View
217
Download
1
Tags:
Embed Size (px)
Citation preview
Sequence Databases – 21 June 2007
Learning objectives- Be able to describe how information is stored in GenBank. Be able to read a GenBank flat file. Be able to search GenBank for information. Be able to explain the content difference between a header, features and sequence. Be able to say what distinguishes between a primary database and a secondary database. Be able to access and navigate the ENTREZ platform for biological data analysis.
BIOSEQs – entry common to all sequence databases
BIOSEQ = Biological sequence Central element in the NCBI database model. Found in both the nucleotide and protein databases
Comprises the sequence of a single continuous molecule of nucleic acid or protein. Entry must have At least one sequence identifier (Seq-id) Information on the physical type of molecule (DNA, RNA, or
protein) Descriptors, which describe the entire Bioseq Annotations, which provide information regarding specific
locations within the Bioseq
What is GenBank?
The NIH genetic sequence database, an annotated collection of all publicly available DNA sequences
Each record represents a single contiguous stretch of DNA or RNA
DNA stretches may have more than one coding region (gene).
RNA sequences are presented with T, not U
Records are generated from direct submissions to the DNA sequence databases from the investigators (authors).
GenBank is part of the International Nucleotide Sequence Database Collaboration.
General Comments on GBFF
Three sections: 1) Header-information about the whole record 2) Features-description of annotations-each represented
by a key. 3) Nucleotide sequence-each ends with // on last line of
record.
Nucleic acid (DNA or RNA (cDNA)) sequence translated to amino acid sequence is a “feature”
Genbank Flat File (MyoD1 as an example)
Feature Keys
Purpose: 1) Indicates biological nature of sequence 2) Supplies information about changes to
sequencesFeature Key Description
conflict Separate determinations of the same seq. differ rep_origin Origin of replication protein_bind Protein binding site on DNA CDS Protein coding sequence
Feature Keys-Terminology
Feature Key Location/Qualifiers
CDS 23..400
/product=“alcohol dehydro.”
/gene=“adhI”
The feature CDS is a coding sequence beginning at base 23 and ending at base 400, has a product called “alcohol dehydrogenase” and corresponds to the gene called “adhI”.
Feature Keys-Terminology (Cont.)
Feat. Key Location/QualifiersCDS join (544..589,688..1032) /product=“T-cell recep. B-ch.”
/partial
The feature CDS is a partial coding sequence formed by joining the indicated elements to form one contiguous sequence encoding a product called T-cell receptor beta-chain.
(For MyoD1 – Accession number X61655)
Record from GenBank
LOCUS SCU49845 5028 bp DNA PLN 21-JUN-1999
DEFINITION Saccharomyces cerevisiae TCP1-beta gene, partial cds, and
Axl2p (AXL2) and Rev7p (REV7) genes, complete cds.
ACCESSION U49845
VERSION U49845.1 GI:1293613
KEYWORDS .
SOURCE baker's yeast.
ORGANISM Saccharomyces cerevisiae
Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales;
Saccharomycetaceae; Saccharomyces.
Modification dateGenBank division (plant, fungal and algal)
Coding regionUnique identifier (never changes)
Nucleotide sequence identifier (changes when there is a changein sequence (accession.version))
GeneInfo identifier (changes whenever there is a change)
Word or phrase describing the sequence (not based on controlled vocabulary).Not used in newer records.
Common name for organism
Formal scientific name for the source organism and its lineagebased on NCBI Taxonomy Database
Locus name
Record from GenBank (cont.1)
REFERENCE 1 (bases 1 to 5028)
AUTHORS Torpey,L.E., Gibbs,P.E., Nelson,J. and Lawrence,C.W.
TITLE Cloning and sequence of REV7, a gene whose function is required
for DNA damage-induced mutagenesis in Saccharomyces cerevisiae
JOURNAL Yeast 10 (11), 1503-1509 (1994)
MEDLINE 95176709
REFERENCE 2 (bases 1 to 5028)
AUTHORS Roemer,T., Madden,K., Chang,J. and Snyder,M.
TITLE Selection of axial growth sites in yeast requires Axl2p, a
novel plasma membrane glycoprotein
JOURNAL Genes Dev. 10 (7), 777-793 (1996)
MEDLINE 96194260
Medline UID
REFERENCE 3 (bases 1 to 5028)
AUTHORS Roemer,T.
TITLE Direct Submission
JOURNAL Submitted (22-FEB-1996) Terry Roemer, Biology, Yale University,
New Haven, CT, USA
Submitter of sequence (always the last reference)
Record from GenBank (cont.2)
FEATURES Location/Qualifiers
source 1..5028
/organism="Saccharomyces cerevisiae"
/db_xref="taxon:4932"
/chromosome="IX"
/map="9"
CDS <1..206
/codon_start=3
/product="TCP1-beta"
/protein_id="AAA98665.1"
/db_xref="GI:1293614"
/translation="SSIYNGISTSGLDLNNGTIADMRQLGIVESYKLKRAVVSSASEA
AEVLLRVDNIIRARPRTANRQHM"
The 5’ end of the coding sequence begins upstream of the first nucleotide of the sequence. The 3’ end is complete.
There are three parts to the feature key: a keyword (indicates functional group), a location (instruction for finding the feature), and a qualifier (auxiliary information about a feature)
Keys
Location
Qualifiers
Descriptive free text must be in quotations
Start of open reading frame
Database cross-refsProtein sequence ID #
Note: only a partial sequence
Values
Record from GenBank (cont.3) gene 687..3158 /gene="AXL2" CDS 687..3158 /gene="AXL2" /note="plasma membrane glycoprotein" /codon_start=1 /function="required for axial budding pattern of S. cerevisiae" /product="Axl2p" /protein_id="AAA98666.1" /db_xref="GI:1293615"
/translation="MTQLQISLLLTATISLLHLVVATPYEAYPIGKQYPPVARVN. . . “ gene complement(3300..4037) /gene="REV7" CDS complement(3300..4037) /gene="REV7" /codon_start=1 /product="Rev7p" /protein_id="AAA98667.1" /db_xref="GI:1293616"
/translation="MNRWVEKWLRVYLKCYINLILFYRNVYPPQSFDYTTYQSFNLPQ . . . “
Cutoff
Cutoff
Another location
Another location
Record from GenBank (cont.4)
BASE COUNT 1510 a 1074 c 835 g 1609 t
ORIGIN
1 gatcctccat atacaacggt atctccacct caggtttaga tctcaacaac ggaaccattg
61 ccgacatgag acagttaggt atcgtcgaga gttacaagct aaaacgagca gtagtcagct . . .//
Primary databases vs. Secondary databases
Primary database comprises information submitted directly by the
experimenter. is called an archival database.
Secondary database comprises information derived from primary
database. is a curated database.
Types of primary databases carrying biological infomation
GenBank/EMBL/DDBJ
PDB-Three-dimensional structure coordinates of biological molecules
PROSITE-database of protein domain/function relationships. http://www.expasy.org/prosite/
Types of secondary databases carrying biological infomation
dbSTS-Non-redundant db of sequence-tagged sites (useful for physical mapping)Genome databases-(there are over 20 genome databases that can be searchedEPD:eukaryotic promoter database http://www.epd.isb-sib.ch/
NR-non-redundant GenBank+EMBL+DDBJ+PDB. Entries with 100% sequence identity are merged as one.ProDom http://protein.toulouse.inra.fr/prodom/current/html/home.php
PRINTS http://bioinf.man.ac.uk/dbbrowser/PRINTS/
BLOCKS http://bioinformatics.weizmann.ac.il/blocks/
RNA
cDNA
DNA protein
DNA databases derived from GenBankcontaining data for a single gene
•Non-redundant (nr)•dbGSS (genome survey sequences)•dbHTGS (high throughput)•dbSTS (sequence tagged site)•LocusLink
RNA (cDNA) databases derivedfrom GenBankcontaining data for a single gene•dbEST (expressed sequence tag)•UniGene•LocusLink
Protein databases derivedfrom GenBank containingdata for a single gene•Non-redundant (nr)•Swissprot•PIR (Int’l. protein sequence)•LocusLink
Secondary Databases
References for understanding the NCBI sequence database model
Here is the website for NCBI developer tools. http://
www.ncbi.nlm.nih.gov/IEB/ToolBox/SDKDOCS/INDEX.HTML