved when… A temperature of P = temperature of Q B mass of liquid Q displaced = mass of P C volume of liquid Q displaced = volume of P D specific heat capacity of P = specific heat capacity of Q
21. Which of the following graphs correctly represents Pressure Law?
A C
B D
22. What is the physical quantity that is kept constant in Boyle’s Law, Charles’ Law and Pressure Law?
A Volume C Absolute temperature B Mass D Pressure 23. A piece of metal with specific heat capacity 200 J kg-1 °C-1
dropped from an aeroplane flying at an altitude of 800 m above the ground. Assuming that all the gravitational potential energy of the metal is converted to heat when the piece of metal hits the ground, what is rise in temperature?
A 35°C C 45°C B 40°C D 50°C
24. A student stands at a distance of 4 cm in front of a vertical plane mirror. How far is his image from him?
A 2 m C 8 m B 4 m D 12 m
25. A student draws ray diagram for light directed towards mirrors
M, N, O and P as shown in the diagrams below. F is the focal point of mirrors M, N, O and P.
Which ray diagram is correct? A I only C I, II, and IV only B I and II only D I, II, III and IV
☑ Sidemirrorofcar ☑Blindcornermirror
26. What is the similar nature of the mirror used in the two applications above?
A It produces multiple reflections. B It provides a wide field of vision. C Its image is enlarged. D It concentrates light at the principal focus.
27. The critical angle of light passing from rock salt into air is 40.5°. What is the refractive index of the rock salt?
A 1.54 C 0.025 B 0.65 D 1.32
28. Diagram 13 shows plane waves moving towards a slit.
Diagram 13
The motion of the waves through the slit will cause a change in the
A amplitude C wave speed B wavelength D frequency
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
76 SOALAN ULANGKAJI SPM 2013
29. Diagram 14 shows sound waves from a piano.
Diagram 14
Which of the following statements is true? A P has a higher pitch than Q B Q has a higher pitch than R C R has the highest pitch D P, Q and R have the same pitch
30. Which of the following have the longest wavelength? A Ultraviolet light C X-rays B Visible light D Radio waves
31. Diagram 15 shows an electric circuit
Diagram 15
Which of the following graph V against I is correct?
A B
C D
32. Diagram 16 shows the electric circuit. A voltmeter reading is
1.5V when the switch is opened. The voltmeter reading drops to 1.35V when a bulb is connected to the battery and the ammeter reading is 0.3 A.
Diagram 16
What is the internal resistance of the battery? A 0.5 Ω C 4.5 Ω B 1.0 Ω D 5.0 Ω
33. If the electrical energy consumption tariff is 22 cents per unit,what is the cost of using an 800 W air conditioner for 8 hours a day within 30 days ?
A RM 20.13 C RM 35.21 B RM 26.08 D RM 42.24
34. Diagram 17 shows a graph which shows how the potential difference, V, across the terminals of a cell changes with the current, I, through the cell.
Diagram 17
What is the internal resistance of the cell? A 0.80 Ω C 1.25 Ω B 1.16 Ω D 1.43 Ω 35. In the domestic electrical circuit, which of the following is
correct? Devices are connected in Fuses place in A Series Live wire B Series Neutral wire C Parallel Earth wire D Parallel Live wire
36. Diagram 18 shows a bar magnet moving towards a solenoid.
Which of these actions will not increase the deflection of the galvanometer pointer?
A Reversing the polarity of the magnet B Increasing the number of coils in the solenoid C Increasing the speed of the bar magnet D Increasing the number of magnets used
Diagram 18
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
77 SOALAN ULANGKAJI SPM 2013
37. Diagram 19 shows the polarities of the parts labeled X and Y of the horseshoe electromagnet.
X Y A North North B North South C South North D South South
38. Which of the following statements is not true regarding the ways to increase the strength of the magnetic field produced by a solenoid?
A Increase the number of turns per unit length of the solenoid.
B Replace the direct current flowing in the solenoid with alternating current.
C Insert a piece of soft iron into the solenoid. D Increase the magnitude of the current flowing in the
solenoid.
39. Diagram 20 shows a copper wire PQ in a magnetic field.
Diagram 20
The direction of motion of PQ can be determined by A Lenz’s law C Fleming’s left hand rule B Faraday’s law D Fleming’s right hand rule
40. The core of a transformer is normally made of soft iron. The reason for this choice is because soft iron
A is a good conductor of electricity. B rust easily. C can be easily magnetized and demagnetized. D is a good conductor of heat.
41. Which of the following statements is correct? A In a step down transformer, the output voltage is higher
than the input voltage. B The output power of a transformer can be greater than the
input power. C A transformer uses electromagnetic induction to produce
e.m.f. in its secondary coil. D Energy loss in a transformer due to eddy currents can be
reduced by using a soft iron core.
42. Diagram 21 shows a waveform on cathode ray oscilloscope (CRO) screen.
Diagram 21
If the Y-input of CRO is set at 5.0 V cm-1, what is the peak voltage?
A 20.0 Volt C 5.0 Volt B 10.0 Volt D 2.0 Volt
43. Diagram 22 below contains
Diagram 22
A two NOT gates and one AND gate. B two NOR gates and one NAND gate. C two OR gates and one AND gate. D two OR gates and one NAND gate.
44. The input signal 1101101 is applied to a NOT gate. The output is A 1100010 C 0010010 B 1011001 D 0011100
Diagram 19
Magnet
Bare copper wire
P
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
78 SOALAN ULANGKAJI SPM 2013
45. If c, b and e have the usual meanings for a transistor, which one of the transistors above is correctly labelled?
A C
B D
46. Diagram 23 shows a radioactive source emits radiation that can pass through a sheet of paper but not through thick aluminium.
Diagram 23
What type of radiation is emitted? A -particles C -particles B -particles D X-rays 47. Which of the following is a neutral atom?
Proton number Neutron number Electron number A 12 12 5 B 8 14 14 C 16 7 16 D 14 15 16
48. The equation above represents a nuclear fusion. What conditions must exist before the reaction above can take place?
A Very high temperature and pressure is required. B A catalyst must be added. C Neutrons must be bombarded to the reacting materials. D Oxygen must be present
49. Two types of emission from a radioactive source are separated by passing them through a magnetic field. The deflections are shown in diagram 24.
Diagram 24
Emission P Emission Q A Alpha particles Gamma rays B Beta particles Gamma rays C Gamma rays Alpha particles D Gamma rays Beta particles
50. The table below shows several safety measures that should be taken when dealing with radioactive substances except
A Avoid direct contact with the radioactive substances. B Always keep the radioactive substances in a lead container. C Wash your hand with soap and water when contaminated
with radioactive substances. D Do not drink or eat when handling radioactive substances.
EnDOFQUESTIOnSPAPER
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
79 SOALAN ULANGKAJI SPM 2013
Physics Paper 2 [4531/2]
Section A[60 marks]
Answer all questions in this section.
1. Diagram 1 shows a man as he jogs from P to R and back to Q.
DIAGRAM 1
(a) Name one physical quantity relating to the boy’s position as he jogs? __________________________________________________________________________ [1 mark]
(b) What is the type of the physical quantity that you state in (a)? Tick ( √ ) the correct answer in the box provided.
Scalar quantity
Vector quantity [1 mark]
(c) If he took 30 s to complete the motion, calculate his average velocity?
[2 marks]
2. Diagram 2.1 shows an observer near a pool. Water wave is a transverse wave and from his observations, the pattern of the water wave is as shown as the diagram below.
DIAGRAM 2.1
(a) What is meant by transverse wave? __________________________________________________________________________ [1 mark]
(b) (i) Name one type of transverse wave besides water wave? _______________________________________________________________________ [1 mark]
(ii) What is the wave phenomenon that was observed by the observer above? _______________________________________________________________________ [1 mark]
Concrete wall of the pool
Observer
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
80 SOALAN ULANGKAJI SPM 2013
(c) Complete the water wave pattern that propagates from the shallow region to the deep region in a ripple tank as shown in the Diagram 2.2 below.
[2 marks]
DIAGRAM 2.2
3. Diagram 3 shows a boy extending the elastic rubber of a catapult.
DIAGRAM 3 (a) State the change of energy when the stone is released from the catapult. __________________________________________________________________________ [1 mark]
(b) What happens to the distance of movement of the stone when a bigger mass of stone is used? __________________________________________________________________________ [1 mark] (c) The mass of the stone used is 0.02 kg. When the elastic rubber is extended 0.2 m by a force of 10 N, (i) Calculate the stored potential energy in the elastic rubber?
[2 marks]
(ii) What is the velocity of the stone?
[2 mark]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
81 SOALAN ULANGKAJI SPM 2013
4. Diagram 4 shows an arrangement of apparatus used to determine the atmospheric pressure in a laboratory. The length of the glass tube is 100 cm and the atmospheric pressure is 75 cm Hg.
DIAGRAM 4
(a) Name the apparatus shown in the diagram. __________________________________________________________________________ [1 mark]
(b) What is the space P? __________________________________________________________________________ [1 mark]
(c) What is the value of h?
[1 mark]
(d) Determine the pressure in unit cm Hg at points J and K
[2 marks]
(e) Given that the density of water and mercury is 1000 kg m-3 and 13 600 kg m-3 respectively. If the mercury in the apparatus is replaced by water, determine the height of water column in the glass tube.
[2 marks]
5. Diagram 5.1 shows an airplane maintaining a steady and level flight under the influence of four forces. Diagram 5.2 shows an load hanging from the middle of the string. T1 and T2 are tensions of the string and W is the weight of the load. The dotted line shows the resolved component of the tensions T1 and T2.
DIAGRAM 5.1 DIAGRAM 5.2
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
82 SOALAN ULANGKAJI SPM 2013
(a) What is meant by weight? __________________________________________________________________________ [1 mark] (b) Based on Diagram 5.1 and Diagram 5.2, (i) compare the forces acting on the airplane vertically : ____________________________________________________________ horizontally : ____________________________________________________________ [2 marks]
(ii) compare the forces acting on the load. vertically : ______________________________________________________ horizontally : ______________________________________________________ [2 marks]
(c) Compare the type of motion of the airplane and the object __________________________________________________________________________ [1 mark]
(d) Based on your answer in 5(b) and 5(c), relate the type of motion with the resultant forces acting on the aeroplane or on the load. __________________________________________________________________________ [1 mark] (e) Name the phenomenon shown in Diagram 5.1 and Diagram 5.2. __________________________________________________________________________ [1 mark ]
6. Diagram 6 (a) shows three resistors P, Q and S, each having resistance of 20 Ω, connecting to 6 V d.c power supply.
DIAGRAM 6 (a)
(a) What is the meaning of resistance? __________________________________________________________________________ [1 mark]
(b) Calculate the effective resistance of (i) the combination of Q and S, and
[1 mark] (ii) the whole circuit.
[1 mark]
(c) Calculate the current flowing through resistor S
[2 marks] (d) Calculate the energy released by S in 1 minute.
[2 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
83 SOALAN ULANGKAJI SPM 2013
(e) Diagram 6 (b) shows an electric kettle connected to a 240V power supply by a flexible cable.
DIAGRAM 6 (a)
(i) State one precautionary measure that should be taken to ensure safe usage of the kettle. ___________________________________________________________________ [1 mark]
(ii) Mention one fault that might happen in the cable that will cause the fuse in the plug to melt. ___________________________________________________________________ [1 mark]
7. Diagram 7 (a) shows a smoke detector contains a radioactive source which is a α-particles emitter.
DIAGRAM 7 (b)
(a) The ammeter shows bigger reading when there is no smoke in between the electrodes compared to when there is smoke.
(i) State the nature of α-particles. ___________________________________________________________________ [1 mark]
(ii) Explain the presence of electric current flowing in the circuit. ___________________________________________________________________ [1 mark]
(iii) Explain why β-particles emitters are not used in this detector. ___________________________________________________________________ [1 mark]
(iv) Americium-241 is an α-particle emitter and is represented by the symbol
It decays into Neptunium 237. The symbol for neptunium is Np. Write down the equation that represents the decay of Americium-241.
[2 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
84 SOALAN ULANGKAJI SPM 2013
(b) Diagram 7 (b) shows the penetrating powers of three radioactive radiations X, Y and Z.
DIAGRAM 7 (b)
(i) Arrange, in increasing order, the penetrating powers of these radiations. ___________________________________________________________________ [1 mark]
(ii) In diagram (b) i. below, draw the path taken by these radiations when they travel into an area where the direction of the magnetic field is directed into the paper.
DIAGRAM (b) i [2 marks]
(iii) What happen to the proton number and the nucleon number if a radioactive nuclide were to emit radiation X? ___________________________________________________________________ [1 mark]
(iv) Among the three radiations, state two properties of radiation Z. ___________________________________________________________________ [1 mark]
8. Diagram 8 shows object O with 1 cm height placed on the left side of convex lens P. The focal length of the convex lens is 5 cm.
DIAGRAM 8
(a) In Diagram 8, draw the ray path from the object to form an image. [2 marks]
(b) State the characteristics of the image formed. __________________________________________________________________________ __________________________________________________________________________ [2 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
85 SOALAN ULANGKAJI SPM 2013
(c) If the object is placed at a distance of 10 cm from the lens, calculate
(i) the image distance
[2 marks]
(ii) the linear magnification
[1 mark]
(d) You are given convex lens Q with +10 D power. You are required to create a simple astronomical telescope using the convex lenses P and Q. State what lens is suitable to be the objective lens and eyepiece.
objective lens : _________________________________________________ [1 mark] eyepiece : _________________________________________________ [1 mark]
(e) Draw the arrangement of the lenses and sketch the ray path from a distance object using convex lens P and Q to form a simple astronomical telescope.
[2 marks]
Section B[20 marks]
Answer any one question from this section.
9. A slide projector is used to view an image from a slide. The power of the lens used by the projector slide is + 5D. (a) What is meant by power of lens? [1 mark]
(b) A student used a slide projector to view the image from the slide. When the slide is place nearer to the lens the sharp image form on the screen as shown in Diagram 9.1. When the slide is place further from the lens the sharp image form on the screen as shown in Diagram 9.2.
DIAGRAM 9.1 DIAGRAM 9.2
Based on Diagram 9.1 and Diagram 9.2, compare the object distance, the image distance and size of image that formed on the screen. Relate the object distance to the image distance and the object distance to the size of image that formed on the screen.
[5 marks]
Image
Screen
Lens
SlideImage
Screen
Lens
Slide
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
86 SOALAN ULANGKAJI SPM 2013
DIAGRAM 9.4 (c) While driving a car on a hot day, you may see a mirage on the road. Explain how mirage occurred. [4 marks]
(d) Diagram 9.5 shows a simple astronomical telescope.
DIAGRAM 9.5
By using two prisms and a telescope in Diagram 9.5, suggest modification that can be done to make a binocular. In your explanation, (i) draw the arrangement of the prisms and lenses (ii) draw ray diagram to explain how the image form (iii) state two advantages using binocular compared to telescope when observing far object on the ground. [10 marks]
10. (a) Diagram 10.1 shows water waves moving towards the shore.
DIAGRAM 10.1
i. Name the wave phenomena in Diagram 10.1. [1 mark]
ii. What happens to the waves as it approaches the headland? Give reasons. [3 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
87 SOALAN ULANGKAJI SPM 2013
(b) Situation 1
Diagram 10.2
Situation 2
DIAGRAM 10.3
Situation 1 A student can hear the sound from the stopwatch at its loudest when cardboard tube B is at the position shown in Diagram 10.2.
Situation 2 Diagram 10.3 shows a man fishing. Eye A can see the man’s image on the water’s surface.
i. Name the types of waves in Situation 1 and Situation 2. [2 marks]
ii. Based on Diagrams 10.2 and 10.3, compare the directions of wave propagation. [1 mark]
iii. Based on Diagrams 10.2 and 10.3, compare the angles of wave propagation and the normal. [1 mark] iv. Based on Diagrams 10.2 and 10.3, relate the angles before and after the wave phenomena. [1 mark]
v. State the wave phenomena for Situation 1 and Situation 2. [1 mark]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
88 SOALAN ULANGKAJI SPM 2013
(c) To attract more tourist to the island in Diagram 10.4 , a contractor wants to build a beach resort .As a consultant you are asked to give suggestions on the proposed project based on the following aspects: i. The location of the resort ii. Features to reduce the erosion of the shore iii. Features to enable children to enjoy swimming in calm water.
DIAGRAM 10.4 [10 marks]
Section C[20 marks]
Answer any one question from this section.
11. (a) Archimedes’ principle states that:
“Anobjectthatistotallyorpartiallysubmergedinfluidexperiencesabuoyantforceequaltotheweightoffluiddisplaced”
(i) What is meant by buoyant force? [1 mark]
(ii) Diagram 11.1 shows a block is submerged in a liquid.
Diagram 11.1
Using the idea of difference in pressure P1 and P2 for different depth, h1 and h2 , show that the buoyant force is equal to the weight of liquid displaced. [4 marks]
Keys:
h1 : depth of upper surface
h2 : depth of bottom surface
liquid surface
A
P1
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
89 SOALAN ULANGKAJI SPM 2013
(b) Table 11.2 shows four hot air balloons, P, Q, R and S, with different specifications.
TABLE 11.2
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
90 SOALAN ULANGKAJI SPM 2013
You are required to determine the most suitable balloon which can be used for safe recreation. Study the specifications of all the four balloons from the following aspects:
- the balloon envelope - the size of the balloon - the number of burner used - the type of basket used to carry the passenger.
Explain the suitability of the aspects.
Justify your choice. [10 marks]
(c) A hot air balloon is adhered to the ground. The balloon contains 1200 m3 of hot air of density 0.8 kg m-3. The mass of the balloon (not including the hot air) is 400 kg . The density of the surrounding air is 1.3 kg m-3.
Calculate
i. the total weight of the balloon and the hot air. [2 marks] ii. the buoyant force exerted on the balloon. [1 mark] iii. the net force exerted on the balloon when it is released? [2 marks]
12. Fuses are used to prevent damage of electrical appliances due to current surges. (a) Diagram 12.1 shows a typical circuit on a household electrical appliance that has not been earthed.
DIAGRAM 12.1
i. What are the properties of a fuse wire? [1 mark]
ii. How does a fuse wire work to prevent damage to the electrical coil due to overheating? [3 marks]
iii. Why is it unwise to connect the fuse to the neutral wire? [1 mark]
iv. Some electrical appliances have an outer chasis made of metal. What modification has to be done to prevent electric shock when the coil is damaged and the live wire touches the metal chasis? [1 mark]
(b) Fuse takes some time to melt or blow. A fast-blowing fuse is required to protect semiconductor equipments which cannot stand high current surge for too long. When a fuse blows, sparking may occur which produces high temperature. The fuse wire is placed in a sheath or catridge as shown in diagram 12.2 to prevent it’s sparks from causing damage.
DIAGRAM 12.2
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
91 SOALAN ULANGKAJI SPM 2013
Table 12.1 shows the specifications of five fuses that can be used to protect a semiconductor device.
Determine the most suitable fuse to protect a 240 V, 2400 W semiconductor device. Study the specifications of all five fuses based on the following aspects.
- The thickness of wire. - The catridge type. - The rating of the fuse. - The melting point.
Explain the suitability of the aspects and justify your choice. [10 marks] (c) Diagram 12.3 shows two bulbs connected in series. Diagram 12.4 shows the same bulbs connected in parallel. Assuming the battery has no internal resistance, calculate the power output of bulb A and B in both the circuits.
[4 marks]
DIAGRAM 12.3 DIAGRAM 12.4
EnDOFQUESTIOnSPAPER
TABLE 12.1
ω ω
ω
ω
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
92 SOALAN ULANGKAJI SPM 2013
Physics Paper3 [4531/3]
Section A [28 marks]
Answer all questions
1 A student carries out an experiment to investigate how the temperature of water increases with the time of heating. Diagram 1.1 shows the set up of the apparatus for the investigation. Before the heater is switched on, the initial temperature, θ0, of the water is measured. Diagram 1.2 shows meniscus of the mercury column in the thermometer.
Diagram 1.2
DIAGRAM 1.1
A stopwatch and the heater are switched on simultaneously. At time, t = 20 s, the temperature, θ, of the water is read on the thermometer. Diagram 1.3 shows the meniscus of the mercury column in the thermometer.
The procedure is repeated for heating time, t = 40 s, 60 s, 80 s, and 100 s. The positions of the meniscus of the mercury column in the thermometer are shown in Diagrams 1.4, 1.5, 1.6 and 1.7.
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
93 SOALAN ULANGKAJI SPM 2013
(a) For the experiment described above, identify: (i) the manipulated variable ________________________________________________________________ [1 mark]
(ii) the responding variable ________________________________________________________________ [1 mark]
(iii) a constant variable ________________________________________________________________ [1 mark]
(b) Based on Diagram 1.2, determine the initial temperature, θ0, of the water. Initial temperature, θ0 = ______________________ [1 mark] (c) Based on Diagrams 1.3, 1.4, 1.5, 1.6 and 1.7,
(i) Record the thermometer readings, θ, in the spaces provided on page 3. [1 mark]
(ii) Calculate the values of Δθ for each heating time using the formula Δθ = θ - θ0. Tabulate your results for θ and Δθ for all values of t in the space below.
[5 marks]
(d) On the graph paper on page 94, plot a graph of Δθ against t. [5 marks]
(e) Based on your graph, state the relationship between Δθ and t. _______________________________________________________________________ [1 mark]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
94 SOALAN ULANGKAJI SPM 2013
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
95 SOALAN ULANGKAJI SPM 2013
2 A student carries out an experiment to study the interference of sound waves. He wants to investigate the relationship of the distance between two coherent sources of sound waves, a, and the distance between two consecutives of constructive interference, x. The distance between the location where the sound is detected, D, is 5 m. The results of the experiment is shown in the graph of x against as in Diagram 2.1.
(a) Based on the graph in diagram 2.1.
(i) State the relationship between x and a. ________________________________________________________________ [1 mark]
(ii) Determine the value of x if a = 4 m. Show on the graph, how you determined the value of x.
[3 marks]
(b) The wavelength of sound waves, λ, is given by the equation
(i) Calculate the gradient of the graph x against . Show on the graph how you determine the gradient.
[3 marks]
(ii) By using equation λ = and the value of the gradient obtained in b (i), calculate the wavelength of sound waves, λ, used in this experiment.
[3 marks]
(c) State two precaution steps that should be taken to improve the results of this experiment. _______________________________________________________________________
_______________________________________________________________________ _______________________________________________________________________
_______________________________________________________________________ [ 2 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
96 SOALAN ULANGKAJI SPM 2013
DIAGRAM 2.1
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
97 SOALAN ULANGKAJI SPM 2013
Section B [12 marks]
Answer any one question from this section
3. Diagram 3(a) shows Bobby riding on his motorcycle with an acceleration. Diagram 4(b) shows Sam riding pillion on Bobby’s motor and the acceleration is noticeably reduced.
DIAGRAM 4(A) DIAGRAM 4(B)
Based on the information and observations above:
(a) State one suitable inference. [1 mark]
(b) State one suitable hypothesis. [1 mark]
(c) Using apparatus such as a ticker timer, a.c power supply and other appropriate apparatus, describe an experiment ramework to investigate the hypothesis stated in part (b).
In your description, state clearly
(i) Aim of the experiment.
(ii) Variables in the experiment.
(iii) List of apparatus and materials.
(iv) Arrangement of the apparatus
(v) The procedure of the experiment which include the method of controlling the manipulated variable and the method of measuring the responding variable.
(vi) The way you would tabulate the data.
(vii) The way you would analyse the data. [10 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
98 SOALAN ULANGKAJI SPM 2013
4. Water is dripped at a constant rate into two different containers as shown in Diagram 4. The cross-section of the water waves formed from the droplets in the containers are shown in diagrams below.
DIAGRAM 4 Based on the information and observation above: (a) State one suitable inference. [1 mark]
(b) State one suitable hypothesis. [1 mark]
(c) With the use of apparatus such as a ripple tank , a vibrator motor and other apparatus, describe an experiment framework to investigate the hypothesis stated in 4 (b).
In your description, state clearly the following; (i) Aim of the experiment.
(ii) Variables in the experiment.
(iii) List of apparatus and materials.
(iv) Arrangement of the apparatus.
(v) The procedures of the experiment include the method of controlling the manipulated variable and the method of measuring the responding variable.
(vi) The way you would tabulate the data.
(vii) The way you would analyse the data. [10 marks]
EnDOFQUESTIOnSPAPER
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
99 SOALAN ULANGKAJI SPM 2013
ChemistryAnalysis
[4541/1][4541/2][4541/3]
Paper 1 Paper 2 Paper3Section A Section B Section C08 09 10 11 12 08 09 10 11 12 08 09 10 11 12 08 09 10 11 12 08 09 10 11 12
1. Introduction to chemistry - - - - - - - - - - - - - - - - - - - - - - - - -
2. The structure of atom 6 10 6 4 6 1/2 1/2 1 1 1/3 - - - - - - - - - - - - - - -
3. Chemical formulae and equation 4 7 4 7 7 1/2 - - - 1
1/3 - 1/2 - - - - - - - - - - - - -
4. Periodic table of elements 4 3 5 4 2 1 1 1 1 1 - - - - - - - - - - 1 - 1 - -
5. Chemical bond 4 3 3 5 3 - 1/2 1 - 1/3 - - - - - 16. Electrochemistry 4 6 5 5 5 - - 1 1 1 1 - - - - - 1 1 - 1 - 1 - - -7. Acids and bases 4 3 4 4 3 - - 1 1 - - 1 - - - 1 1 - - - - 1 1 - 18. Salts 2 2 3 2 1 - - 1 - - - - - - 1 - - - - - - - - 1 -
9.Manufactured substances in industry
4 2 4 3 1 1 1 - - - - - - 1 - - - - - - - - - - -
10. Rate of reaction 2 2 3 3 4 1 1 - 1 - - - 1 - - - - - - 1 - 1 1 1 -
11. Carbon compound 3 5 4 4 6 1 1 - - 1 - 1/2 1/2 - - - - - 1 - 1 - - - -
12.Oxidation and reduction 6 3 2 3 6 - - - 1 - - - - - - 1 - - - - - - - - -
13. Thermochemistry 3 2 4 4 4 1 1 - - - - - - - 1 - - 1 - - - - - - 1
14.Chemical for consumer 4 1 3 2 2 - - - - 1 1 - 1/2 1 - - - - - - - - - - -
TOTAL 50 50 50 50 50 6 6 6 6 6 2 2 2 2 2 2 2 2 2 2 2 3 3 2 2
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
100 SOALAN ULANGKAJI SPM 2013
Chemistry Paper 1 [4541/1]
1. Which substance is an ionic compound? A Magnesium, Mg C Magnesium dioxide, MgO B Carbon dioxide, CO2 D Tetrachloromethane, CCl
2. What is the meaning of molecular formula? A Formula that shows the type of element in the compound B Formula that shows how the atoms of elements are bonded
together C Formula that shows the simplest ratio of atoms of each
element in the compound D Formula that shows the actual number of atoms of each
element in the compound
3. The diagram shows the arrangement of particles in a substance in room temperature.
This arrangement of particles can be found in A Zinc C Helium B Oxygen D Sodium chloride
4. Table below shows the number of neutrons for chlorine isotopes.
What is the value of X? A 17 C 19 B 18 D 20
5. Element Y has the same chemical property as the element with the electron number of 19. The letter of Y is not the actual symbol of the element.
Which of the following is the electron arrangement for an atom of element Y?
A 1 C 2.8.2 B 2.1 D 2.8.8.2
6. In the periodic table, J is below K in the same group. If the proton number of atom K is 12, what is the electron configuration for ion J?
A 2 C 2.8.2 B 2.8.8 D 2.8.8.2
Each question is followed by either three, four or five options. Choose the best option for each question and then blacken the correct space on the answer sheet.
7. Diagram below shows the inter-conversion of the state of matter of a substance
Which inter-conversion involves the absorb of energy? A water ice C steam water B ice steam D steam ice
8. The chemical formula for sodium thiosulphate is Na2S2O3. What is its relative formula mass?
[Relative atomic mass : Na = 23, S = 32, O = 16] A 39 C 142 B 71 D 158
9. Calcium carbonate, CaCO3 is the main component of marble. What is the number of particles in 0.5 mol of calcium carbonate? [Avogadro constant = 6.02 x 1023 mol-1]
A 3.01 X 1022 C 3.01 X 1023
B 6.02 X 1022 D 3.01 X 1023
10. Which of the following gases contains 0.2 mol of atoms at room temperature and pressure?
[1 mol of gas occupies the volume of 24 dm3 at room temperature and pressure]
A 4.8 dm3 He C 4.8 dm3 SO3 B 4.8 dm3 H2 D 4.8 dm3 CO2
11. Table below the melting point and boiling point of substance P, Q, R, and S.
Which substance is a solid at room temperature? A P C R B Q D S
12. The diagram shows the molecular formula for glucose.
Which of the following is its empirical formula? A CH2O C C2H2O2 B CH2O2 D C2H4O2
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
101 SOALAN ULANGKAJI SPM 2013
13. The following chemical equation shows the reaction between
Which of the following statements is correct? A 2 mol of magnesium atoms react with 1 mol of oxygen atom. B 2 mol of magnesium atoms react with 2 mol of oxygen gas. C 2 mol of magnesium atoms react with 1 mol of oxygen atom
producing 2 mol of magnesium oxide molecules. D 2 mol of magnesium atoms react with 1 mol of oxygen
molecules producing 2 mol of magnesium oxide molecules.
14. The diagram shows the electron arrangement of atom Q.
Where is element Q placed in the Periodic Table of Element?
15. Diagram below shows the electron arrangement of atom R and S.
Which of the following is true about R and S? A Element R is more reactive than element S. B Both elements R and S react with bromine gas. C Both elements R and S are monoatomic gas. D Element R reacts with element S to perform a compound
with formula RS.
16. What are the anions present in aluminium nitrate solution? A OH-, NO3- C Al3+, NO3- B H+, Al3+ D Al3+, H+, OH-, NO3-
17. Substance X form white precipitate when added sodium hydroxide and ammonia solution until excess. It is insoluble in both excess sodium hydroxide solution and ammonia solution.
What is X? A Magnesium sulphate C Aluminium sulphate B Zinc sulphate D Lead (II) nitrate
18. Which statement explains why the size of Potassium atom is bigger than Lithium atom in the Periodic Table?
A The number of protons in Potassium atom is greater than Lithium atom.
B The relative atomic mass of potassium atom is greater than Lithium atom.
C The number of valence electrons is same. D The number of shells filled with electrons for potassium is
greater than lithium.
19. Elements X and Y dissolve in water to form acidic solutions which are also bleaching agents.
What is element X and Y? I. Chlorine III. Iodine II. Bromine IV. Astatine
A I and II C II and IV B I and III D III and IV
20. The table below shows the electron arrangement for elements W, X, Y and Z.
The letters used are not the actual symbol of the elements.
Which of the following is an element that able to form an amphoteric oxide?
A W C Y B X D Z
21. The diagram shows the electrolysis of molten lead (II) bromide using carbon electrodes.
Which half equation shows the reaction at the anode?
A C B D
22. The following elements located in Period 4 of the Periodic Table of Elements.
• Chromium,Cr • Manganese,Mn • Iron,Fe • Cobalt,Co • Nickle,Ni • Copper,Cu
Which of the following is true about the elements? A They have a low melting point. B They do not able to conduct electricity. C They are able to conduct heat. D They are able to show same oxidation numbers in their
compounds.
x x x x
x
x
Q
x
xx
xx
x
x x x xxx
x
xx
xx
x
x x x xxx x xxx R S
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
102 SOALAN ULANGKAJI SPM 2013
23. Diagram below shows the positions of elements P, Q, R, S and T in the Periodic Table. P, Q, R, S and T are not the actual symbol of the elements
Which of the following pairs of elements react to form an ionic compound?
I. S, P III. R, T II. R, P IV. Q, T
A I and II C II and IV B I and III D III and IV
24. Table below shows the proton number of elements E, F, G, and H.
Based on table above, which two elements that form a compound with a high melting and a high boiling point?
I. E, F III. F, H II. E, G IV G, H
A I and II C II and IV B I and III D III only
25. Diagram below shows the set up of the apparatus to plate an iron key with silver.
After 30 minutes, it is found that no plating took place on the iron key.
What should be done to ensure electroplating takes place? A Use a bigger silver rod B Increase the cell voltage C Interchange the terminals in the cell D Rub the iron key with sand paper
26. Diagram below shows the setup of the apparatus to build a chemical cell.
Which of the following metal can be replaced the iron nail to obtain the highest voltage reading?
A Tin C Silver B Lead D Copper
27. Table below shows information about three chemical cells.
Which of the following is the correct descending order of these metals in the electrochemical series?
A U, T, S, R C R, U, T, S B R, T, U, S D S, T, U, R
28. Glacial ethanoic shows acidic properties when it is dissolved in water.
In which pairs of substances does a reaction occur? A Glacial ethanoic acid + pH paper B Glacial ethanoic acid + Magnesium ribbon C Glacial ethanoic acid + Calcium carbonate chips D Glacial ethanoic acid + Sodium carbonate solution
29. Which medicine can relieve a headache and paint in joint? A Aspirin C Streptomycin B Vinegar D Insulin
30. Sulphuric acid, H2SO4 has the concentration of 0.5 mol dm3. What is the volume of sodium hydroxide, NaOH, 1.0 mol dm3
that can neutralize 25.0 cm3 of sulphuric acid, H2SO4, solution? A 6.25 cm3 C 25.00 cm3
B 12.50 cm3 D 50.00 cm3
31. A student is stung by an ant which contains acidic sting. Which of the following substances is the most suitable to be
applied to the part stung to treat the student? A Magnesium hydroxide C Cooking oil B Vinegar D Sodium chloride
32. Diagram below shows the double decomposition reaction between solution X and solution Y.
Which equation represents reactions to form a precipitate. I. AgNO3 + NaCl AgCl + NaNO3 II. ZnCl2 + Na2SO4 ZnSO4 + 2 NaCl III. CuSO4 + Na2CO3 CuCO3 + Na2SO4 IV. CuSO4 + Mg(NO3) Cu(CO3)2 + MgSO4
A I and II C II and IV B I and III D III and IV
33. The diagram shows a polymerization process.
Which of the following properties is identical for substance P and Q?
A Density C Melting point B Percentage composition D Relative molecular mass
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
103 SOALAN ULANGKAJI SPM 2013
34. Why is ceramic used for the wall of object that has higher temperature?
A Ceramic is very hard B Ceramic is malleable C Ceramic is inert towards chemicals D Ceramic is very high melting point
35. The reaction between calcium carbonate and hydrochloric acid produces carbon dioxide gas. The reaction is complete in 50 seconds and the maximum volume of gas produce is 25 cm3.
What is the average rate of the reaction? A 0.5 cm s-1 C 2.0 cm s-1
B 1.0 cm s-1 D 4.0 cm s-1
36. Zinc reacts with acid to produce hydrogen gas, H2. Which solution would give the highest initial rate of reaction?
A 100 cm3 of 1.0 mol dm-3 of nitric acid, HNO3 B 100 cm3 of 1.0 mol dm-3 of hydrochloric acid, HCl C 100 cm3 of 1.0 mol dm-3 of sulphuric acid, H2SO4 D 100 cm3 of 1.0 mol dm-3 of ethanoic acid, CH3COOH
37. Experiment I and Experiment II are carried out as follows:
Which graphs of volume of carbon dioxide collected against time in both sets is correct?
38. Which of the following statements correctly related to the collision theory affected by rise in temperature on the reactant particles?
I. The total surface area of the reactant particles increases II. The kinetic energy of the reactant particles increases III. The frequency of the collision between the reactant particles
increases IV. The number of the reactant particles per one unit volume
increases
A I and II only C III and IV only B II and III only D I and IV only
39. Oils can be converted to fat by process Q. Which of the following is process Q? A hydrogenation C hydration B Halogenation D dehydration
40. The equation shows the chemical change that occurs to compound F.
Which of the following is the compound F? A n – butane C But – 2 – ene B Prop – 1 – ene D Butan – 2 – ol
41. The diagram below shows the molecular formula of pent – 1 – ene.
Which of the following are correct names for isomers of pent -1 – ene?
I. pent – 2 – ene III. pent – 3 – ene II. 3 – methylbut – 1 – ene IV. 2 – methylbut – 2 – ene
A I and IV only C I, II, and IV only B II and III only D I, II, III, and IV
42. Natural rubber has to be treated first before it can be used to make car tire.
What is the name of the process? A Hydrolysis C Vulcanization B Esterification D Polymerisation
43. Methods below are used to stop iron from rusting.
Which metal is most often used to protect iron in water pipelines, roofing sheet, and in food containers?
44. A metal W lies between magnesium and iron in the reactivity series.
Which reaction is W most likely to undergo? A It liberates hydrogen from dilute hydrochloric acid B It reduces magnesium oxide to magnesium on heating C Its forms a hydroxide which dissolves in water D Its oxide decomposes to give the metal on heating
45. Which statement is correct for all exothermic reactions? A The reactants gain energy from the surrounding. B The reactants of the reaction have more energy than the
products. C The temperature of the reaction decreases. D The symbol for heat of reaction is ΔH = + kJmol-1
• Coatingwithzinc• Coatingwithtin• Connectingtomagnesiumrod
+
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
104 SOALAN ULANGKAJI SPM 2013
46. The reaction between 25 cm3 of 0.5 mol dm-3 copper (II) sulphate solution, CuSO4 and excess zinc releases 2625 J of heat. What is the temperature change of the mixture?
[Specific heat capacity of solution = 4.2 J g-1 OC-1. Assume that 1cm3 of a solution is equal to 1g of the solution]
A 100C C 200C B 150C D 250C
47. Table below shows the heat of combustion of methanol, ethanol, and butanol.
What is the approximate value for the heat of combustion of propanol?
A 1050 kJmol-1 C 3310 kJmol-1
B 2020 kJmol-1 D 3970 kJmol-1
48. Why are soaps less effective than detergents? A Soaps decrease the wetting ability of water whereas
detergents increase the wetting ability of water. B Soaps are biodegradable substances whereas detergents are
non-biodegradable substances C Soaps form scum in hard water whereas detergents do not
form scum in hard water. D Soaps are cheap to make whereas detergents are expensive to
manufacture.
49. Diagram below shows the experiment to determine the heat of neutralization.
Which experiment gives the highest rise in temperature?
50. The diagram below shows the energy diagram for the precipitation of silver chloride.
Which of the following is true about the diagram? I. The reaction is exothermic. II. The heat of reaction is 60.5 kJ mol-1. III. The temperature increases during the reaction. IV. The energy content of the product is higher than the
reactants.
A I and II only C I, II, and III only B I and III only D I, II, III, IV
EnDOFQUESTIOnSPAPER
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
105 SOALAN ULANGKAJI SPM 2013
Chemistry Paper 2 [4541/2]
SECTION A[60 marks]
Answer All Questions
1. Table 1 shows the proton number and nucleon number of four atoms T, U, V, and W.
Table 1
Based on Table 1:
(a) (i) Write the arrangement of V atom. _____________________________________________________________________ [1 mark]
(ii) How many valence electrons does an atom of U have? _____________________________________________________________________ [1 mark]
(iii) State the number of shells does an atom of T have. _____________________________________________________________________ [1 mark]
(iv) Draw the electron arrangement of atom U.
_____________________________________________________________________ [2 marks]
(b) Atom T reacts with oxygen to form a covalent compound. (i) State two physical properties of covalent compound. _____________________________________________________________________ _____________________________________________________________________ [2 marks]
(ii) Write the chemical formula of covalent compound formed.
[1 mark] (iii) Complete the realationship below.
Nucleon number = proton number + [1 mark]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
106 SOALAN ULANGKAJI SPM 2013
2. The diagram below represents a reaction between hydrogen and oxygen to produce water.
(a) (i) Name the type of particle present in water, H2O. _____________________________________________________________________ [1 mark]
(ii) Calculate the relative molecular mass of water. [Relative atomic mass: H = 1; O = 16]
_____________________________________________________________________ [1 mark]
(b) 20g of hydrogen are reacting completely with excess oxygen to form water.
(i) Write a balanced chemical equation for the reaction. _____________________________________________________________________ [2 marks]
(ii) Calculate the numbers of moles are the in 20g of hydrogen.
_____________________________________________________________________ [2 marks]
(c) (i) Presence of water can showing the properties of acid. State the role of water in showing the properties of acid. _____________________________________________________________________ [1 mark]
(ii) Ethanoic acid, CH3COOH dissolved in propanone, CH3COCH, has no effect on blue litmus paper. Explain this observation. _____________________________________________________________________ _____________________________________________________________________ [2 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
107 SOALAN ULANGKAJI SPM 2013
3. E, F, G, H, J, K, and L are the symbols used to represent elements. They form compounds in which they exist as ions with the following formulae in the Table 3
Table 3
Based on Table 3: (a) State the Group of element F in the Periodic Table. ___________________________________________________________________________ [1 mark]
(b) Which element is a noble gas? Explain your answer. ___________________________________________________________________________ ___________________________________________________________________________ [2 marks]
(c) (i) State the elements is most likely to form coloured compound and gives a reason for your answer. _____________________________________________________________________ _____________________________________________________________________ [2 marks]
(ii) Write the formulae of the two oxides this element is likely to for _____________________________________________________________________ [2 marks]
(d) (i) Which element forms an amphoteric oxide?
_____________________________________________________________________ [1 mark]
(ii) Write the equation for the reaction of this Oxide with hydrochloric acid. _____________________________________________________________________ [2 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
108 SOALAN ULANGKAJI SPM 2013
4. Hydrogen sulphide is a compound of hydrogen and sulphur. Sulphur is an element found in Group 16 of the Periodic Table.
(a) What is a compound? ___________________________________________________________________________ [1 mark]
(b) Name two types of chemical bonds.
___________________________________________________________________________ [1 mark]
(c) (i) What type of bond is formed between the hydrogen and sulphur atom? _____________________________________________________________________ [1 mark]
(ii) Draw the electron arrangement of the bond formed between hydrogen and sulphur atom.
_____________________________________________________________________ [2 marks]
(d) (i) Hydrogen sulphide has the melting point of – 850C and a boiling point of – 610C. Write the physical state of hydrogen sulphide at 280C. _____________________________________________________________________ [1 mark]
(ii) Draw the arrangement of particles in the substance in d (i).
_____________________________________________________________________ [1 mark]
(e) Hydrogen sulphide has the smell of rotten eggs but sodium sulphide has no smell. Explain why sodium sulphide has no smell? ___________________________________________________________________________ ___________________________________________________________________________ [2 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
109 SOALAN ULANGKAJI SPM 2013
5. The diagram below shows the reaction between magnesium with sulphuric acid.
Diagram 5
(a) (i) Write the balance chemical equation for the reaction. _____________________________________________________________________ [1 mark]
(ii) Write an ionic equation for this reaction. _____________________________________________________________________ [2 marks]
(b) In this reaction, which substance is (i) oxidised? = __________________________________ (ii) reduced? = __________________________________ (iii) oxidizing agent? = __________________________________ (iv) reducing agent? = __________________________________ [4 marks]
(c) Magnesium also can react with copper (II) sulphate, CuSO4 solution. The chemical equation as follows:
(i) Write half-equations showing what happen to the reactants. _____________________________________________________________________ _____________________________________________________________________ [2 marks]
(ii) Explain why this is a redox reaction. _____________________________________________________________________ _____________________________________________________________________ [2 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
110 SOALAN ULANGKAJI SPM 2013
6. A student carried out an experiment to determine the heat of precipitation for the reaction between lead (II) nitrate, Pb(NO3), solution and sodium sulphate, Na2SO4 solution. In this experiment, 50 cm3 of 2.0 mol dm-3 lead (II) nitrate solution was added to 50 cm3 of 2.0 mol dm-3 sodium sulphate solution. The result are given below:
Diagram 6
(a) State the meaning heat of precipitation. ___________________________________________________________________________ [1 mark]
(b) Why is a polystyrene cup used in the experiment? ___________________________________________________________________________ [2 marks]
(c) State the type of reaction that occurred in this experiment. ___________________________________________________________________________ [1 mark]
(d) (i) State the colour of the precipitate formed in this experiment. _____________________________________________________________________ [1 mark]
(ii) Give the reason for observation in (d) (i). _____________________________________________________________________ [1 mark]
(e) (i) Complete the ionic equation for the reaction that occurred.
_______________ [1 mark]
(ii) Calculate the heat change of the precipitation reaction between lead (II) nitrate and sodium sulphate. [Specific heat capacity of solution = 4.2 Jg-1 OC-1. Assume that 1 cm3 of a solution is equal to 1g of the solution]
_____________________________________________________________________ [2 marks]
(iii) Calculate the heat of precipitation for this experiment.
_____________________________________________________________________ [2 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
111 SOALAN ULANGKAJI SPM 2013
7 (a) The following are three examples of chloride salts that can be prepared in the laboratory • Silverchloride,AgCl • Lead(II)chloride,PbCl2 • Potassiumchloride,KCI
(i) From these examples , identify the soluble and insoluble salts
[2 marks]
(ii) State the reactants for the preparation of lead(II) chloride , PbCl2 [2 marks]
(b) With the aid of a labelled diagram , explain the preparation of soluble salts which are potassium chloride , KCI
[6 marks] (c) Table 7 shows the observations from some tests carried out from salt X
I.
II.
Table 7
Based on the information in table 7 : (i) Identify an anion that is present in Test I and describe a chemical test to verify the anion.
[4 marks]
(ii) Identify two cations that are present in Test II and describe a chemical test to verify the cations
[6 marks]
SECTION B[20 marks]
Answer any one Questions
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
112 SOALAN ULANGKAJI SPM 2013
8. (a) What is meant by the heat of neutralisation? [1 mark]
(b) Two experiments are carried out to compare the heat of neutralisation:
neutralisation
(i) Explain the difference of temperature changes between experiment I and experiment II. [4 marks]
(ii) Calculate the heat change in Experiment I and Experiment II. [Specific heat capacity of solution = 4.2 Jg-1 oC-1. Assume that 1 cm3 of a solution is equal to 1g of the solution] [4 marks]
(iii) Based on Experiment I and Experiment II, explain both experiment according to their: • Balancedequation • Numberofmolesofwater • Heatofneutralisation [11 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
113 SOALAN ULANGKAJI SPM 2013
SECTION C[20 marks]
Answer any one Questions
9. Diagram 9 shows the arrangement of particles of a compound in molten state and solid state.
Diagram 9
(a) The compound can conduct electricity in molten state but cannot do so in solid state. Name one example of a compound with this property. [1 mark]
(b) Write one of the two half equations for the electrolysis of the compound you named in 9(a). [3 marks]
(c) Draw a labeled diagram of the apparatus that u can use to electrolyse the compound you named in 9 (a). In your drawing show by using arrows the movement of particles that that occurs in the compound.
[10 marks]
(d) Describe the electrolysis process that occurs in 9 (a). [6 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
114 SOALAN ULANGKAJI SPM 2013
10. Table 10 shows the data from Experiment I and Experiment II that were carried out to study the rate of reaction of zinc with two acids, P and Q.
Table 10
(a) (i) By choosing either experiment I or Experiment II, state the name of the acid used. Write the chemical equation for the reaction of this acid with zinc.
[2 marks]
(ii) Draw an energy profile diagram for the reaction in 10 (a)(i). On the energy profile Diagram shows the:
• Heatofreaction,∆H • Activationenergywithoutacatalyst,Ea • Activationenergywithacatalyst,Ea
Explain the energy profile diagram.
[10 marks]
(b) Compare the rate of reaction between Experiment I and Experiment II. Explain the difference in the rate of reaction in the experiments accordingly to the collision theory.
[8 marks]
EnDOFQUESTIOnSPAPER
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
115 SOALAN ULANGKAJI SPM 2013
Chemistry Paper3 [4541/3]
[50 marks]Answer All Questions
1. Diagram 1.1 shows the apparatus set up for the experiment, using metal P and copper. Given that copper is placed at the positive terminal. The reading of the voltmeter is recorded as shown in Diagram 1.2.
The experiment is repeated using metal Q, R, and S (one at a time) and copper. Voltmeter readings are shown below.
Based on the Diagram 1.2, construct a table to record the reading of the voltages. [3 marks]
(b) Complete the Table 1 based on the experiment.
Table 1 [6 marks]
(c) State one hypothesis for the experiment. ____________________________________________________________________ [3 marks]
(d) Based on the observation shown in the above diagram, arrange metal P, Q, R, S, and copper in descending order of reactivity. ____________________________________________________________________ [3 marks]
(e) If another metal, T, which is a higher position then Q is used, predict the voltage which will be produced. ____________________________________________________________________ [3 marks]
RAJAH 1.1 / DIAGRAM 1.1
RAJAH 1.2 / DIAGRAM 1.2
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
116 SOALAN ULANGKAJI SPM 2013
2. Diagram 2.1 shows the set up of apparatus to study the reaction of metal oxides with carbon.
(a) Complete Diagram 2.1 by stating the observations for the reaction of metal oxides with carbon powder. [3 marks]
(b) State all the variables in this experiment: Manipulated variable: ___________________________ Responding variable : ___________________________ Controlled variable : ___________________________ [3 marks]
(c) State the inference that can be made for this experiment. _________________________________________________________ [3 marks]
(d) Based on the observations in Diagram 2.1, arrange metals M, Z, C, S and carbon in ascending order of reactivity.
[3 marks]
(e) The experiment is repeated by using the oxides of N with carbon powder. The result of the experiment is shown in
Diagram 2.2
How would you determine whether metal M or metal N is higher in the reactivity series? [3 marks]
Set-up of apparatus Observation on the mixture
Set-up of apparatus Observation on the mixture
Diagram 2.1
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
117 SOALAN ULANGKAJI SPM 2013
3. Diagram 3 shows the conversation between a teacher and her students.
Diagram 2
Based on the situation, plan a laboratory experiment to study the action of heat on nitrate salts. Your planning should include the following aspects:
(a) Problem statement
(b) All the variables
(c) Statement of the hypothesis
(d) List of materials and apparatus
(e) Procedure for the experiment
(f ) Tabulation of data
[17 marks]
EnDOFQUESTIOnSPAPER
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
118 SOALAN ULANGKAJI SPM 2013
BiologyAnalysis
[4551/1][4551/2][4551/3]
Chapter 2008 2009 2010 2011 2012P1 P 2 P 3 P 1 P 2 P 3 P1 P 2 P 3 P 1 P 2 P 3 P 1 P 2 P 3
O A B Q1 Q2 O A B Q1 Q2 O A B Q1 Q2 O A B Q1 Q2 O A B Q1 Q2
FORM4
1. Introduction to Biology
2. Cell Struc. and Cell Org. 2 1 2 0.5 4 1 4 1 4 1
3. Movement of Sbst acr Pl. Mbr 3 1 1 5 0.5 3 1 4 1 3 1
4. Chemical Comp. of the Cell 3 3 1 2 1 3 1 4
5. Cell Division 2 1 2 1 0.5 3 3 16. Nutrition 8 1 7 1 1 6 1 5 0.5 0.5 4 17. Respiration 3 6 1 5 1 3 0.5 4 18. Dynamic
Ecosystem 3 1 3 1 5 1 4 0.5 6 1
9. Endangered Ecosystem 3 1 4 2 1 3 1 3 1
No. of question for Form 4 27 2 3 1 1 32 2 2 1 1 28 3.5 2 1 1 29 3 2 1 0 31 4 2 1 0
FORM5
10. Transport 5 1 5 1 3 1 3 1 4 111. Locomotion and Support 5 1 1 1 1 5 1 4
12. Coordination and Response 4 1 5 4 1 4 1 3 1
13. Reproduction & Growth 5 1 5 1.5 8 3 1 2 1
14. Inheritance 2 1 1 1 3 5 0.5 3 115. Variation 2 1 0.5 3 0.5 1 0.5 3
No. of question for Form 5 23 3 1 0 0 18 3 2 0 0 22 1.5 2 0 0 21 2 2 0 1 19 1 2 0 1
TOTAL 50 5 4 1 1 50 5 4 1 1 50 5 4 1 1 50 5 4 1 1 50 5 4 1 1
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
119 SOALAN ULANGKAJI SPM 2013
Biology Paper 1 [4551/1]
1. Diagram 1 shows the structures of a cell in a Hydrilla sp.
Which of the structures on Diagram 1 are not found in a cheek cell?
A Q and R C R and S B Q and S D R and T
2. The following statements are about an organelle of a cell.
- Existfreelyinthecytoplasmorattached totheroughendoplasmicreticulum- Siteoftheproteinsynthesis.
What is the organelle? A Vacuole C Ribosome B Nucleus D Golgi body
3. Diagram 2 shows the structure of a cell organelle. Which cell does not possess this organelle?
Diagram 2
A Guard cell C Epidermal cell B Spongy mesophyll cell D Palisade mesophyll cell
4. Diagram 3 shows the appearance of a cell after being immersed in a particular solution.
Diagram 3
Which of the following is the cell undergoing? A Crenation C Haemolysis B Plasmolysis D Deplasmolysis
5. Which of the following onion cells were immersed in a hypotonic solution?
6. An experiment was conducted to determine the concentration of the cell sap of potatoes. The results obtained were plotted on a graph shown in Diagram 4.
Which point A, B, C or D, shows the concentration of the cell sap of the potatoes?
7. Diagram 5 shows the movement of molecule X across the plasma membrane through process Y.
Diagram 5
What is process Y? A Osmosis C Active transport B Simple diffusion D Facilitated diffusion
8. Diagram 6 shows the mechanism of an enzyme reaction.
What is M? A An enzyme C The substrate B The product D The enzyme-substrate
complex
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
120 SOALAN ULANGKAJI SPM 2013
9. Diagram 7 shows the phospholipid bilayer in a plasma membrane.
Diagram 7
Identify the hydrophobic and hydrophilic layers.
10. Diagram 8 shows the molecular structure of three classes of food.
Diagram 8
Which food classes do P, Q and R belong to?
11. Diagram 9 below shows a phase of mitosis taking place in the nucleus of an animal cell.
Diagram 9
What is the phase? A. Prophase C. Anaphase B. Metaphase D. Telophase
12. Which of the following diagrams is a stage in meiosis?
13. Diagram 10 shows part of the human digestive system.
Diagram 10
Which of the following menu is suitable for a patient whose organ P is dysfunctional?
A Fried fish and steamed rice B Steamed fish and steamed rice C Steamed chicken and fried rice D Fried chicken and steamed rice
14. The following data is the result of an experiment to determine the energy value of a cashew nut.
The specific heat capacity of water is 4.2 J g-1 °C-1 . Calculate the energy value of the cashew nut.
A 1680 J g-1 C 7560 J g-1
B 3360 J g-1 D 11 760 J g-1
15. The table below shows an experiment to determine the content of vitamin C in orange juice.
What is the concentration of vitamin C in orange juice? A 0.02 mg/cm3 C 0.5 mg/cm3
B 0.2 mg/cm3 D 5.0 mg/cm3
16. Diagram 11 shows the structure of a chloroplast seen under an
electron microscope.
Diagram 11
Which of the following processes occurs in P?
A Production of starch B Production of glucose C Reduction of carbon dioxide by hydrogen D Dissociation of water molecule by sunlight
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
121 SOALAN ULANGKAJI SPM 2013
17. Which of the following is true about the enzyme and its function?
18. The following information shows the results of an experiment to determine the oxygen and carbon dioxide content in inhaled air using J-tube.
The percentage of carbon dioxide content in the inhaled air is A 4.0 % B 14.0 % C 11.4 % D 21.0 %
19. Diagram 12 shows an experiment of yeast respiration.
Diagram 12
Which of the following mixtures can increase the rate of respiration of yeast?
A 1 g of yeast and 20 ml of 5% glucose solution B 1 g of yeast and 20 ml of 7% glucose solution C 1 g of yeast and 20 ml of 10% glucose solution D 1 g of yeast and 20 ml of 15% glucose solution
20. The following equation shows
Glucose +oxygen → carbon dioxide + water + ATP
A condensation of glucose C anaerobic respiration B hydrolysis of glucose D aerobic respiration
21. Diagram 13 shows a crab with barnacles on its shell.
Diagram 13
What is the interaction between the crab and the barnacles? A Parasitism C Saprophytism B Mutualism D Commensalism
22. The following information is about a habitat.
Which of the following is the most suitable method to use to estimate the population of Pleurococcus in the habitat?
A Quadrat of size 1 m ×1m C Quadrat of size 10cm × 10cm B Quadrat of size 5m × 5m D Line transect
23. The following information is related to a process occurring in an ecosystem.
The process is A colonisation C succession B competition D evolution
24. The table below shows the results of an experiment to study the population of garden snails in Muthu’s vegetable farm.
What is the approximate population of the snails in the farm? A 140 C 330 B 240 D 520
25. Which term refers to a group of organisms of the same species living in the same habitat?
A Niche C Community B Ecosystem D Population
26. The table below shows the result of an experiment to compare the qualities of water from areas, X and Y.
Which of the following statements explain the result of the experiment?
I Water sample from area X is more polluted than area Y II Water sample from area X has a lower BOD value than area Y III Water sample from area X has less microorganisms than area Y IV Water sample with a higher BOD value causes slow
decolourisation of methylene blue
A I and III only C II and IV only B II and III only D III and IV only
27. Which of the following organs is not part of the excretory system in the human body?
A B C D
Enzyme FunctionA Pepsin Emulsifies milkB Rennin Curdles milkC Trypsin Digests fatD Erepsin Hydrolyses fat
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
122 SOALAN ULANGKAJI SPM 2013
Diagram 20
28. Diagram 14 shows a cross section of the heart and its associated blood vessels.
Diagram 14
Which of the following A, B, C and D is the pulmonary vein?
29. Diagram 15 shows a cross section of a part of a dicotyledonous plant. Which labelled part functions to transport the products of photosynthesis?
Diagram 15
30. Diagram 16 shows a blood circulatory system. What type of the blood circulatory system is this?
Diagram 16
A Open circulatory system B Double circulatory system C Single, closed and complete circulatory system D Single, closed and incomplete circulatory system
31. The role of P is
A to absorbs fatty acid and glycerol. B to produce antibodies to destroy bacteria C to destroy red blood cells of more than 120 days D to ensures the flow of lymphatic fluids in one direction only
32. Diagram 17 shows a potometer used to study the effect of light intensity on the rate of transpiration of a plant.
Diagram 17
When the potometer is under the shade, the reading of the air bubble is at 4.5 cm after 10 minutes. If the experiment is repeated by putting the potometer in the sun, what is the expected reading of the air bubble after 10 minutes?
A 3.5 cm C 4.5 cm B 4.0 cm D 5.5 cm
33. P, Q, R and S in Diagram 18 are vertebrae found along the spine.
P Q R SDiagram 18
Which of the following shows the correct arrangement of the vertebrae in the spine?
A R, S, P, Q C Q, R, S, P B P, Q, R, S D S, P, R, Q
34. The plant in the diagram 19 is an aquatic plant. Which of the parts help the plant to float?
Diagram 19
35. Diagram 20 shows human elbow joint. Which of the parts labelled A, B, C and D is strong and inelastic?
Diagram 20
AB
C
D
AC
BD
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
123 SOALAN ULANGKAJI SPM 2013
41. Diagram 24 shows the female reproductive system?
Which of the parts labeled A, B, C or D is the place where fertilisation occurs?
42. Which of the following sequence is the development of the human zygote?
A Zygote → morula → blastocyst → embryo B Zygote → blastocyst → morula → embryo C Zygote → morula → foetus → embryo D Zygote → embryo → foetus → blastocyst
43. Which of the following is not true about the formation of identical twins and fraternal twins?
44. Which of the following sequences about the formation of sperm is true?
A Spermatogonium → spermatid → spermatocyte → sperm B Spermatocyte → spermatogonium → spermatid → sperm. C Spermatid → spermatocyte → spermatogonium → sperm D Spermatogonium → spermatocyte → spermatid → sperm.
45. Diagram 25 shows a cross section of a pistil of a flowering plant.
Diagram 25
Which of the structures labelled A, B, C or D, is a female gamete?
R
U
T
S
MitochondrionVesicleSynaptic bulb
Substance P
36. Diagram 21 shows the structure of the human fore-limb. What happened to the parts labelled R, S, T and U to enable the arm to be in the position as shown in the diagram?
Diagram 21
37. Diagram 22 shows a synapse at the nerve ending of a neuron. What is substance P?
Diagram 22 A Dopamine C Adrenaline B Oxytosin D Prolactin
38. Diagram 23 shows four coleoptiles, Q, R, S and T that are exposed to light from one direction. After three days, which coleoptile will move towards the right?
Diagram 23 A P only C Q and S B R only D Q, R and S
39. Which of the following hormones in the blood increases immediately after absorption of digested food by the villus?
A insulin C glucagons B estrogen D antidiuretic hormone
40. The growth hormone that is used to speed up the ripening of fruits for export is
A auxin C cytokinin B ethylene D giberellin
Identical twins Fraternal twins
AProduced from a single
a sperm cell which fertilised one ovum
Produced from two sperm cells which fertilised two different ovums
B Produce two different zygotes
Produce two similar zygotes
C Share the same placenta Have two separate placentas
D Produce two identical individuals
Produce two different individuals
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
124 SOALAN ULANGKAJI SPM 2013
46. Diagram 26 shows a pair of homologous chromosomes. T and t represent
Diagram 26
A alleles C phenotype B genotypes D linked genes
47. Diagram 27 shows the karyotype of an individual who suffers from a disability due to a genetic disease. The genetic disease suffered by the individual is
Diagram 27
A Haemophilia C Turner Syndrome B Down Syndrome D Klinefelter Syndrome
48. A normal couple gives birth to a Down Syndrome child. Which statement explains the situation?
A Chromosome number 21 is not separate. B Segregation of alleles are not complete. C Recombination of chromosomes does not occur D Fusion of gamete is not at random
49. Which of the following characteristics show continuous variation?
50. The following is information about two individuals, P and Q.
Which factor causes the differences in traits for the two individuals?
A Genetic C Mutation B Environment D Hormone
EnDOFQUESTIOnSPAPER
A
C
B
D
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
125 SOALAN ULANGKAJI SPM 2013
Biology Paper 2 [4551/2]
SECTION A[60 marks]
Answer All Questions In This Section.
1. Diagram 1 shows the cross section of a leaf.
Diagram 1
(a) (i) Name the structure labeled Q. _______________________________________________________________ [1mark]
(ii) State two tissues that form the structure named in (a)(i). 1. _____________________________________________________________ 2. _____________________________________________________________ [2 marks]
(b) Explain how the structure labeled P in Diagram 1 is adapted for optimal photosynthesis. _____________________________________________________________________ _____________________________________________________________________ _____________________________________________________________________ [3 marks]
Indifferenthabitats,plantshavedifferentdistributionofstomataandchloroplasts.
(c) Explain how the above statement enables the following plants to carry out photosynthesis at an optimum rate. i) Aquatic plants _______________________________________________________________
_______________________________________________________________ [2 marks]
ii) Desert plants _______________________________________________________________ _______________________________________________________________ [2 marks]
d) Explain the importance of green plants to living organisms. _____________________________________________________________________
_____________________________________________________________________ [2 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
126 SOALAN ULANGKAJI SPM 2013
2. Diagram 2 illustrates an enzyme-catalyzed reaction according to a hypothesis.
Diagram 2
a) Name the hypothesis. _____________________________________________________________________ [1mark]
b) Name stage 2. _____________________________________________________________________ [1mark]
c) What is formed at stage 3? _____________________________________________________________________ [1mark]
d) State three characteristics of enzymes that can be observed based on diagram 2. _____________________________________________________________________ _____________________________________________________________________ _____________________________________________________________________ [3 marks]
e) The diagram below shows a shirt stained with oil. A branded washing machine is provided with temperature regulator.
i) A housewife uses some detergent containing enzyme to wash the shirt at 35oC. By using the information given, explain why? _______________________________________________________________
_______________________________________________________________ [2 marks]
ii) Suggest one way to increase the effectiveness of the detergent. Explain how it reacts? _______________________________________________________________
_______________________________________________________________ [2 marks]
iii) Name the enzyme that can be found in the detergent. _______________________________________________________________ [1mark]
iv) Suggest an enzyme which can be used to remove starch stains from clothes. _______________________________________________________________ [1mark]
Stage 1 Stage 2 Stage 3
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
127 SOALAN ULANGKAJI SPM 2013
3. Diagram 3.1 shows a section through the human heart.
Diagram 3.1
(a) (i) Name the parts labelled P and S. P : _______________________________________________________________ S : _______________________________________________________________ [2 marks]
(ii) In Diagram 3.1, shade the cavity of the ventricle which contains oxygenated blood. [1 mark]
(b) Explain why the wall around the chamber Q is much thicker than that around chamber R? _____________________________________________________________________ _____________________________________________________________________ _____________________________________________________________________ [2 marks]
(c) (i) In Diagram 3.1, label the bicuspid valve with letter T.
[1 mark]
(ii) Explain the function of bicuspid valve.
__________________________________________________________________ __________________________________________________________________ [1 mark]
Diagram 3.2 shows a part of the circulatory system in human.
Diagram 3.2
d) What happen to the blood pressure as the blood flows from W towards X? _____________________________________________________________________ [1mark]
e) Explain how muscles at X prevent the backflow of blood. _____________________________________________________________________ _____________________________________________________________________ _____________________________________________________________________ [2 marks]
f ) Our normal blood pressure is 120/80 mmHg. Explain what the figure represents. _____________________________________________________________________ _____________________________________________________________________ _____________________________________________________________________ [2 marks]
P
QRS
From the heart
Blood capillaries
To the heart
W
X
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
128 SOALAN ULANGKAJI SPM 2013
Gland X
organ y
4. Diagram 4.1 shows gland X and organ Y which are involved in osmoregulation in human.
Diagram 4.1
(a) Name gland X and organ Y. Gland X : ____________________________________________________________________ Organ Y : ____________________________________________________________________ [2 marks] Diagram 4.2 shows an excretory unit and its associated blood vessels found in organ Y.
Diagram 4.2
(b) Explain the process which causes the movement of some of the blood components from P into Q. _____________________________________________________________________ _____________________________________________________________________ [2 marks]
(c) Explain the difference in the solute concentration of the filtrate in R and Q. _____________________________________________________________________ _____________________________________________________________________ [2 marks]
(d) The contents of urine which passes through the collecting duct are influenced by various factors. Describe how gland X is involved in the formation of urine in the body of an athlete running a 10km race. _____________________________________________________________________ _____________________________________________________________________ _____________________________________________________________________ [3 marks]
In a normal healthy person, the concentration of urea in renal artery is higher than in renal vein.
(e) State the changes in urea concentration in the renal vein after eating meat. _____________________________________________________________________ _____________________________________________________________________ [1 mark] (f ) Explain the importance of osmoregulation in human. _____________________________________________________________________ _____________________________________________________________________ [2 marks]
collecting duct
P QR
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
129 SOALAN ULANGKAJI SPM 2013
5. Diagram 5 shows a type of variation.
Diagram 5
(a) (i) Name the type of variation shown in diagram 5. _______________________________________________________________ [1 mark]
(ii) State the factor that causes the above variation. _______________________________________________________________ [1 mark]
(iii) State how the factor in (a) (ii) causes variation. _______________________________________________________________ [1 mark]
(b) State two traits which show the same type of variation as in (a)(i). Trait 1 : ________________________________________________________________ Trait 2 : ________________________________________________________________ [2 marks]
(c) (i) Height is a type of variation.
Explain the differences between the type of variation shown by a(i) and height. _______________________________________________________________ _______________________________________________________________ [2 marks]
(ii) Name two other examples which is of the same type of variation as height. _______________________________________________________________ _______________________________________________________________ [2 marks]
(d) Explain how variation can ensure the survival of a species. ___________________________________________________________________ ___________________________________________________________________ ___________________________________________________________________ [3 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
130 SOALAN ULANGKAJI SPM 2013
SECTION B[40 marks]
Answer any two questions.
6. Diagram 6.1 shows a respiratory structure of an insect.
Diagram 6.1
(a) (i) Explain the gaseous exchange between tracheole and body cell. [4 marks]
(ii) Chitin is a polysaccharide on the outer surface of structure P. Due to the change in the environment, the insect is unable to form the polysaccharide. Explain how the absence of chitin affects inhalation and the energy production. [6 marks]
(b) Diagram 6.2 shows the rate of oxygen intake before, during and after a vigorous exercise of an athlete.
Diagram 6.2
(i) Based on the graph, compare the respiration before and during the vigorous exercise. [8 marks]
(ii) Explain how the oxygen intake by the athlete returns to the normal level at the 25th minute. [2 marks]
Tracheol
Body cells
P
Oxygen intake (litre/min)
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
131 SOALAN ULANGKAJI SPM 2013
7 (a) Diagram 7 shows the development of a follicle in the female ovary, thickening of uterine endometrium and the hormones involved.
Diagram 7
Explain the relationship between development of the follicle, changing of the respective hormonal level in the blood and the thickening of the uterine endometrium in a female.
[10 marks]
b) The fallopian tubes of a married woman are blocked, making it impossible for her to conceive through the natural process. She and her husband insist to have their own child. Explain one modern technique that can be used by the childless couple to
conceive. Justify your choice. [10 marks]
8 (a) Encik Saiful with blood group A married Puan Zalina with blood group B and they have 4 children. Of their 4 children, 3 of them have blood group O and one with blood group AB. Explain why there is a variation in blood groups of the offsprings. [10 marks]
(b) Genetic engineering is widely used in the field of agriculture and medicine. Justify the impact of genetic engineering on humans and the environment. [10 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
132 SOALAN ULANGKAJI SPM 2013
Biodiversityisthevarietyofplants,animalsandmicroorganismslivingonEarth.Theseorganismslivein
differentecosystemsandareimportanttoourlives.
9. (a) (i) Based on the above statement, discuss the importance of biodiversity. [4 marks]
(ii) Diagram 9 shows an ecosystem in Malaysia.
Diagram 9
Discuss the importance of the ecosystem shown in diagram 9 to the environment and economy of Malaysia. [6 marks]
(b)
Discuss the uses of microorganisms in
(i) the waste treatment process.
(ii) food processing [10 marks]
Biotechnologyistheapplicationoforganismsormicroorganismsortheirbiologicalprocessesinthe
productionofmaterialsforuseinmedicineandindustry.
EnDOFQUESTIOnSPAPER
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
133 SOALAN ULANGKAJI SPM 2013
Biology Paper3 [4551/3]
1. A group of students carried out an investigation to check the water pollution level of Sungai Zarina near their small town, Kampung Zarina.
Four water samples are obtained from four different sources of water along Sungai Zarina: • nearanoilpalmfactory, • attherivermouth, • atKampungZarina • nearapark.
The volume of each water sample is 100 ml. The water samples are collected in reagent bottles and covered immediately. A syringe is used to place 1 ml of 0.1% methylene blue solution at the bottom of each water sample. The bottle are immediately closed and placed in a dark cupboard. The time taken for the methylene blue solution in each sample to
decolourise is shown in Table 1.
Table 1
Answer all questions.
Bottlestopper
Syringe
Reagent bottle
1 ml of 0.1% methylene blue
100 ml Water sample
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
134 SOALAN ULANGKAJI SPM 2013
Table 1
(a) Record the time taken for the methylene blue solution to decolourise in the boxes provided in Table 1. [3 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
135 SOALAN ULANGKAJI SPM 2013
(b) (i) State two different observations made from Table 1.
Observation 1: _____________________________________________________________________ _____________________________________________________________________ _____________________________________________________________________ Observation 2: _____________________________________________________________________ _____________________________________________________________________ _____________________________________________________________________ [3 marks]
(ii) State the inferences from the observation in 1(b)(i).
Inference from observation 1: __________________________________________________________________ __________________________________________________________________
__________________________________________________________________
Inference from observation 2: __________________________________________________________________ __________________________________________________________________
__________________________________________________________________ [3 marks]
(c) Complete Table 2 based on this experiment.
Table 2
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
136 SOALAN ULANGKAJI SPM 2013
Table 2
[3 marks]
(d) State the hypothesis for this experiment. _____________________________________________________________________ _____________________________________________________________________ _____________________________________________________________________
[3 marks]
(e) (i) Construct a table and record all the data collected in the experiment. Your table should have the following titles:
• Watersample • Timetakenformethylenebluesolutiontodecolourise • BODlevelaccordingtohigh,medium,lowandverylow.
[3 marks]
(ii) Use a graph paper to answer this question. Using the data in 1(e)(i),draw a bar chart to show the relationship between the water sample and time taken for methylene blue solution to decolourise.
[3 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
137 SOALAN ULANGKAJI SPM 2013
(f ) Based on the bar chart in 1(e)(ii), explain the relationship between the level of pollution in the water samples and the time taken for methylene blue to decolourise.
_____________________________________________________________________ _____________________________________________________________________ _____________________________________________________________________
[3 marks]
(g) The experiment is repeated on a water sample taken upstream. Predict the time taken for the decolourisation of methylene blue solution.
Explain your prediction.
_____________________________________________________________________ _____________________________________________________________________ _____________________________________________________________________
[3 marks] (h) State the operational definition for Biochemical Oxygen Demand (BOD).
_____________________________________________________________________ _____________________________________________________________________ _____________________________________________________________________
[3 marks]
(i) Diagram 1 shows some of the materials and apparatus used in this experiment.
Classify all the materials and apparatus labeled in Diagram 1 into Table 3.
Table 3
[3 marks]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
138 SOALAN ULANGKAJI SPM 2013
2. Ah Meng has an orchard. He plants watermelons and pineapples in his orchard. He is curious to know the content of vitamin C in the watermelons and pineapples that he has planted.
Based on the statement above, design a laboratory experiment to determine the content of vitamin C in watermelon and pineapple.
The planning of your experimental must include the following aspects:
• Problemstatement
• Hypothesis
• Variables
• Listofapparatusandmaterials
• Experimentalproceduresormethods
• Presentationofdata
[17 marks]
EnDOFQUESTIOnSPAPER
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
139 SOALAN ULANGKAJI SPM 2013
Prinsip Perakaunan Analysis
[3756/1][3756/2]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
140 SOALAN ULANGKAJI SPM 2013
Prinsip Akaun Kertas 1 [3756/1]
1 Di antara berikut yang manakah bukan ciri-ciri kod etika akauntan profesional?
A Keutuhan B Kerahsiaan C Kebolehpercayaan D Urus Tadbir yang Baik 2 Antara berikut, pernyataan manakah yang salah? A Keuntungan koperasi diagihkan dalam bentuk bonus B Keuntungan milikan tunggal diperoleh oleh pemilik sendiri C Keuntungan syarikat berhad diagihkan dalam bentuk
dividen dan bonus D Keuntungan perkongsian diagihkan menurut Ikatan
Perjanjian Perkongsian 3 Pengguna luaran penyata kewangan adalah seperti berikut
kecuali A Pemiutang B Pihak bank C Pemegang saham D Pihak pengurusan
4 Pasangan manakah yang betul bagi akaun kontra dan akaun induk
5 Antara berikut butiran manakah merupakan liabiliti semasa? A Komisen diterima terdahulu B Belanja iklan terdahulu C Stok alat tulis D Gadai janji
6 Barang niaga bernilai RM400 dijual RM568 secara kredit Apakah kesan urus niaga ini ke atas persamaan perakaunan?
7 Dokumen-dokumen yang terlibat untuk kerja-kerja perekodan dalam buku perakaunan ialah
I Memo II Sebut harga III Nota serahan IV Slip Pindahan Wang
A I dan II B I dan IV C II dan IV D III dan IV
8 Berdasarkan keratan cek dalam Rajah 1 di bawah, berapakah jumlah bayaran gaji yang dibuat kepada Encik Razikin pada 31 Mac 2013?
Keratan CekRAJAH 1
A. RM 500 B. RM 600 C. RM1 400 D. RM2 000
9 Makluman debit dihantar oleh pihak bank kepada pelanggan atas sebab-sebab berikut kecuali
A Pindahan kredit B Perintah sedia ada C Pengeluaran buku cek D Caj terhadap cek tak laku
RAJAH 2 10 Berdasarkan Jurnal Pulangan Jualan di atas, apakah butiran yang
mungkin diisikan pada ruangan X? A Pelbagai penghutang B Akaun Pulangan Jualan C Jumlah Pulangan Jualan D Jumlah Jurnal Pulangan jualan
11 Nota debit salinan hendaklah direkodkan ke dalam A Jurnal Jualan B Jurnal Belian C Jurnal Pulangan Belian D Jurnal Pulangan Jualan
Akaun Kontra Akaun IndukA Akaun Ambilan Akaun ModalB Akaun Diskaun diberi Akaun PenghutangC Akaun Pulangan masuk Akaun Belian
D Akaun Peruntukan Hutang Ragu Akaun Jualan
Stok Penghutang Untung bersih
A BerkurangRM400
BertambahRM568
BertambahRM168
B BerkurangRM568
BertambahRM400
BerkurangRM168
C BertambahRM400
BertambahRM568
BertambahRM168
D BertambahRM568
BertambahRM400
BertambahRM168
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
141 SOALAN ULANGKAJI SPM 2013
12 Antara urus niaga berikut, yang manakah tidak direkodkan dalam buku tunai
I Pembayaran bil telefon dengan cek II Menghantar invois kepada pelanggan III Ambilan tunai untuk kegunaan persendirian IV Membawa masuk komputer bimbit peribadi untuk
kegunaan perniaagaan
A I dan III B I dan IV C II dan IV D III dan IV
13 Butiran manakah yang terdapat di sebelah debit akaun kawalan pemiutang?
A Belian B Kontra C Diskaun diberi D Pulangan masuk
14 Catatan lejar yang betul bagi pembayaran balik jumlah tunai runcit yang telah dibelanjakan adalah
RAJAH 3 15 Berikut merupakan penyata pendapatan bagi tahun berakhir 30
Jun 2013
Penyata Pendapatan bagi tahun berakhir 30 Jun 2013
RAJAH 4 Butir yang patut dicatatkan di tempat X dan Y ialah
16 Yang manakah antara berikut direkod sebagai hasil dalam Penyata Pendapatan?
I Pengurangan peruntukan hutang ragu II Penambahan peruntukan hutang ragu III Faedah simpanan tetap IV Hutang lapuk terpulih
A I, II dan III B I, II dan IV C I, III dan IV D II, III dan IV
17 Akaun manakah antara berikut mempunyai baki kredit dalam imbangan duga
A Ambilan B Pulangan belian C Pulangan jualan D Angkutan keluar 18 Tempoh perakaunan bagi perniagaan runcit Syauqi Enterprise
bermula 1 Jun hingga 31 Mei. Sewa bulanan ialah RM300. Sehingga akhir tempoh perakaunan, perniagaan ini telah membayar sewa sebanyak RM 4 200.
Berapakah jumlah sewa yang terdahulu?
A RM300 B RM600 C RM3 600 D RM4 200
19 Antara pernyataan berikut, yang manakah tidak benar tentang peruntukan hutang ragu?
A Suatu anggaran hutang yang tidak dapat dikutip B Suatu kerugian dan dikelaskan sebagai belanja C Suatu keuntungan dan dikelaskan sebagai hasil D Hutang yang pasti tidak dapat dikutip 20 Butiran berikut diambil daripada buku Syarikat Zarul pada 30
Jun 2013.
Bagi tahun berakhir 30 Jun 2013, kenderaan ini disusutnilaikan dengan kadar 10% setahun mengikut kaedah baki berkurangan. Hitungkan susutnilai kenderaan bagi tahun berakhir 30 Jun 2013.
A RM2 680 B RM3 900 C RM5 120 D RM10 480 21. Pada 1 Januari 2012, sebuah mesin dibeli dengan harga
RM10,000. Kadar susutnilai ialah 15% setahun atas kos. Mesin itu dijual pada 31 Disember 2012 dengan harga RM8 000.
Pilih pernyataan yang betul.
A Rugi daripada pelupusan sebanyak RM500. B Rugi daripada pelupusan sebanyak RM1 500. C Untung daripada pelupusan sebanyak RM500. D Untung daripada pelupusan sebanyak RM1 500.
X YA Diskaun diberi Upah atas belianB Diskaun diberi Angkutan masukC Diskaun diterima Angkutan keluarD Diskaun diterima Insurans atas belian
Debit KreditA Bank Tunai RuncitB Tunai BankC Tunai Runcit AkauntanD Tunai Runcit Bank
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
142 SOALAN ULANGKAJI SPM 2013
22 Catatan Hutang Lapuk Pulih akan direkodkan seperti berikut:
23 Diberi maklumat seperti berikut:
Hitungkan harga pelupusan kenderaan.
A RM 30 000 B RM 31 000 C RM 29 000 D RM 44 000
24 Kehilangan tunai bukan disebabkan perkara berikut:
A Kecurian B Penipuan C Penyelewengan D Kebolehpercayaan
25 Maklumat berikut diperoleh daripada buku perniagaan En. Tan pada bulan Julai 2013
Hitungkan baki kredit di Penyata Bank pada bulan Julai 2013?
A RM1 520 B RM1 535 C RM1 715 D RM1 750
26 Kesan varian manakah memberikan gambaran yang benar
27 Item manakah yang tidak terdapat di bahagian pembayaran slip gaji?
A Kumpulan Wang Simpanan Pekerja (KWSP) caruman pekerja
B Kumpulan Wang Simpanan Pekerja (KWSP) caruman majikan
C. Pertubuhan Keselamatan Sosial (PEKESO) caruman pekerja
D. Potongan Cukai Berjadual
28 Catatan jurnal am bagi merekod pembayaran potongan-potongan kepada pihak-pihak tertentu ialah
29 Antara berikut, yang manakah bukan kesan kemasukan rakan kongsi baru
A Aset dan liabiliti perlu dinilai semula B Mengubah kedudukan aset dan liabiliti C Ikatan perjanjian perkongsian tidak perlu dibuat semula D Hak dan tanggungjawab pekongsi diperuntukkan semula
30 Pembubaran perkongsian disebabkan perkara-perkara berikut kecuali
A Arahan mahkamah B Perkongsian ditukarkan ke koperasi C Tamat tempoh perjanjian perkongsian D Ketidak mampuan membayar hutang perniagaan
31 Akaun Modal pekongsi berbaki debit atas sebab-sebab berikut kecuali
A Modal yang disumbangkan rendah B Ambilan yang dibuat terlalu sedikit C Rugi realisasi melebihi baki kreditnya D Nilai aset yang diambil alih terlalu tinggi
32 Pekongsi meminjamkan RM10 000 kepada perkongsian dengan kadar faedah 6% setahun. Faedah atas pinjaman yang telah dibayar oleh perkongsian adalah RM400. Catatan untuk faedah atas pinjaman ialah
33 Pilih pernyataan yang benar tentang dividen interim I Dividen sementara II Lazimnya dibayar setahun sekali III Dibayar setelah keuntungan syarikat diketahui IV Dibayar sebelum keuntungan syarikat diketahui A I dan III B I dan IV C II dan III D II dan IV
Debit Kredit
A Akaun Untung Rugi Akaun Hutang Lapuk Pulih
B Akaun Penghutang Akaun Hutang Lapuk Pulih
C Akaun Hutang Lapuk Pulih Akaun PenghutangD Akaun Hutang Lapuk Pulih Akaun Tunai
Item Kesan Varian
A Penerimaan dalam belanjawan melebihi penerimaan sebenar Memuaskan
B Pembayaran sebenar melebihi pembayaran dalam belanjawan Memuaskan
C Baki akhir dalam belanjawan melebihi baki akhir sebenar Memuaskan
D Lebihan sebenar melebihi lebihan dalam belanjawan Memuaskan
Debit Kredit
A Gaji Yuran KoperasiB Gaji BankC Bank Yuran KoperasiD Yuran Koperasi Bank
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
143 SOALAN ULANGKAJI SPM 2013
34 Butir-butir dalam tatawujud syarikat adalah seperti berikut kecuali
A Cara pembayaran dividen B Jenis perniagaan yang dijalankan C Pernyataan tentang liabiliti pemegang saham C Modal berdaftar, bilangan saham dan jenis saham
35 Pada 1 Januari 2013, Kelab Rekreasi HNR, mempunyai aset dan liabiliti seperti berikut:
Berdasarkan maklumat di atas, dana terkumpul Kelab Rekreasi HNR pada 1 Januari 2013 ialah
A RM47 650 B RM47 350 C RM44 350 D RM38 350
36. Yang manakah belanja modal bagi sesebuah kelab dan persatuan
A Susutnilai aset bukan semasa B Belanja pengubahsuaian bangunan pejabat C Pembelian barang untuk kegunaan kelab seperti bola tenis D Belanja penyelenggaraan dan pembaikan aset bukan semasa
Soalan 37 adalah berdasarkan maklumat di bawah.
Diberikan bahawa modal tambahan dalam tahun 2013 berjumlah RM2 500 dan ambilan oleh pemilik ialah RM2,000. Hitungkan untung atau rugi bersih perniagaan itu dalam tempoh tersebut.
A RM4 170 (Rugi Bersih) B RM4 170 (Untung Bersih) C RM3 630 (Rugi Bersih) D RM3 630 (Untung Bersih)
38 Antara berikut, yang manakah bukan kos overhed kilang A Belanja alat kecil B Cukai taksiran kilang C Gaji pentadbiran pejabat D Gaji pengawal keselamatan
39. Data di bawah dipetik daripada buku Firma ABC bagi tahun berakhir 31 Mac 2013
Hitungkan unit pengeluaran sekiranya firma ingin mendapatkan keuntungan RM14 000.
A 400 unit B 600 unit C 1 000 unit D 2 000 unit
40 Maklumat berikut dipetik daripada buku akaun Perniagaan
Awang Bakar
Modal awal RM60 000 Modal akhir RM73 800 Untung kasar RM33 000 Untung bersih RM13 800
Berdasarkan maklumat di atas, kirakan pulangan atas modal bagi perniagaan ini
A 44.72% B 55.00% C 18.70% D 23.00%
KERTAS SOALAN TAMAT
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
144 SOALAN ULANGKAJI SPM 2013
Prinsip Akaun Kertas 2 [3756/2]
Bahagian A(60 markah)
Jawab semua soalan 1 (a) Nyatakan satu nama akaun dalam setiap kod item carta akaun berikut:
(2 markah)
(b) Nyatakan akaun yang didebit dan dikreditkan dalam urus niaga berikut:
Menjualstokbarangniagasecarakredit
(2 markah)
(c) Maklumat berikut diambil daripada Perniagaan Perabot Misran
Hitung susutnilai skru bagi Perniagaan Perabot Misran (2 markah)
(d) Kelaskan perkara berikut samada terkandung dalam peruntukan akta perkongsian 1961 ataupun dinyatakan dalam ikatan perjanjian perkongsian
(2 markah)
(e) Kelaskan belanja berikut kepada 2 kategori belanja sesebuah kelab dan persatuan
(2 markah)
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
145 SOALAN ULANGKAJI SPM 2013
2 Imbangan Duga berikut diperolehi daripada buku Perniagaan Siadah pada 31 Ogos 2013
Maklumat tambahan: (i) Penilaian: Stok RM5 000 Alat-alat kecil RM3 500 (ii) Hutang sebanyak RM500 dihapuskan sebagai hutang lapuk: (iii) Peruntukan hutang ragu diselaraskan pada kadar 10% atas baki penghutang (iv) Sewa tahunan ialah RM1 200 (v) Terakru: Gaji RM 200 (vi) Ambilan barang berjumlah RM 200 belum direkod dalam mana-mana buku perniagaan (vii) Polisi susut nilai: Kenderaan : 10% mengikut kaedah garis lurus Lengkapan : 5% mengikut kaedah baki berkurangan Alat-alat kecil : penilaian semula
Anda dikehendaki menyediakan :
(a) Penyata Pendapatan bagi tahun berakhir 31 Ogos 2013 [15 markah]
(b) Kunci Kira-Kira pada 31 Ogos 2013 (bentuk penyata) [10 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
146 SOALAN ULANGKAJI SPM 2013
3 Aset dan liabiliti Kelab Warga Taman Ria pada 1 Januari 2013 adalah seperti berikut:
Baki bank 3 000 Stok kantin 1 500 Yuran tertunggak 200 Yuran terdahulu 300 Alatan sukan 5 500 Pemiutang kantin 4 020
Ringkasan Penerimaan dan Pembayaran Kelab bagi tahun berakhir 31 Disember 2013 adalah seperti berikut:
Maklumat Tambahan: i. Stok kantin pada 31 Disember bernilai RM1 500 ii. Pemiutang pada 31 Disember RM3 600 iii. Yuran ahli belum diterima RM600 iv. Susutnilai alatan sukan 10% v. Kadar bayaran terakru RM55 vi. Belanja am terdahulu RM100 vi. Insuran dibayar adalah untuk setahun berakhir 1 April 2014
Anda dikehendaki menyediakan: (a) Akaun Kawalan Pemiutang (3 markah)
(b) Akaun Yuran keahlian (3 markah)
(c) Akaun dagangan kantin bagi tahun berakhir 31 Disember 2013 (4 markah)
(d) Penyata Pendapatan dan perbelanjaan bagi tahun berakhir 31 Disember 2013 (8 markah)
(e) Kunci Kira-kira pada 31 Disember 2013 (7 markah)
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
147 SOALAN ULANGKAJI SPM 2013
Bahagian B(40 markah)
Jawab dua soalan sahaja
4. Baki bank berbeza dengan baki buku tunai seperti berikut: RM Penyata bank 3 480 Buku tunai 3 451
Setelah membandingkan penyata bank dengan buku tunai, Erni telah mengenal pasti perkara berikut:
(i) Cek RM100 yang diterima daripada Saleh tidak dilayan oleh pihak bank
(ii) Cek RM900 diterima daripada penghutang belum lagi didepositkan
(iii) Pihak bank telah mengenakan RM28 untuk faedah atas overdraf (iv) Faedah atas simpanan RM82 dan buku cek RM15 belum direkodkan dalam buku tunai
(v) Akaun bank telah dikreditkan dengan dividen RM200
(vi) Deposit RM300 telah dikreditkan oleh bank tetapi direkod di sebelah kredit buku tunai
(vii) Pihak bank telah membayar premium takaful RM300 atas Perintah Sedia Ada
(viii) Sekeping cek bernilai RM450 yang dibayar kepada Omar tersilap catat sebagai RM540 dalam buku tunai
(ix) Cek bernilai RM400 untuk bayaran sewa belum dikemukakan untuk pembayaran
(a) Sediakan Penyata penyesuaian bank pada 31 Mei 2013 tanpa mengemaskini buku tunai (12 markah)
(b) Apakah 3 tujuan penyediaan penyata penyesuaian bank (3 markah)
(c) Nyatakan 5 sebab cek tak laku (5 markah)
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
148 SOALAN ULANGKAJI SPM 2013
5 Encik Farid dan Halim ialah pekongsi-pekongsi dalam sebuah perniagaan. Perkongsian Farha dengan nisbah pembahagian untung atau rugi 3:2
Kedudukan kewangan perkongsian Farha tersebut pada 30 September 2013 adalah seperti berikut:-
Perniagaan Farha telah dibubarkan pada 30 September 2013. Perkara berikut telah dipersetujui semasa pembubaran.
(i) Aset yang berikut dijual dengan harga: Lengkapan 11 000 Stok 5 000
(ii) Encik Farid mengambil alih kenderaan pada nilai RM15 000.
(iii) Sejumlah RM3 000 berjaya dikutip daripada penghutang
(iv) Belanja realisasi sebanyak RM2 000 telah dibayar
(v) Pinjaman telah dijelaskan sepenuhnya.
(vi) Diskaun sebanyak RM500 diterima daripada pemiutang. Encik Halim bertanggungjawab menjelaskan baki pemiutang.
Anda dikehendaki menyediakan:
(a) Akaun realisasi (8 markah)
(b) Akaun modal pekongsi (8 markah)
(c) Akaun bank (4 markah)
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
149 SOALAN ULANGKAJI SPM 2013
6 (a) Perniagaan Masrif menyimpan buku tunai runcit mengikut sistem panjar dengan peruntukan RM500 sebagai dana runcit pada setiap bulan. Urus niaga yang berikut berlaku sepanjang bulan Jun 2013
2013 Jun 1 Terima sekeping cek daripada Akauntan untuk memulakan 500 Buku tunai runcit 4 Fail, kertas karbon dan dakwat pencetak 100 10 Sampul surat dan setem 10 15 Tambang teksi 20 17 Telegram dan pos bungkusan 75 21 Perabot baru pejabat 510 24 Belanja membaiki telefon pejabat 120 29 Pinjaman kepada pekerja 150
(i) Sediakan buku tunai runcit sehingga 1 Julai 2013 dengan menunjukkan lajur analisis alat tulis, tambang, pos, belanja am dan pelbagai
(8 markah)
(ii) Catatan jurnal am untuk - memulakan dana tunai runcit (2 markah) - memulangkan dana tunai runcit (2 markah)
6 (b) Maklumat urus niaga berikut diambil daripada buku Kedai Andong pada bulan Februari 2013 Februari 1 Baki buku tunai Tunai RM250 Bank RM100 (kredit) 2 Menerima tunai daripada Zaini RM1 000 6 Memasukkan tunai RM900 ke dalam bank 10 Membayar Syarikat Lim dengan cek RM400. Diskaun diterima RM40 15 Ambilan tunai RM210 untuk yuran tuisyen anak 20 Mengeluarkan tunai dari bank RM200 untuk kegunaan pejabat
(i) Sediakan buku tunai tiga lajur (8 markah)
KERTAS SOALAN TAMAT
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
150 SOALAN ULANGKAJI SPM 2013
PerdaganganAnalysis
[3755/1][3755/2]
2008 2009 2010 2011 2012Tajuk K1 K2 K1 K2 K1 K2 K1 K2 K1 K2
1 Asas Kepada Perdagangan 3 1 5 1 6 1 8 1 6 12 Unsur Perdagangan 1 2 - 1 2 1 1 23 Perniagaan Dalam Negeri 5 2 3 2 6 2 5 2 7 2,64 Perniagaan Antarabangsa 2 3 1 3 5 3,6 3 2 2 -5 Industri Kecil Dan Sederhana 2 3 2 3 3 6 3 3 1 36 Pemilikan Perniagaan 2 6 4 3 2 3 3 3,6 4 3,67 Pelaburan 3 4 2 6 1 3 1 3 2 38 Perbankan 5 4 3 4 1 4 3 6 4 4,69 Insurans 5 6 7 6 5 4,6 3 4,6 3 4,6
10 Pengangkutan 2 5 2 4 1 4 2 4 2 411 Komunikasi 2 6 1 5 2 4 1 6 212 Pergudangan 2 - 3 5 2 5,6 2 4 2 513 Promosi 1 5 2 - 2 5 3 5 2 5
14 Peranan Kerajaan Dalam Perniagaan 2 6 2 5 2 5 4 5 - 6
15 Konsumerisme 4 5 4 6 1 5 2 5 2 5Jumlah 40 40 40 40 40
K1 - bilangan soalanK2 - no soalan
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
151 SOALAN ULANGKAJI SPM 2013
Perdagangan Kertas 1 [3755/1]
1 Pernyataan yang manakah benar mengenai keperluan?
A Diperlukan oleh manusia untuk terus hidup B Berbeza-beza mengikut taraf hidup C Keinginan manusia untuk hidup selesa D Sesuatu yang dipelajari daripada pengalaman hidup
2 Pernyataan manakah yang menerangkan keperluan fisiologi dalam Hierarki Keperluan Maslow?
A Puan Nora memberikan hadiah sempena hari lahir anak perempuannya
B Encik Lee memenangi pertandingan golf untuk kali yang ketiga
C Puan Heng menyediakan sarapan untuk anaknya setiap pagi D Encik Aru membawa ahli keluarganya bercuti ke Port
Dickson
3 Apakah maksud pengeluaran langsung?
A Manusia memenuhi keperluan dan kehendak melalui bantuan orang lain
B Manusia menjalankan pengeluaran dijalankan secara pengkhususan
C Pengeluaran yang dijalankan untuk memenuhi keperluan sendiri
D Pengeluaran yang dijalankan secara besar-besaran
4 Apakah nilai faedah yang terlibat dalam proses pengeluaran berikut?
A Nilai faedah masa B Nilai faedah bentuk C Nilai faedah milikan D Nilai faedah tempat
5 Rajah berikut menunjukkan cabang pengeluaran.
Apakah aktiviti yang mewakili X?
A Melombong bijih timah B Membina bangunan C Memproses makanan D Menggunting rambut
6 Pernyataan yang manakah menerangkan ciri seorang usahawan? I Menyumbangkan idea yang kreatif II Mementingkan keuntungan perniagaan III Mementingkan khidmat kepada masyarakat IV Mengamalkan pengurusan yang statik
A I dan II B I dan III C II dan IV D III dan IV
7 Apakah kelebihan pengkhususan kepada seorang pekerja? I Meningkatkan kemahiran II Meningkatkan produktiviti III Mewujudkan minat bekerja IV Melahirkan sifat kreatif
A I dan II B II dan III
C II dan IV D I dan IV
8 Apakah syarat yang membolehkan berlakunya sistem barter?
A Terdapat barang yang tidak tahan lama B Barang mudah dibawa untuk ditukarkan C Terdapat pertemuan kemahuan serentak D Wujudnya mata wang sebagai perantara
9 Pernyataan manakah merupakan fungsi peruncit dalam saluran agihan?
A Lokasi kedai berhampiran dengan pemborong B Membiayai pemborong dengan membayar tunai C Membeli pelbagai jenis barang dari banyak pemborong D Menyediakan pengangkutan sendiri untuk mengangkut
barang
10 Maklumat berikut berkaitan dengan ciri perniagaan runcit besar-besaran.
• Ditubuhkanolehpengilanguntukmemasarkankeluaran • Mempunyailebihdaripada10cawangandiseluruhnegara • Pentadbirandikawalolehibupejabat
Apakah jenis perniagaan runcit di atas? A Kedai sejaras B Pasar raya besar C Koperasi runcit D Gedung aneka jabatan
11 Maklumat berikut berkaitan sejenis kaedah jualan.
• Pelangganmembelibarangdanmembayarsecaraansuran • Barangmenjadimilikpembeliapabilabayaranpertama
dibuat • Sesuaiuntukbarangyangrendahnilaijualannya
Apakah kaedah jualan tersebut?
A Jualan tunai B Bayaran tertunda C Jualan prabayar D Sewa beli
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
152 SOALAN ULANGKAJI SPM 2013
12 Dokumen berikut berkaitan satu urus niaga.
Berapakah jumlah bersih yang akan dibayar oleh Butik Maju Makmur jika bayaran dibuat pada 22 Februari 2013?
A RM1 040.00 B RM1 019.20 C RM988.00 D RM967.20
13 Apakah faedah yang diperoleh daripada aktiviti perniagaan antarabangsa kepada pengeluar?
I Lebih banyak sumber bekalan II Menggalakkan pertukaran pengetahuan dan teknologi III Barang dapat dijual pada harga yang lebih rendah IV Dapat meningkatkan taraf hidup
A I dan II B II dan III C II dan IV D I dan IV
14 Antara berikut yang manakah merupakan eksport nyata?
A Pelajar Malaysia melanjutkan pelajaran di United Kingdom B Pelancong Australia datang ke Malaysia untuk bercuti C Malaysia menjual barang elektrik ke Hong Kong D Pelancong Malaysia menaiki penerbangan Singapore
Airlines
15 Seorang saudagar import menerima inden tertutup daripada pengimport kasut.
Apakah yang dimaksudkan dengan inden tertutup?
A Saudagar import perlu membeli jenama kasut seperti yang dinyatakan dalam inden
B Saudagar import boleh membeli kasut daripada mana-mana pengeluar
C Saudagar import boleh menentukan jenama kasut yang sesuai
D Saudagar import perlu membeli kasut secara kredit sahaja
16 Apakah ciri Industri Kecil dan Sederhana (IKS)?
A Mempunyai tenaga pekerja mahir lebih daripada 150 orang B Mudah ditubuhkan kerana beroperasi di tempat kediaman C Terlibat dalam sektor membuat kenderaan D Teknologi pengeluaran IKS berintensifkan mesin
17 Apakah kepentingan Industri Kecil dan Sederhana (IKS) kepada pembangunan ekonomi negara?
I Membantu mengurangkan masalah pengangguran II Membolehkan usahawan mengambil alih syarikat besar III Memberi peluang usahawan kecil mempelajari teknologi
baru IV Menggalakkan pelabur asing melabur dan memegang ekuiti
dalam IKS
A I dan II B I dan III C II dan III D III dan IV
18 Apakah kebaikan memulakan perniagaan secara mengambil alih?
A Risiko yang dihadapi adalah rendah B Mendapat bimbingan daripada pemilik asal C Dapat mengurangkan persaingan dalam perniagaan D Dapat menguruskan perniagaan mengikut gaya sendiri
19 Pilih pernyataan yang benar mengenai syarikat sendirian berhad.
I Hal ehwal syarikat diumumkan II Liabiliti pemegang syer tidak terhad III Syer tidak boleh dipindah milik dengan mudah IV Bilangan pemegang syer terdiri daripada 2 – 50 orang
A I dan II B II dan III C I dan IV D III dan IV
20 Mengapakah peniaga perlu bijak menguruskan stok?
A Supaya barang cepat habis dijual B Modal tidak terikat dalam bentuk stok C Mendapat diskaun niaga daripada pembekal D Stok gerak cepat tidak melebihi stok gerak perlahan
21 Antara berikut, yang manakah benar mengenai bentuk pelaburan, risiko dan pulangan?
Pelaburan Risiko Pulangan
A Simpanan tetap Rendah RendahB Hartanah Rendah TinggiC Saham Tinggi RendahD Unit Amanah Tinggi Tinggi
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
153 SOALAN ULANGKAJI SPM 2013
22 Maklumat berikut berkaitan dengan ciri sejenis syer keutamaan.
Syeryangdibayarpadasatukadardividenyangtetapdandividentambahanselepaspembayarandividenkepada
pemegangsyerbiasa
Apakah jenis syer keutamaan di atas?
A Syer keutamaan kumulatif B Syer keutamaan boleh tebus C Syer keutamaan penyertaan D Syer keutamaan boleh tukar
23 Apakah tugas utama Bank Negara Malaysia?
A Mengawal dan melaksanakan dasar kerajaan B Mengawal dan melaksanakan dasar kewangan negara C Mengawal dan melaksanakan dasar pembangunan negara D Mengawal dan melaksanakan dasar bank-bank perdagangan
24 Dalam sistem perbankan Islam, simpanan wang atau harta pelanggan di bank merupakan suatu amanah.
Apakah prinsip yang diamalkan?
A Al-Mudharabah B Al-Musyarakah C Al-Wadiah D Al-Rahnu
25 Apakah faktor yang perlu dipertimbangkan oleh pihak bank untuk meluluskan permohonan pinjaman perniagaan?
A Lokasi perniagaan yang dijalankan B Kedudukan kewangan peniaga C Jenis perniagaan yang dijalankan D Sasaran pasaran peniaga
26 Maklumat berikut berkaitan dengan perkhidmatan institusi kewangan.
• Membeliinvoisatauakaunbelumterimadaripadapenjual serta mengutip bayaran daripada pembeli
• Mendahulukanwangtunaipadajumlahtertentudaripada nilai bil hutang kepada penjual
Apakah institusi kewangan yang menjalankan perkhidmatan di atas?
A Syarikat pajakan B Syarikat kewangan C Syarikat pemfaktoran D Syarikat Jaminan Kredit
27 Mengapakah risiko perubahan cita rasa pelanggan tidak boleh diinsuranskan?
I Kadar premium tidak dapat dikira II Kerajaan mengawal cita rasa pelanggan III Risiko kerugian dapat ditanggung oleh peniaga IV Perubahan cita rasa pelanggan tidak dapat dijangka
A I dan II B I dan IV C II dan III D III dan IV
28 Apakah peranan insurans kepada peniaga?
A Mengelakkan kerugian akibat bencana alam B Dapat menumpukan perhatian untuk memajukan
perniagaan C Mendapat keuntungan jika risiko yang diinsuranskan
berlaku D Merupakan satu cara menabung yang berkesan
29 Situasi berikut berkaitan dengan satu tuntutan ganti rugi.
Encik Ramzan telah membeli insurans kesihatan untuk melindungi dirinya.
Semasa mengisi borang cadangan, beliau tidak menyatakan bahawa beliau mempunyai masalah jantung. Apabila beliau dimasukkan ke dalam wad kerana sakit jantung, syarikat insurans tidak membayar sebarang ganti rugi.
Apakah prinsip yang digunakan oleh syarikat insurans untuk menolak tuntutan Encik Ramzan?
A Sumbangan B Kepentingan boleh insurans C Doktrin sebab hampiran D Penuh percaya mutlak
30 Apakah peranan pengangkutan?
A Menggalakkan pengeluaran besar-besaran B Mempengaruhi pengguna untuk membeli sesuatu produk C Membolehkan peniaga berhubung antara satu sama lain D Memudahkan kawalan dan pentadbiran perniagaan
31 Apakah kelebihan menggunakan saluran paip?
A Kos pemasangan yang murah B Tidak memerlukan penyelenggaraan C Risiko kerosakan dan kecurian dapat dielakkan D Dapat mengangkut pelbagai jenis barang
32 Pernyataan yang manakah benar tentang pengkontenaan?
I Sesuai mengangkut muatan dalam kuantiti yang kecil II Boleh mengangkut barang sekali gus III Kukuh, boleh dikunci dan dipateri IV Kos modal yang rendah
A I dan II B I dan IV C II dan III D III dan IV
33 Mengapakah komunikasi penting dalam perniagaan? I Memudahkan peniaga menghantar barangan pukal II Membolehkan peniaga mendapat maklumat dengan cepat III Membantu peniaga mengurangkan kerugian dan kerosakan IV Menggalakkan pembukaan kawasan baru untuk perniagaan
A I dan II B II dan III C III dan IV D I dan IV
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
154 SOALAN ULANGKAJI SPM 2013
34 Apakah perkhidmatan yang membolehkan seseorang pelabur mendapatkan maklumat tentang harga saham?
A MyBursa B MAYPAC C Telestok D Telefaks
35 Berikut adalah ciri-ciri sebuah gudang.
• Menyimpanbarangyangdikenakancukaitetapicukaibelum dijelaskan
• Peniagadibenarkanmasukuntukmenjalankankerja-kerja akhir
• Barangdalamgudangbolehdicagarkanuntukmendapat pinjaman
Apakah jenis gudang tersebut?
A Gudang pengilang B Penyetoran sejuk C Gudang peruncit D Gudang berbon
36 Rajah berikut berkaitan unsur dalam campuran pemasaran.
Pernyataan manakah yang benar tentang P dan Q?
37 Puan Siti ingin membuka sebuah pusat tuisyen di Setia Alam. Kumpulan sasaran beliau ialah pelajar sekolah yang akan menduduki peperiksaan UPSR, PMR dan SPM.
Apakah media pengiklanan yang sesuai untuk memperkenalkan pusat tuisyen tersebut?
I Mengedarkan risalah dari rumah ke rumah II Menyiarkan iklan dalam surat khabar tempatan III Menggantung sepanduk berhampiran kawasan sekolah IV Menyiarkan maklumat pusat tuisyen di dalam laman web
A I dan II B II dan IV C I dan III D III dan IV
38 Maklumat berikut berkaitan dengan perundangan perniagaan. Akta ini melindungi pengguna daripada peniaga atau pengeluar
yang memberi maklumat palsu atau salah tentang sesuatu produk
Apakah akta tersebut?
A Akta Francais 1998 B Akta Kawalan Harga 1946 C Akta Jualan Langsung 1993 D Akta Perihal Dagangan 1972
39 Pernyataan yang manakah benar tentang taraf perintis?
A Potongan cukai dua kali untuk promosi eksport barang B Pelepasan cukai selama lima tahun bagi syarikat yang
berstatus MSC C Pengecualian cukai bagi syarikat yang terlibat dalam
pengeluaran makanan D Pelepasan cukai mengikut peratusan tertentu selama lima
tahun
40 Apakah yang perlu dipertimbangkan oleh seorang pengguna bijak semasa membeli?
I Meneliti kandungan bahan II Memilih jenama yang terkenal III Mengenal pasti tarikh luput barang IV Memilih barang yang murah
A I dan II B I dan III C II dan IV D III dan IV
KERTAS SOALAN TAMAT
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
155 SOALAN ULANGKAJI SPM 2013
Perdagangan Kertas 2 [3755/2]
BAHAGIAN A[75 markah]
Jawab tiga soalan sahaja.
1 (a) Nyatakan dua perbezaan keperluan dan kehendak. [4 markah]
(b) Dalam pengeluaran, sesuatu keluaran mempunyai nilai faedah jika ia memberi kepuasan kepada pengguna. Terangkan tiga jenis nilai faedah dalam pengeluaran.
[6 markah]
(c) Situasi berikut berkaitan dengan pengeluaran yang dijalankan Encik Rayyan. Encik Rayyan mengusahakan dusun durian di Raub, Pahang. Hasil tanaman durian diproses di kilang yang dibuka bandar berhampiran. Encik Rayyan menghasilkan pelbagai makanan daripada durian untuk dijual di pasar raya berhampiran dan di hantar ke Kuala Lumpur. Beliau dibantu oleh sepuluh orang pekerja.
Terangkan tiga peranan Encik Rayyan sebagai seorang usahawan. [6 markah]
(d) Jelaskan empat kekurangan mengamalkan pengkhususan dalam pengeluaran.
[4 markah]
(e) Situasi berikut berkaitan perbualan antara dua sahabat. Angah: Saya ada ayam dan saya perlukan beras. Man: Saya ada beras tetapi hanya cukup untuk keperluan kami sekeluarga.
(i) Nyatakan dua syarat yang perlu dipenuhi dalam sistem barter. [2 markah]
(ii) Jelaskan tiga kelemahan dalam sistem barter. [3 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
156 SOALAN ULANGKAJI SPM 2013
2 (a) Huraikan perkaitan pengeluaran, perdagangan dan perniagaan. [6 markah]
(b) Gambar berikut menunjukkan sebuah peti sejuk yang dibeli oleh Puan Zarina dengan kaedah bayaran tertunda.
(i) Hitung jumlah faedah yang perlu dibayar oleh Puan Zarina. [2 markah]
(ii) Jelaskan tiga kelebihan kaedah jualan di atas kepada pengguna. [3 markah]
(c) Rajah berikut menunjukkan jenis-jenis ejen.
Huraikan jenis ejen berikut:
(i) X [3 markah]
(ii) Y [3 markah]
(d) Situasi berikut berkaitan dengan Pak Atan, seorang peruncit.
Pak Atan menerima bekalan roti dari Syarikat Roti Enak dua kali seminggu. Syarikat roti tersebut menyediakan rak untuk memperagakan roti di kedai Pak Atan. Pak Atan akan membayar roti yang habis dijual sahaja manakala selebihnya akan
dipulangkan kepada Syarikat Roti Enak.
(i) Nyatakan jenis pemborong dalam situasi di atas. [1 markah]
(ii) Jelaskan tiga peranan pemborong dalam (c) (i) di atas. [3 markah]
(e) Syarat serahan terdiri daripada syarat masa serahan dan syarat bayaran angkutan. Terangkan dua syarat masa serahan.
[4 markah]
TUnAI:RM1800 @
PEnDAHULUAn:RM300
AnSURAnBULAnAn:RM67.50selama2tahun
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
157 SOALAN ULANGKAJI SPM 2013
3 (a) Malaysia mengimport hasil tenusu dari New Zealand dan mengeksport minyak kelapa sawit ke negara tersebut. Huraikan faktor yang menyebabkan wujudnya perniagaan tersebut.
[6 markah]
(b) Jelaskan empat halangan dalam perniagaan antarabangsa.
[4 markah]
(c) Maklumat berikut berkaitan dengan Industri Kecil dan Sederhana (IKS). Encik Mustafa mengusahakan sebuah kilang perabot di Kuala Selangor. Kilang beliau membekalkan perabot ke sekolah-sekolah
kerajaan melalui Pemasaran Bersepadu.
Apakah yang dimaksudkan dengan Pemasaran Bersepadu?
[3 markah]
(d) Seorang usahawan merupakan pemimpin dalam organisasi perniagaannya dan haruslah mahir dalam pengurusan sumber manusia.
Terangkan tiga ciri pengurusan sumber manusia yang baik.
[6 markah]
(e) Terangkan tiga perbezaan antara syarikat awam berhad dan syarikat sendirian berhad.
[6 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
158 SOALAN ULANGKAJI SPM 2013
4 (a) Maklumat berikut berkaitan dengan pelaburan Encik Amran.
Encik Amran memiliki 2500 unit 8% syer keutamaan bernilai RM2.00 seunit dan 5000 unit syer biasa bernilai RM1.00 seunit dalam Syarikat Global Crystal Berhad. Syarikat tersebut telah mengisytiharkan pembayaran dividen 7% bagi bagi syer biasa, pada tahun berakhir 31 Disember 2012. Hitung pendapatan Encik Amran daripada pelaburan dalam Syarikat Global Crystal Berhad.
[4 markah]
(b) Jelaskan empat faktor perlu dipertimbangkan semasa membuat pelaburan.
[4 markah]
(c) Encik Haikal bercadang untuk menyediakan perkhidmatan fotostat di kedai alat tulis yang baru dibuka. Beliau mempertimbangkan dua cara untuk mendapatkan mesin fotostat tersebut iaitu melalui syarikat pajakan atau membeli secara tunai.
(i) Tentukan cara pembelian yang sesuai dipilih oleh Encik Haikal. [1 markah]
(ii) Jelaskan tiga sebab bagi pilihan (i) di atas.
[3 markah]
(d) Situasi berikut berkaitan dengan polisi insurans.
Puan Hannan memiliki sebuah kereta Perodua MyVi. Kereta beliau telah dicuri ketika diparkir di hadapan rumahnya. Syarikat insurans telah membayar pampasan kepada Puan Hannan di atas kecurian kereta tersebut. Sebulan kemudian, kereta
beliau telah dijumpai semula tetapi syarikat insurans tidak membenarkan beliau menuntut hak milik kereta tersebut. Selain itu, Puan Hannan juga memiliki polisi Hayat Endowmen. Bagaimanapun beliau mendapati premium yang dikenakan lebih tinggi
daripada adiknya yang tujuh tahun lebih muda darinya.
(i) Mengapakan syarikat insurans tidak membenarkan Puan Hannan menuntut hak milik kereta tersebut?
[3 markah]
(ii) Jelaskan empat faktor yang dipertimbangkan dalam pengiraan premium insurans hayat.
[4 markah]
(e) Terangkan tiga peranan pengangkutan dalam membantu perniagaan.
[6 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
159 SOALAN ULANGKAJI SPM 2013
5 (a) Maklumat berikut berkaitan dengan seorang pengimport kereta.
Datuk Ghani adalah seorang pengimport kereta dari Eropah. Kereta-kereta yang diimport akan disimpan dalam sebuah gudang apabila sampai di pelabuhan. Kereta-kereta tersebut akan dikeluarkan dari gudang setelah cukai dikeluarkan.
(i) Nyatakan jenis gudang yang digunakan untuk menyimpan kereta import tersebut.
[1 markah]
(ii) Jelaskan empat kelebihan gudang tersebut.
[4 markah]
(b) Rajah berikut menunjukkan unsur-unsur dalam campuran pemasaran.
Huraikan berkaitan perkara berikut:
(i) P [4 markah]
(ii) Q [4 markah]
(c) Kerajaan memberikan galakan kepada peniaga yang terlibat dalam industri tertentu dengan memberikan pelepasan cukai.
Huraikan pelepasan cukai berikut:
(i) Taraf perintis [3 markah]
(ii) Elaun cukai pelaburan
[3 markah]
(d) Berikut adalah perbualan dua orang sahabat.
Razeef: Sudah lama saya menyewa rumah. Rumah yang saya beli sejak lima tahun yang lepas masih belum siap lagi. Apa yang perlu saya lakukan?
Farhan: Adakah anda mengetahui latar belakang pemaju perumahan sebelum membeli rumah tersebut?
Razeef : Saya tidak mendapat maklumat tentangnya.
Farhan: Bagaimanapun, anda boleh membuat tuntutan di Tribunal Tuntutan Pengguna atas kelewatan pemaju menyiapkan rumah itu.
(i) Apakah hak pengguna dalam situasi di atas. [2 markah]
(ii) Jelaskan peranan Tribunal Tuntutan Pengguna. [4 markah]
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly
160 SOALAN ULANGKAJI SPM 2013
BAHAGIAN B[25 markah]
Soalan ini wajib dijawab.
Puan Rafiza adalah pemilik Salun dan Spa Harmoni yang menjalankan perniagaan salun kecantikan untuk wanita di Bandar Bukit Tinggi sejak lima tahun yang lepas. Salun ini memberikan perkhidmatan rawatan kecantikan, spa dan mendandan rambut kepada wanita sahaja.
Perkhidmatan yang berkualiti dan harga yang berpatutan telah menarik ramai pelanggan datang ke salunnya. Perniagaan salun ini dibuka
setiap hari dari jam 10.00 pagi hingga 10.00 malam dan dibantu oleh tujuh orang pekerja yang mahir dalam bidang kecantikan.
Untuk mengelakkan pelanggan menunggu lama, salun ini hanya menerima pelanggan yang membuat temu janji terlebih dahulu. Temu janji boleh dibuat melalui telefon dan internet. Salun ini juga menggunakan laman sosial facebook dan laman blog untuk mengiklankan perkhidmatan di sini.
Disamping perkhidmatan yang disediakan, Puan Rafiza juga mengeluarkan sendiri produk kesihatan berasaskan herba. Beliau mempunyai kemahiran menghasilkan produk kesihatan yang dipelajari daripada ibunya. Produk ini amat digemari oleh pelanggan-pelanggannya. Ini telah menambahkan pendapatan perniagaan beliau disamping membantu pelanggan yang mempunyai masalah kesihatan.
Produk ini juga boleh ditempah melalui internet. Barang yang ditempah akan dihantar menggunakan perkhidmatan kurier. Hasil pendapatan dari salun kecantikan ini disimpan di bank bagi menjamin keselamatan. Beliau mempunyai akaun semasa di salah
sebuah bank perdagangan. Memandangkan perniagaan mendapat sambutan yang menggalakkan dari orang ramai, Puan Rafiza bercadang untuk menambah pengeluaran produk kecantikan bagi memenuhi permintaan yang semakin bertambah. Namun begitu beliau masih kekurangan modal. Beliau bercadang untuk membuat pinjaman daripada bank perdagangan tetapi seorang kawan mencadangkan beliau memohon kemudahan overdraf dari bank berkenaan.
Berdasarkan kes di atas, jawab soalan-soalan berikut:
(a) Namakan jenis saluran agihan yang terlibat dalam situasi di atas dan nyatakan sebab saluran agihan tersebut dipilih.
[2 markah]
(b) Jelaskan sebab perkhidmatan kurier digunakan dalam situasi di atas.
[5 markah]
(c) Jelaskan kelebihan E-dagang kepada pelanggan.
[4 markah]
(d) Jelaskan empat peranan bantuan berikut kepada Puan Rafiza. (i) Promosi
[4 markah]
(ii) Perbankan [4 markah]
(e) Berikan tiga perbezaan antara pinjaman dan overdraf.
[6 markah]
KERTAS SOALAN TAMAT
http://edu.joshuatly.com/ http://fb.me/edu.joshuatly