Upload
morgan-ward
View
228
Download
1
Tags:
Embed Size (px)
Citation preview
Secondary Structure Prediction and Signal Peptides
Protein Analysis Workshop 2012
Bioinformatics groupInstitute of BiotechnologyUniversity of helsinki
Earlier version: Hung Ta
Current: Petri Törönen
Why Sec. Struct. Predictions andsignal peptides?
Usually sequence homology represents good source of information
However sometimes one does not get good homology
We need other sources of information to aid us• Domain (profile) homologies (later lectures)
• Secondary structure
• Signal peptides
• Transmembrane regions
Sec.Struct. And signal peptides also good information for other bioinformatics tools
Secondary Structure
Alternative when only weak sequence homology Structure more conserved than sequence
Similar sec. struct. gives extra support for weak sequence homology
Special cases of sec. struct. can suggest function or localization
Hierachy of Protein Structure Hierachy of Protein Structure
Primary Structure: a Primary Structure: a Linear Arrangement Linear Arrangement of Amino Acidsof Amino Acids
An amino acid has several structural components: a central carbon atom (C), an amino group (NH2), a carboxyl group (COOH), a hydrogen atom (H), a side chain (R). There are 20 amino acids
The peptide bond is formed as the cacboxyl group of an aa bind to the amino group of the adjacent aa.
The primary structure of a protein is simply the linear arrangement, or sequence, of the amino acid residues that compose it
Secondary Structure: Secondary Structure: Core Elements of Core Elements of Protein ArchitectureProtein Architecture
resulted from the folding of localized parts of a
polypeptide chain.
α-helix
β-sheet
Coils, turns,
} major internal supportive elements, 60 percent of the polypeptide chain
αα-Helix-Helix
Hydrogen-bonded
3.6 residues per turn
Axial dipole moment
Side chains point outward
Average length is 10 amino acids
(3 turns).
Typically, rich of Analine,
Glutamine, Leucine, Methione;
and poor of Proline, Glycine,
Tyrosine and Serine.
ββ-Sheet-Sheet
Formed due to hydrogen bonds
between β-strands which are short
polypeptide segments (5-8
residues).
Adjacent β-strands run in the
same directions -> parallel sheet.
Adjacent β-strands run in the
oposite directions -> anti-parallel
sheet.
Ribbon diagram
Turns, loops, coils…Turns, loops, coils…
A turn, composed of 3-4 residues, forms
sharp bends that redirect the polypeptide
backbone back toward the interior.
A loop is similar with turns but can form
longer bends
Turns and loops help large proteins fold into
compact structures.
A random coil is a class of conformations
that indicate an absence of regular
secondary structure.
Turn
Secondary Structure PredictionSecondary Structure Prediction
Primary: MSEGEDDFPRKRTPWCFDDEHMC
Secondary: CCHHHHHHCCCCEEEEEECCCCC
Why: the first level of structural organization.
The tasks:
• H: α-helix
• E: β- strand
• T: turn
• C: coil
aa
?
Secondary Structure PredictionSecondary Structure Prediction
Single residue statistical analysis (Chou-Fasman -1974): For each amino acid type, assign its ‘propensity’ to be in a helix, β-
sheet, or coil.
Based on 15 proteins of known conformation, 2473 total amino
acids.
Limited accuracy: ~55-60% on average.
Eg: Chou-Fasman (1974), not used any more
Secondary Structure PredictionSecondary Structure Prediction
Segment-based statistics: Look for correlations (within 11-21 aa windows).
Many algorithms have been tried.
Most performant: Neural Networks:
Input: a number of protein sequences with their known secondary
structure.
Output: a trained network that predicts secondary structure elements for
given query sequences.
Accuracy < 70%.
Popular Servers for Secondary Structure Prediction
Jpred (http://www.compbio.dundee.ac.uk/www-jpred/ )
Psipred (http://bioinf.cs.ucl.ac.uk/psipred/ ) Metaserver PredictProtein
(http://www.predictprotein.org/ ).
PSIPRED and JPRED
Test with uniprot|P00772|ELA1_PIG Elastase-1 precursor
Correct answer: http://www.uniprot.org/uniprot/P00772
PSIPRED (http://bioinf.cs.ucl.ac.uk/psipred/result/351083)
JPRED (http://www.compbio.dundee.ac.uk/www-jpred/results/jp_Pt7zBV4/jp_Pt7zBV4.results.html)
•Above the summary•On the right the Detailed view
Special Cases of Secondary Special Cases of Secondary StructureStructure
Informative special cases of secondary structures. These include: Coiled Coil regions Transmembrane regions
Prediction of coiled-coilsPrediction of coiled-coils
• Coiled-coil protein are often biologically relevant regulators (Transcription Factors)• Coiled-coils are generally solvent exposed multi-stranded helix structures:
Helix periodicity and solvent exposure imposespecial pattern of heptad repeat:
… abcdefg … hydrophobic residues hydrophilic residues
two-stranded
(From Wikipedia Leucine zipper article)
Helical diagram of2 interacting helices:
Compares a sequence to a database of known, parallel two-stranded coiled-coils, and derives a similarity score.
By comparing this score to the distribution of scores in globular and coiled-coil proteins, the program then calculates the probability that the sequence will adopt a coiled-coil conformation.
Options:• scoring matrices,• window size (score may vary),• weighting options.
The COILS server at EMBnetThe COILS server at EMBnet
The program works well for parallel two-stranded structures that are solvent-exposed but runs progressively into problems with the addition of more helices, their antiparallel orientation and their decreasing length.
The program fails entirely on buried structures.
COILS LimitationsCOILS Limitations
COILS DemoCOILS Demo
Let us submit the sequence
to the COILS server at EMBnet:
http://www.ch.embnet.org/software/COILS_form.html
>1jch_AVAAPVAFGFPALSTPGAGGLAVSISAGALSAAIADIMAALKGPFKFGLWGVALYGVLPSQIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSVPVVDAKPTERPGVFTASIPGAPVLNISVNNSTPAVQTLSPGVTNNTDKDVRPAFGTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL
Correct answer:http://www.rcsb.org/pdb/explore/explore.do?structureId=1JCH
Correct answer:http://www.rcsb.org/pdb/explore/explore.do?structureId=1JCH
Transmembrane proteins are important receptor or transport proteins.
Transmembrane regions: Usually contain residues with hydrophobic side
chains (surface must be hydrophobic). Usually ~20 residues long, can be up to 30 if
not perpendicular through membrane.Methods: Hydropathy plots (historical, better methods now available)
Threading (TMpred, MEMSAT), Hidden Markov Model (TMHMM), Neural Network (PHDhtm).
Transmembrane Region PredictionTransmembrane Region Prediction
Hydropathy Plots (Kyte-Doolittle)
The hydropathy index of an amino acid is a number
representing the hydrophobic or hydrophilic properties of
its side-chain
compute an average hydropathy value for each position
in the query sequence,
window length of 19 usually chosen for membrane-
spanning region prediction.
•Skip this
>sp|P06010|RCEM_RHOVI Reaction center protein M chain (Photosynthetic reaction center M subunit) - Rhodopseudomonas viridis. ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIYLGASGIAAFAFGSTAILIILFNMAAEVHFDPLQFFRQFFWLGLYPPKAQYGMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGCIHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFWRWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHG AAPDYPAYLPATPDPASLPGAPK
Hydropathy Plot ServersHydropathy Plot Servers
Let us submit the sequence
to
Membrane Explorer (also as standalone MPEx), Grease (http://fasta.bioch.virginia.edu/fasta_www2/fasta_www.cgi?rm=misc1)
Remove the FASTA header, if seq reading is not working.
•Skip this
Hydropathy PlotHydropathy Plot
The larger the number is, the more hydrophobic the amino acid
Correct answer (http://pir.uniprot.org/uniprot/P06010)
•Skip this
Scans a candidate sequence for matches to a sequence scoring matrix, obtained by aligning the sequences of all transmembrane alpha-helical regions that are known from structures.
These sequences are collected in a database called TMBase.
TM PredTM Pred
Method summary:
Remark: Authors do not suggest this method for genomic sequences. Automatic methods recommended, eg, TMHMM, PHDhtm.
TM Pred ServerTM Pred Server
>sp|P06010|RCEM_RHOVI Reaction center protein M chain (Photosynthetic reaction center M subunit) - Rhodopseudomonas viridis. ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIYLGASGIAAFAFGSTAILIILFNMAAEVHFDPLQFFRQFFWLGLYPPKAQYGMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGCIHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFWRWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHG AAPDYPAYLPATPDPASLPGAPK
Let us submit RCEM_RHOVI again
to the TMPred server at EMBnet:
http://www.ch.embnet.org/software/TMPRED_form.html
allows you to obtain many informations based on your sequence including structure predictions, motif or domain search… The predictions are based on several methods.
PredictProtein: http://predictprotein.org
Meta-ServersMeta-Servers
A server which
For sequence analysis, structure and function prediction. When you submit
any protein sequence PredictProtein retrieves similar sequences in the
database and predicts aspects of protein structure and function
SEG: finds low complexity regions.
ProSite: database of functional motifs, ie, biologically relevant short patterns
ProDom: a comprehensive set of protein domain families automatically generated
from the SWISS-PROT and TrEMBL sequence databases.
PROFsec (PHDsec): secondary structure,
PROFacc (PHDacc): solvent accessibility,
PHDhtm: transmembrane helices.
Sequence database is scanned for similar sequences (Blast, Psi-Blast).
Multiple sequence alignment profiles are generated by weighted dynamic
programming (MaxHom).
The PredictProtein meta-server
PredictProtein Demo
Let´s submit again
to http://predictprotein.org/
>uniprot|P00772|ELA1_PIG Elastase-1 precursor MLRLLVVASLVLYGHSTQDFPETNARVVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
For a list of mirror sites: http://predictprotein.org/newwebsite/doc/mirrors.html
Detailed results Summary view
Results
Documentation:• COILS: http://www.ch.embnet.org/software/coils/COILS_doc.html
• TMPred: http://www.ch.embnet.org/software/tmbase/TMBASE_doc.html
• MPEx: http://blanco.biomol.uci.edu/mpex/MPEXdoc.html
Articles: B. Rost: Evolution teaches neural networks. In Scientific applications of neural nets. Ed.
J.W.Clark, T.Lindenau, M.L. Ristig, 207-223 (1999).
D.T Jones: Protein Secondary Structure Prediction Based on Position-specific Scoring Matrices. J.Mol.Biol. 292, 195-202 (1999).
B. Rost: Prediction in 1D: Secondary Structure, Membrane Helices, and Accessibility. In Structural Bioinformatics (reference below).
Books: P.E. Bourne, H. Weissig: Structural Bioinformatics. Wiley-Liss, 2003.
A. Tramontano: Protein Structure Prediction. Wiley-VCH, 2006.
References •Skip this
Short peptide chain that directs the transport of protein
Peptide chain is located mostly in N or C-terminus
Targets in eukaryotes: ER, nucleus, nucleolus, mitochonrion, peroxisome
Bacteries use them to secrete proteins When one does not have the sequence
homology these still can tell the potential location of the protein => a hint to function
Signal PeptidesSignal Peptides
Challenge is to determine weak signal from the background noise
Various machine learning methods used Hidden Markov Models (HMM) Neural Networks
Most popular tool: SignalP http://www.cbs.dtu.dk/services/SignalP/
Prediction of signal peptidesPrediction of signal peptides
Tools that predict the cellular localization automatically
Wolf Psort: http://wolfpsort.org/ TargetP: http://www.cbs.dtu.dk/services/TargetP/
Prediction of cellular localizatio nPrediction of cellular localizatio n
http://www.signalpeptide.de/ Collection of the information on known and
predicted sign.peptide - protein pairs Allows search with sequence name and keywords Advanced search allows limitation of hits to single
species
This is useful when looking for extra information for the known protein
Signal Peptide DatabaseSignal Peptide Database