Super Power Gayatri-The Icon Deity of Demigods, Avataras

8/10/2019 Super Power Gayatri-The Icon Deity of Demigods, Avataras

1/52


2/52

CONTENTS

INTRODUCTION

CHAPTER 1

MOTHER OF VEDAS-MOTHER OF DEITIES IS

GODDESS GAYATRI

CHAPTER 2THE 3 LEGS OF GAYATRI BASED SPIRITUAL

PRACTICES

CHAPTER 3

GAYATRI SUPER POWER IS THE SUPREME ICON

DEITY OF THE 3 DEMIGODS


3/52

INTRODUCTION

In the science of worship and meditation with reference to science of

spirituality and religion Super Power Gayatri reigns supreme. There are

many reasons for this. One of the reasons is that in this Super Mantra in seed

form resides principles of human culture and sacred ideals. It can be called

the smallest text of 24 letters in the entire world. In it in a gist dwells wisdom

of religion and spirituality. While describing these 24 letters what is most

required for human progress and good management that itself is the Mantra

of divine intelligence and farsightedness. All problems in human life appearbecause of a vile brain. Daily in this world clouds of danger that manifest are

but a creation of salty ocean of vile thinking. Viveka or farsighted thinking

reigns supreme. In this world there is nothing more important than a sacred

brain. This fact makes the Goddess of divine intellect called Super Power

Gayatri supreme.


4/52

Gayatri is a sacred intellect. In this Super Mantra a prayer is made to

Almighty God for a sacred intellect. In its 24 letters 24 priceless messages

reside and they are symbols of a sacred intellect. In this teaching such

foundations dwell that by imbibing them one's viewpoint gets positively

transformed. Further that spiritual ignorance manifesting due to illusion gets

destroyed which is the root cause of strife and problems appearing in our lifeday in and day out. Creation of Super Mantra Gayatri has been done via

such a scientific foundation that by imbibing it secret energy centers dwelling

in it opens fully and in our psyche starts flowing the waterfall of piousness. In

Gayatri dwells extraordinary divine energy that can gather in the psyche

Prana Energy spread out in the cosmos via its intense magnetic power. Due

to all these reasons Gayatri is a sure shot method to destroy a vile intellect.

Definitely along with it other types of sorrow too get overcome. Goddess

Gayatri is an imperishable eternal light. Due to it the darkness of a vile

intellect gets warded off and the soul attains its natural state. It is for

attaining bliss in the sacred peaceful lap of purity personified mother earth

that it has arrived.

Man is the inheritor and prince of Almighty God. The soul is a part of the

divine cosmic soul or God. All qualities and grandeur of his divine father

dwell in man. The energy present in a flame torch is present in a spark of fire

too. Despite this we find that mankind is leading a very lowly stature of life.

Despite being potentially divine he lacks divine wealth.

God is truth manifest but we all his children are immersed in delusion. God

is divine consciousness whereas we humans are immersed in spiritual

darkness. God is divine bliss incarnate whereas we are immersed in sorrow

and face harassment. What is the reason for this state? It is a question worthpondering over.

When God's indestructible prince has come in this world akin to his divine

father's beautiful garden for merriment and sport then why is it that his life's

journey instead of being divinely blissful is filled with sorrow and poverty? It

is worth cogitating over this.

Fire is hot and illumined but when a burning coal starts cooling down ash

starts covering it. In this coal covered with ash the above 2 qualities cannot

be seen. Coal that has cooled down and is covered by ash is neither hot norillumined. It remains dark, ugly and a pile of ash. This lowly state of a

burning coal is that ash that has covered it from all sides. If this ash covering

it is removed fire dwelling within it starts blazing again and it now possesses

the qualities of heat and light.

Almighty God is Sat-Chit-Anand (existence-consciousness-bliss) in nature.

He oozes with divine bliss. His son (soul) hence too must be bliss personified.


5/52

While enjoying bliss of life in this divine garden he must experience bliss

only. It is the ash of a vile intellect that creates poverty and sorrow bang

opposite to the other by hiding this reality. Just as ash by covering coal fully

rests far away from its natural state in the same manner this vile intellect

hides the soul's state of purity, piousness and supreme bliss. As a result man

lives a life that is demeaning and poverty stricken.

It is this vile intellect that is none other than Maya, demonic nature and

spiritual ignorance. The more this covering covers man's mental arena to

that extent he remains sorrowful. The more dirt sticks to our body the more

we feel itchy and smell foul odor from it. The lesser this covering lesser is the

itchy feeling and foul odor. If in our body tainted foreign poison does not

gather no disease attacks it. But the more these distortions the more the body

becomes diseased. This vile intellect is like dirt gathering on the body or like

poisonous alien elements in the blood. And as a result of this itchy feeling,

foul odor, diseases and other type of discomforts like pain, worry, tension,

restlessness and harassment get created.

World humanity is sorrowful because of many hardships faced by them.

Some of them are pained by diseases, some are sad because of poverty and

the married life of many is stressful. Some are worried regarding their

children, their business accrues losses, advancement fails, suspicion lurks

regarding failure and there is fear with reference to court cases and enemy

attacks. Friends break each others' trust and hence are worried. Events of

breaking away from friends and relatives manifest. Such sorrow crops up

day in and day out. Just like ones personal life there is no dearth of strife in

the arenas of religion, spirituality, economic, social, political and

international. Even if a person is very cautious then too taints spread out insociety and mismanagement breaks apart their peace. Thus the goal of living

a life of bliss and peace is not achieved.

Sorrow could be personal or collective yet its cause is singular i.e. a vile

tainted intellect. In this world material means exist in such a big measure

that by playing with these 'toys' one's entire life can be lived joyously.

Humans possess priceless bodies, brains and sense organs. So much bliss can

be attained in more commonplace things and circumstances that in

comparison to it heaven seems lowly. But despite possessing all this people

are very sad and stressed out. There is no attraction of life, people pass time

waiting for death to engulf them. The mind and psyche daily are burning

with worry and tension, fear, demeaned state and restlessness. As a result

one has to endure strife similar to what is described in Indian Mythology

called Puranas.

This world is as beautiful as a painting. In it not even an iota of ugliness

exists. This world is a place for divine blissful sports. In it there is no place


6/52

for worries and fear of any sort. This life is a ceaseless stream of divine bliss.

In it there is no cause for undergoing sorrow. In this mother earth that is

more nectarine than even heaven dwell all principles that helps the bud

called the mind to bloom forth. The designing of this human body rare even

for demigods to attain has been created so beautifully that via its mere touch

it renders commonplace objects very beautiful. Almighty God's prince i.e.the living soul has arrived in this world to enjoy bliss. God has sent all

mankind here by giving them a chariot that is the body, servants in the form

of sense organs and a minister that represents the brain. Almighty God has

sent mankind in this world akin to heaven so that he can see its beauty and

taste nectar that pours from every pore of it. But it is this vile human brain

that has created obstacles in this great goal of God and rendering heaven into

hell.

Healthiness is our natural state. Illness is unnatural and this error gets

created. Birds and animals follow nature in a natural way. They do not fall

sick. They are always healthy and joyful. But man invites illness by eating,sleeping etc in an unnatural way. If man too follows nature's laws he shall

never fall ill. Similarly our sacred intellect too is natural. It has been given by

God, it is divine, it is there right from birth and a companion of our life. At

the time of sending us in this world God gives us Kamadhenu or wish

fulfilling cow or a sacred intellect so that man can attain all facilities and

joyous comforts. But we err, because we dwell in illusion due to spiritual

darkness by getting enmeshed in Maya or spiritual ignorance and

renouncing a pious intellect imbibe a vile tainted brain and by acting

unnaturally we invite illnesses. Similarly we invite a vile tainted brain. The

moment this witch comes all of life's situations become lopsided. Wherever a

vile tainted brain dwells there the human state reeks with chaos, worries,desires, lowliness, cowardice etc

If we don colored spectacles all objects appear colored. Of course! The

objects actually are not of that particular color. Despite this all objects and

our surroundings appear like the colored spectacles. By donning the

spectacles of a tainted intellect our brain gets deluded. It is hence that the

otherwise straightforward situations and incidences give us pain. The main

course of action of Super Mantra Gayatri is to awaken Ritambhara Prajna

or divine intellect after warding off a vile intellect. Added to this Super

Mantra Gayatri possesses one more specialty wherein in it there dwells the

confluence of word science and musical note based wisdom. No other Mantrapossesses it. Great Yogis interested in spiritual practices and men of

austerities have tested, applied and experienced it. On its basis they have

noted its comparative supremacy. By getting impressed with it they have

given a prime spot to Super Mantra Gayatri and its Super Energy.

Regarding this many descriptions can be found in holy scriptures:

Gayatrya na param mantra na bijam pranavadhikam.


7/52

Gayatrya na param japyam gayatrya na param tapaha.

Gayatrya na param dhyanam gayatrya na param hutam.

Havishyam ghritam sanyuktam gayatri mantra purvakam.

............................Vishwamitra Kalpa

Apart from Super Manta Gayatri there is no better Mantra. There is nothing

greater than it like Japa or Mantra chanting, austerities and meditation.

Apart from Gayatri Yajna there no superior Yajna.

Gaytri paradevateti gahita brahmaiva chidrupini.

............................Devyupanishad

Gayatri is called Paradevata or supreme than demigods. That consciousness

manifest Gayatri is noe other than Almighty God.

In the epic Mahabharat Bhishma Pitamaha says:

Param sidhimavapnoti gayatri mutamam pathet.

That person who chants the greatest Gayatri Mantra attains supreme Sidhi

or material and spiritual success.

Ashtadashasu vidyasu mimansati gariyasi.

Tatopi tarkashastrani puranastebhya ai vach.

Tatopi dharmashastrani tebhyo gurvi shrutirdwij.

Tatopyupanishacchreshtha cha tatodhika.

Durlabha sarva mantreshu gayatri prnavanvita.

.........................Brihat Sandhyabhashya

Amongst the 18 types of sciences Mimansa or Karmakand (rites and rituals)

is great. Logic and Viveka or farsighted discrimination are greater than

Karmakand (rites and rituals). The glory of Puranas or Indian Mythology is


8/52

greater than Nyaya scriptures. Vedas are superior than Puranas or Indian

Mythology and religious scriptures. The utility value of Upanishads that

describe the Vedas is greater than that of Vedas. Super Energy Gayatri is

greater than Upanishads. Amongst all Mantras Pranav or Om and Gayatri

together reign supreme.

Gayatrim yaha parityajya chanyamantramupasatey.

Na safalyamavapnoti kalpa koti shatairapi.

.........................Brihat Sandhyabhashya

Those who worship Mantras other than Gayatri Mantra they do not atain

desired success even after 100 million Kalpas.

Japatam juhyatam chaiva nityam cha prayatatmanam.

Rishinam paramam japyam guhya metannaradhipa.

........................Mahabharat

For ceaseless Japa or Mantra chanting and for doing fire rituals called

Havan great Rishis' supremely sacred Mantra is Gayatri.

Gayatri sarvamantranam shiromani taya sthita.

Vidhanamapi tenaitam sadhayetsarva sidhaye.

Trivyahriti yutam devimonkara yuga samputam.

Upasya chaturo vargana sadhayedyo na sondhakaha.

Devya dwijatwamasadhya hitwa chintamanim karat.

......................Brahmavartik

Amongst all Mantras and sciences Gayatri is a crest jewel. Via it all spiritual

practices can be done pertaining to our sense organs. That person who does

not attain Dharma, Artha, Kama and Moksha via this worship/meditation is

one who has a blind intellect. If a person does worship/meditation of other


9/52

Mantras even though Gayatri is accessible certainly is foolish. It is like

throwing away a touch stone that fulfills our desires and searches for other

less valuable jewels. Such a one is stupid.

Gayatri vedajanani gayatri lokapawani.

Na gayatryaha param japyametadvijnaya muchyatey.

......................Karma Purana

Gayatri the mother of Vedas is one that purifies the most in the entire world.

Great scholars opine that that there is no other greater Japa than Super

Mantra Gayatri.

Savitryastu param nasti shodhanam sarvakarma.

.......................Agni vridha chastambi

Nothing is better than Gayatri for sanctifying all actions.

Ashtadashasu vidyasu mimansati gariyasi.

Tatopi tarkashastrani puranastebhya ai vach.

Tatopi dharmashastrani tebhyo gurvi shrutirdwij.

Tatopyupanishacchreshtha cha tatodhika.

Durlabha sarva mantreshu gayatri prnavanvita.

...................Skandpurana Kashikhand (9/49/50)

In comparison to Mimansa scriptures, Tarka scripture is more important, in

comparison to Tarka scripture Purana scripture is more important, in

comparison to Purana scripture Tarka Dharma scripture is more important,in comparison to Dharma scripture Tarka Veda scripture is more important,

in comparison to Veda scripture Tarka Upanishad scripture is more

important and in comparison to Upanishad scripture Gayatri is more

important.

Kuryadanyannava kuryadanushthanadikam tatha.


10/52

Gayatri matra nishthastu krityakrityo bhavedwijaha.

........................Gayatri Mantra

Whether a Dwij carries out other Anushthans (rites) or not, whether he

worships and meditates or not, yet he becomes glorified if he worships andmeditates on Super Mantra Gayatri.

Saptakoti mahamantra gayatri prayakaha smritaha.

Adidevamupasantey gayatri vedamataram.

.......................Gayatri Kalpa

Amongst millions of Mantras the chief Mantra is Gayatri. It is worshiped

and meditated on by demigods like Brahma etc. it is Gayatri that is the root

of all Vedas.

Ityukta cha mahadevi mulaprakritirishwari.

Antardhanam gata sadyo bhaktya devairabhishtuta.

Tataha sarvey swargavan tu vihaya padapankajam.

Samyagaradhayamasurbhagvatyaha paratparam.

Trisandhyam sarvada sarvey gayatrijapatatparaha.

Yajnabhagadibhihi sarvey devim nityam sishevirey.

Na vishnupasana nitya vedenokta tu kutrachit.

Na vishnudiksha nityasti shivasyapi tathaiva cha.

Gayatryupasana nitya sarvavedaiha samirita.

Yaya vina twadhahapato brahmanasyasti sarvatha.

Tavata kritakrityatvam nanyapeksha dwijasya hee.

Gayatrimatranishnato dwijo mokshamvapnuyat.


11/52

Kuryadanyam na va kuryaditi praha manuhu swayam.

....................Devi Bhagwat (12/8/84 to 91)

Vyasji said:

At first Goddess gave directions and then disappeared from sight. After this

all demigods gave up their ego and spiritual ignorance and started

worshiping and meditation on that Supreme Divine Energy.

All of them got immersed in doing Gayatri Mantra chanting along with

Trikal Sandhya. They started giving Yajna portion. Worship and meditation

on Vishnu and Shiva is not permanent. Vedas say that Gayatri worship and

meditation is permanent. A Brahmin devoid of Gayatri is said to be a sinner

and he undergoes a downfall. No other worship and meditation method gives

good results like Gayatri. Only by doing Gayatri worship and meditationdoes one get Moksha or salvation. Such a one need not do any other type of

worship and meditation. Lord Manu has spoken similarly:

Ashtadashasu vidyasu mimansatigariyasi.

Tatopitarkashastrani puranastebhya eva cha.

Tatopidharmashastrani tebhyo gurvishrutirdwij.

Tatopyupanishachhreshtha gayatri cha tatodhika.

Durlabhasarvamantreshu gayatri pranavanvita.

Na gayatryadhikam kinchittrayishu parigiyatey.

Na gayatrisamo mantro na kashisadrishi puri.

......................Skandpurana

Amongst 18 sciences Mimansa is quite a huge science. Bigger than it is Tarka

science. Bigger than it is Puranas and bigger than it is Dharma science and

bigger than it is Shruti. O Dwij! Bigger than it is Upanishad and superior to

it is Gayatri. Nothing is more superior than it. Gayatri along with Pranav or

Om is rare amongst all Mantras. In Vedatrayi nothing is more supreme than

Gayatri. There is no Mantra greater than Gayatri. There is no Mantra

comparable to Gayatri and there is no city like Kashi.


12/52

Gayatri vedajanani gayatri brahmanaprasuha.

Gataram trayateyasmad gayatri tena giyate.

Vachyavachak sambandhogayatrayaha saviturdwayoha.

Vachyoso savita sakshad gayatri vachika para.

Prabhavenaivagayatryaha kshatriyaha kaushikovashi.

Rajarshitwaparityajay brahmarshipadamiyivan.

Samarthyam prap chatyucchairanyadbhuvanasarjaney.

Kim kim na dadyadgayatri samyagevamupasita.

Gayatri is the mother of Vedas. Gayatri gives birth to Brahmins because they

chant it and protect it. Hence it is called Gayatri. Gayatri and Savita

complement each other. God Savita is Vachya and Gayatri Para is its

Vachika. Due to the influence of Gayatri Kaushik (Vishwamitra) of

Kshatriya or soldier class became Brahmarshi from Rajarshi. Also he had

learnt the science of making buildings. Man can attain just about anything

by doing Gayatri meditation and worship.

In comparison to other Mantras Gayatri reigns supreme and it is also said

that by worshiping only one Beej or seed one gets benefit of studying Vedas.In comparison to other Mantras one cannot negate Gayatri's supremacy.

Following is the proof of this:

Sarvesham japasooktanamruchancha yajusham tatha.

Samnam chaikaksharadinam gayatri paramo japaha.

..................Vridha Parasher Smriti (4/4)

In Vedas there are so many types of worship-meditation, Mantras, Japa,

Sookta, Omkar etc and in comparison to them Gayatri reigns supreme.

Ashtadashasu vidyasu mimansatigariyasi.

Tatopitarkashastrani puranastebhya eva cha.


13/52

Tatopidharmashastrani tebhyo gurvishrutirdwij.

Tatopyupanishachhreshtha gayatri cha tatodhika.

.....................Skandpurana, Kashi Khanda (1/49-50)

Amongst 18 sciences Mimansa is quite a huge science. Bigger than it is Tarka

science. Bigger than it is Puranas and bigger than it is Dharma science and

bigger than it are Vedas. O Dwij! Bigger than it is Upanishad and superior to

it is Gayatri.

Sarvesham japasooktanamrichanch yajusham tatha.

Samnam chikaksharadinam gayatri paramo japaha.

Tasyashchaiva tu omkaro brahmana ya upasitaha.

Abhyastu paramam japyam trailokyepi na vidyatey.

.................Brihat Parasher Samhita

Amongst all Sooktas Rigveda, Yajurveda and Samaveda and everything else

like Pranav etc Gayatri is said to be supreme. Brahmaji had meditated onthat Omkar which is a part of it. There is nothing in the 3 worlds that is

worth chanting than these 2.

Puranam samhitashastram smritishastram tathaiva cha.

Gayatryaha parmeshani sadaartham brahmasammitam.

The true meaning of Puranas, Samhita science and Smriti scriptures is

offered by Brahman.

Sangashcha chaturovedanadhityapi savangayat.

Savitrim yo na janati vrutha tasya parishramaha.

...................Yogi Yajnavalkya


14/52

Even if one studies all Vedas along with Ang and Upang yet if he does not

know Gayatri his efforts go in vain that must be undestood by us.

Gayatrim chaiva vedanshcha tulayam samatolayat.

Veda ekatra sangastu gayatri chaikataha smruta.

................Brihad Yogi Yajnavalkya (4/80)

When Brahma the creator placed the 4 Vedas in one pan of a weighing scale

and Gayatri in the other pan, he noted that Gayatri was much heavier than

the Vedas.

Over here the essence is that while comparing the mother and her children

the glory of the mother is much more. Keeping in mind all these specialties

Gayatri is said to bestow the 4 fruits viz. Dharma, Artha, Kama and Mokshaand that it wards off our sins, sorrow, harassment etc. Spiritual practices

pertaining to it is said to be supremely great.

Maharshi Vyas says:

Gayatrayeva tao yogaha sadhanam dhyanamuchyate.

Sidhinam sa mata maata nataha kinchid brihataram.

.............................Skand Purana

It is Gayatri that is penance, Gayatri is Yoga and Gayatri is the biggest

meditation and spritual practices. There is no other spiritual practice that

gives such type of success.

Lord Manu too has concluded thus:

Saivitryastu parannasti

...................Manu (2/3)

Gayatri is supremely great. There is nothing greater than it.

In Manu Smriti text that great spiritual philosophy and worship-meditation's

deep import has been written about at every step of it.


15/52

Japyenaiva tu sansidhyed brhmano natrasanshayaha.

Kuryadanyannam va kuryanmaitro brahman uchyate.

...................Manu (2/87)

Gayatri worship-meditation is said to be the substratum of all Sidhis.

Whether a Gayatri devotee executes other Anushthans or not yet by

behaving in a friendly manner with all he attains Brahman. This is because

due to his Mantra chanting his psyche becomes sacredly pure like Brahman

or divine cosmic consciousness.

Purvam sandhyam japanstishthetsavitriyamarkadarshanat.

Paschimam tu samaseenaha samyagrihakshavibhavanat.

...................Manu (2/10)

O beloved son! In the morning before the sun rises a devotee that stands and

does Mantra chanting and in the evening till the stars are seen in the sky he

sits to do Japa or Mantra chanting attains both material and spiritual

grandeur.

Apam samipey niyato naityakamvidhimasthitaha.

Savitrimpyadhiyati gatwaranyamsamahitaha.

...................Manu (2/104)

By doing meditation-worship on Gayatri seated on the shore of a lake in a

jungle far away from noisy cities one attains mental concentration and

benefit of untold peace.

Gayatri matra saropi varamvipra suryantrataha.

Nayantritastrivedopi sarvanshi sarvavikriya.

...................Manu (2/118)

A self controlled person doing Gayatri worship is greater than a Veda

chanting Brahmin eating everything and selling off all.


16/52

Etadaksharmetam cha japan vyahriti purvikama.

Sandhyorvedavidvipro veda punyena yujyate.

...................Manu (2/78)

A self controlled person doing Gayatri worship at dawn and dusk along with

Omkar and Vyahriti attains Vedic wisdom automatically.

Yodhitehanyahanyetam trini varshanyatandritaha.

Sa brahma parambhyeti vayubhutaha khamamurtimana.

...................Manu (2/82)

That devotee who without lethargy continuously and regularly for 3 years

does Gayatri Mantra chanting understands very well consciousness that

resides in air and cosmic space and attains the credentials to attain Almighty

God (Self or God Realization).

In the Bhagwad Geeta (10/35) it is said:

Gayatri chhandasamaham

Amongst Chhandas (poetic meter) I (God) am Gayatri Chhanda.

Gayatri paradevateti gadita brahmaiva chidrupini.

........................Gayatri Purashcharan

Gayatri is the supremely great deity and it is also said that it is divine

consciousness manifest Brahman.

Gayatri va idam sarva bhutam yadidamkincha.

.....................Chandogya Upanishad

This entire cosmos is Gayatri manifest.

Gayatri pratyagbrahmaikyabodhika.


17/52

....................Shankar Bhashya

Gayatri connotes direct wisdom of non dual Brahman (God).

In scriptures and Puranas or Indian Mythology there are many examples of

such proofs given above wherein Gayatri is called the mother of IndianCulture and supreme icon deity worth worshiping. Not only this but that

those not worshiping Gayatri are rebuked. The above mentioned proof is

very important. As long as it was imbibed our country India was a crest

jewel from both the material standpoint. When Super Power Gayatri was

ignored later our country's foundation experienced a downfall. In order to

strengthen it, it is mandatory that Gayatri devotion spreads out in the entire

world.

CHAPTER 1

MOTHER OF VEDAS-MOTHER OF DEITIES IS

GODDESS GAYATRI

Gayatri is called the mother of Indian Culture and Yajna is called IndianReligion's divine father. It is called mother of Vedas, mother of deities and

mother of the entire cosmos. Right from the Vedas to religious scriptures all

divine knowledge is said to be the amplification of Gayatri's seed letters.

Yoga practices and energy streams of austerities have emerged from

Himalaya Mountains in the form of Gayatri. The great results of its spiritual

practice bestows on us Amrit or immortal nectar, Kalpavriksha or the wish

fulfilling tree, Kamadhenu or the wish fulfilling cow and divine bliss. These


18/52

are 5 boons given by 5 chief deities. Because of this mystery its one form is

created with 5 faces. In Super Energy Gayatri reside hidden, material

powers and infinite storehouse of soul based glories. The theory of attaining

Sidhis via spiritual practices can be directly perceived by doing Gayatri

worship systematically. Even in material world dire situations it proves to be

a great boon. This primordial energy Mother Gayatri if taken recourse tonever does one experience hopelessness.

Gayatri Mantra has 24 alphabets or letters. Spiritual seers had identified

that divine energy residing in seed form in these letters that are known as 24

Avataras, 24 Rishis, 24 energy streams and 24 Sidhis or Divine Powers. With

the help of worship-meditation on it Devarshi, Brahmarshi and Rajarshi

attained a high status.

Anoraniyan mahato mahiyan

This itself is a Super Power. Gayatri Mantra is a small body made from 24

alphabets or letters. In it a full storehouse of knowledge and wisdom. There

is nothing in this cosmos which does not dwell in Gayatri. Its high stature

spiritual practices are quite difficult and special in nature but alongside it is

straightforward too that in any situation it can be successfully with ease. It is

hence that everyone without exception can use it and is universal in nature.

Women, men, children or senior citizens and without communal differences

can worship it and based on their faith in it they can accrue benefits.

The 4 Vedas have been created in the form of description of the 4 legs of

Gayatri. Hence it is called Mother of Vedas. For description of Jnana ordivine wisdom other scriptures and Puranas have been created. Indian

Spiritual Philosophy and knowledge-wisdom are manifestations of the seed in

the form of Gayatri. With the help of its worship-meditation and devotion

great citizens of ancient India had become akin to deities and hence Gayatri

is called Mother of Demigods too.


19/52

CHAPTER 2

THE 3 LEGS OF GAYATRI BASED SPIRITUAL

PRACTICES

THE METHOD OF RENDERING THE BODY, MIND AND SOUL VERY

STRONG:

Gayatri is called Tripada or 3 legged. It is believed that this Tripada energy

has spread everywhere and is described in the form of 3 bodies, 3 worlds, 3

Gunas, Traitbrahma, 3 deities, 3 energies and 3 Kalas (time). Its 3 fruits or

results are immortal nectar, touch stone and the wish fulfilling tree. Spiritual


20/52

seers have told us about the 3 boons and 3 blessings of Tripada. In these 3

reside material wealth and spiritual grandeur. In the Atharvaveda 7 fruits

have been described viz. life span, life force, children, animals, fame, wealth

and Brahmavarchas or divine aura and these are found in the periphery of

immortal nectar, touch stone and the wish fulfilling tree.

Everyone wishes that grandeur in the realms of Adhibhautik, Adhidaivik

and Adhyatmik increases and that lack of any type and obstacles are warded

off. All facilities and comforts dwell in this periphery. Difficulties maybe

many but in reality they come in the realms of Adhibhautik, Adhidaivik and

Adhyatmik. These are symbolically called immortal nectar, touch stone and

the wish fulfilling tree. Scriptural seers say that these 3 divine glories are

attained due to the divine grace of Goddess Mother Gayatri. Those people

that possess ethically earned prosperity and ooze with sacred qualities are

called deities. Divinity is conjoined to habits and inner nature and not to

external appearance. It is tested via inner qualities, activities and nature.

Demigods dwell in heaven. It can also be said that wherever demigods dwellthere the atmosphere becomes heavenly.

Gayatri is called the presiding deity of heaven. One more name of her is

Kamadhenu or the wish fulfilling cow. By drinking its milk demigods attain

divinity. There are 3 streams of joyous comforts of demigods. They are:

Immortal nectar, touchstone and wish fulfilling tree. With the help of

immortal nectar demigods get Adhyatmik grandeur, with the help of the

touchstone they get Adhibhautik grandeur and with the help of the wish

fulfilling tree they get Adhidaivik grandeur. It has been said that via

devotion to Tripada Gayatri it is possible to attain all 3 grandeurs.

Immortal nectar is that matter that on drinking it a person becomes

immortal. Old age and death leave such a person forever. They remain young

all the time and their psyche drips with bliss and zest. It is believed that

immortal nectar rests in heaven. Demigods are known to drink it. Those

benefits accrued by demigods in heaven are attained by a Gaytri devotees.

The existence of matter like immortal nectar is not found in earth where

living beings dwell. On earth everything takes birth, they grow and change

too. It is due to growth that youth and old age arrive. Transformation and

death are nothing but that which has become old is created again. This

natural creation's cycle goes on and on.

It is the physical body that becomes old and then dies. Lest we accept that

our existence is not the body but is the soul then definitely one experiences

that he is deathless and immortal. Even children are overjoyed to remove old

clothes and wear new clothes instead. Hence how can a God or Self Realized

person undergo fear of death? Right since time immemorial to the end it

remains youthful. It never undergoes childhood or old age. Sorrow and lack


21/52

too give pain to the body but via Gayatri meditation-worship one gets

inspiration, direction and facility to attains immortality. It is hence that it is

called Kamadhenu or wish fulfilling cow. It is said that Kamadhenu is

immortal in nature. Demigods on drinking it become glorified. By drinking it

bad sentiments stay far away. No qualities like envy, anger and revenge are

seen. As a result one is saved from selfish desires and lack of peace. AGayatri devotee always oozes with bliss, zest and enthusiasm.

This immortality or Amaratva and divinity are synonymous. In comparison

to human beings demigods are said to be more powerful, prosperous and

contented. It is the principle of deities to desire to give beneficial things and

continue doing so. People drinking the nectar of God or Self Realization are

never greedy to use things for themselves. Whatever they get they prefer to

give it away to those in need. Hence even if things are less the soul is

completely self fulfilled. It has no desire or wish to attain anything. If we get

true experience of it the face always exhibits contentment and peace. Such

people all called Jivanmuktas or liberated while alive. They are termeddeities of earth and in the areas they contact they create an environment of

heavenly bliss. These are the signs of people attaining immortality.

Paras or touchstone is that if touched a black, ugly and cheap metal like iron

turns into gold or we can say that it becomes a metal that is beautiful,

expensive and ever shining. The so called existence of Paras is suspicious. Till

date none have attained it yet the Paras of spirituality in the form of honest

effort dwells in this world for a great length of time. Those touching it

overcomes life full of poverty, rushes ahead with speed and reaches the peak

of development.

The first step regarding efforts is mental in nature. They are identified as

creative inner potentials like power of resolve, daring, hope, zest etc. Its

second step can be seen by our eyes in the form of alertness and zeal.

Lethargy and indolence are wicked demons that curse us with backwardness.

When a person gets attacked by them he leads a demeaned regressive life of

poverty and lowliness of the soul. Over and above lethargy and indolence is

the third demon in the form of lack of self control.

When the touchstone of effort is imbibed by the inner self they after kicking

the taint make a resolve to shoo them away. The state of inertness and semiconsciousness is shaken up in order to ward it off. It creates a new way of

living life. Sacred ideals are neo created. This inner transformation that is

ushered in by efforts is called the touchstone of supremacy, advancing

enterprise and a strong will power. Wherever it manifests there diseased

state, weakness, poverty, sadness etc run far away.


22/52

Gayatri means one that protects our Prana or vital force. 'Gaya' means

Prana or vital force and 'Tri' means one that protects us. Prana or vital force

connotes effort. When inner enterprise and practical hard work combine so

as to use it for high stature great goals then in every realm its miraculous

results can be noted. The touchstone is given due importance because by

overcoming the lowliness of iron into greatness of gold. Efforts of thespiritual touchstone plays a similar role. Via Gayatri devotion one gets divine

light and daring gets awakened. Keeping this in mind one can say that this

inner transformation has found a touchstone called Paras. No doubt

symbolism rests in it but there is no place for overstatement here.

A pure sacred inner personality is believed to be like a Kalpavriksha or a

wish fulfilling tree. Kalpavriksha is found in heaven. It is said that those who

sit beneath it and makes a wish, it gets fulfilled. From the symbolic

standpoint it is but a description of a pure sacred inner personality. Gayatri

is called the Goddess of a sacred radiant intellect. If she is worshiped

properly God gives that devotee the boon of a sacred radiant intellect. Thefirst influence of this boon is seen in the form of a pure sacred inner

personality. Those who reap such success they must understand that they

have attained the good fate of sitting under the Kalpavriksha or a wish

fulfilling tree and attaining what he wishes for. Demigods are desire free. All

their desires get fulfilled o their own. They never have to endure the burden

of hardships. Such a glorious inner state is called Sidhi (success) of

Kalpavriksha or a wish fulfilling tree.

Man's requirements are very less. His stomach is small and the combined

production of this hands and brain is so much more that in a short time and

efforts his physical bodily needs get fulfilled easily. If the lifestyle of Indiansis adhered to and one remains content in accruing apt nutrition for his family

then the burden on his head full of unnecessary desires shall not increase any

longer. In order to fulfill then correct or wrong means shall not be taken

recourse to. No longer need one get worried every day. Requirements get

fulfilled by ones efforts. The net of mental desires is nothing but increasing

wrong desires and remaining restless to immediately fulfill them. That for

which unruly people each moment remained stressed and fall at the feet of

gods and goddesses for such selfish desires, people with divine intellect stay

far away from them. By taking recourse to a pious intellect, by limiting their

desires, by making efforts for that which is apt they march ahead in life with

fair ease. It is easy for such people to remain desire free and get joy whilesitting under the Kalpavriksha or a wish fulfilling tree. In a nutshell we must

accept that a pious intellect itself is a Kalpavriksha or a wish fulfilling tree.

The root aim of Gayatri devotion exactly is this. The more one gets its

blessings the more one gets benefits of the touchstone-Paras, immortal nectar

or Amrit and wish fulfilling cow or Kamadhenu. Thus by leading a life of

demigods despite dwelling in the human body they attain bliss of heaven and

Moksha or salvation.


23/52

Gayatri is called soul power and Divine Wisdom. It is comparable to a pot of

immortal nectar. Super Mantra Gayatri oozes with soul welfare and the

substratum and guidance for attaining God vision. Those devotees that

imbibe it drink immortal nectar and in the true sense of the term become

deathless and immortal like deities. It is hence that it is called a pot of

immortal nectar.

The fourth name of Gayatri is wish fulfilling cow or Kamadhenu and the

fifth is Brahmastra or divine weapon. Wish fulfilling cow or Kamadhenu

means giving nourishment like a loving mother, development and the boon of

both material and spiritual prosperity. Brahmastra or divine weapon means

by throwing it downfall, dire situation and obstacles get powdered to pulp

and thus get warded off. Anyone that truly takes recourse to Gayatri has to

the last letter experienced those Richas or verses of Atharvaveda wherein

Super Energy Gayatri is said to bestow the boon of a long life, vital or life

force, performing feats, children, cooperative family, sacred fame, means,

grandeur and Brahmavarchas or soul energy.

In the 24 alphabets of Super Mantra Gayatri that is sacred wisdom's

presiding deity and concrete Ritambhara Prajna or Divine Wisdom rests the

gist of rendering high in stature mankind's thinking process and character.

In the spiritual practice of this Super Energy all foundations, directives and

methods of Yoga practices and austerities are known to reside. With its help

those undergoing its spiritual practices attain apt benefits of Ridhi-Sidhis or

material and divine powers. In order to attain heaven and salvation that is

the high stature of soul progress taking help of the root basis of Gayatri's

philosophy is incomparable.

Every human being adhering to spirituality must definitely take help of

Gayatri. As per Indian religion and spirituality Sandhyavandan is included

in daily worship and devotion. In Sandhya method the spot enjoyed by

Gayatri is like the spinal cord of our body. Indian religion has 2 symbols

wherein one is Shikha or pigtail and other is Sutra (Yajnopaveeta) or sacred

thread. Both are images of Gayatri. There is a tradition of hoisting the flag of

Gayatri's divine wisdom on the highest peak of the head and wearing on the

shoulder Gayatri Mantra's 9 words i.e. 9 threads and 3 Vyahvrittis

represented by 3 knots called Yajnopaveeta or the sacred thread. The brain

is the basis of knowledge and body that of actions. Both in the form of Shikha

or pigtail and other is Sutra (Yajnopaveeta) or sacred thread Gayatri has

been reinstated. Rishi texts direct that the management and usage of both

must be executed as per inspirations residing in the 24 alphabets of Gayatri.

The name of Gurumantra has been given as Gayatri. When studies and

Vedic studies, Sutra (Yajnopaveeta) or sacred thread etc Sanskaras

commence Gayatri initiation is given. Other Mantras are called Deva,

Sadhana, Sampradaya etc Mantras but the beginning less Gurumantra is

Gayatri only. This very Gurumantra was given to Lord Rama by Guru


24/52

Vasishtha and Lord Krishna was given the same by Rishi Sandipan. Via

Maharishi Vishwamitra Lord Rama attained Bala Atibala energies by doing

spiritual practices of it. Maharishi Vishwamitra too became a Brahmarishi

from a Rajarshi via the above effect.

LORD MANU says that there is no other Mantra apart from Gayatri thatcan make us purer. One can attain Almighty God if one regularly does

Gayatri Japa or chanting for 3 years continuously. Those Dwijas that do

Gayatri Japa or chanting in 3 or Trikal Sandhya attains the fruit of studying

the Vedas. Whether one does any other spiritual practice or not but if one

chants Gayatri only one attains Sidhi or material and spiritual success. A

devotee that chants Gayatri 1000 times daily gets liberated from sins akin to

a snake shedding its old skin. That Brahmin failing to do Gayatri Japa or

chanting is rebuked.

SHANKH RISHI opines that Gayatri saves those who have fallen in the

ocean of hell by catching hold of their hands. Nothing is more supreme thanit in heaven and earth. One that knows Gayatri definitely attains heaven.

MAHARISHI VYAS says that just as honey is the essence of flowers, Ghee or

clarified butter is the essence of milk so too Gayatri is the essence of all

Vedas. If one succeeds (Sidhi) in Gayatri practices it becomes akin to the

wish fulfilling cow or Kamadhenu. River Ganga purifies our body and

Gayatri manifest Divine Ganga purifies our soul. One who ignores Gayatri

and takes up other spiritual practices is like one giving up a delicious cake

and becoming a foolish poor beggar. Nothing is more supreme than Gayatri

if we wish to attain success and reap rich dividend by doing penance.

BHARADWAJ RISHI says that Brahma and other deities too performed

Gayatri worship-meditation. It bestows God or Self Realization. Because of

Gayatri the vile qualities of those who act unethically get destroyed. A person

devoid of Gayatri is more impure than a lowest caste Shudra.

NARADJI says that Gayatri is Bhakti or devotion manifest. It is beyond

doubt that wherever Gayatri or Bhakti manifest dwells there Lord Narayana

too resides.

VASHISHTHAJI opines that if a person whose IQ is very low, who walks ona tainted path and one without sharp brain skills does Gayatri Mantra

chanting he attains a high status due to its positive influence. Later post

death he attains higher divine worlds. Those with sacred qualities and in a

balanced manner does Gayatri worship attains soul benefits.


25/52

GAUTAM RISHI says that the fount of Yoga is Gayatri. It is via Gayatri

that other Yoga practices are executed.

MAHARISHI UDDALAK says that Almighty God's terrific divine aura

dwells in Gayatri. Those who imbibe this aura his prosperity becomes

unlimited.

DEVAGURU BRIHASPATI opines that the primordial creator of divinity

and immortality is Gayatri. After attaining it nothing else remains to be

attained.

SHRINGI RISHI says that the primordial source of knowledge and science is

Gayatri. Nothing is greater than it in this cosmos.

CHARAK RISHI opines that those who while observing celibacy do Gayatri

worship and devour fresh Amla fruit lead a very long life.

YOGIRAJ YAJNAVALKYA tells us that Gayatri and Vedas with 6 parts

were placed in the 2 pans of a weighing scale. Know that Gayatri was

heavier. The gist of Vedas are Upanishads and the gist of Upanishads is

Gayatri along with Vyahritis. Gayatri is the Mother of Vedas and destroys

our sins. There is no other Mantra in heaven and earth apart from Gayatri

that renders us more sanctified. There is no other pilgrim spot like River

Ganga, there is no other demigod than Keshav and similarly there is no other

Mantra more supreme than Gayatri and in future too it will remain thus.

One who understands Gayatri becomes the knower of all knowledge,

spiritual and highly learned. If a Brahmin does not daily worship Gayatribut is a knower of Vedas know he is like a low caste Shudra. All his hard

effort goes down the drain. A person ignorant of Gayatri strays far away

from true Brahmin hood and becomes sinful instead.

PARASHER says that amongst all Japa or Mantra, Suktas and Vedic

Mantras Gayatri is supreme. When Vedas are compared to Gayatri the

latter's weight age is infinitely more. By doing Gayatri Japa devotedly one

attains Moksha or salvation and one gets purified both within and without. If

a person studies Vedas, scriptures, Puranas and Itihas but is without Gayatri

one must not call him a Brahmin.

ATRI MUNI says that Gayatri purifies and sanctifies the soul. Due to its

divine influence very intense taints and vileness get destroyed. That person

who understands the principle of Gayatri very well does not require any

other joy in this world.


26/52

The opinion of all Rishis is one as described above. This proves that any

Rishi may harbor difference of opinion regarding other topics but for

Gayatri they all had equal faith. All of them in their spiritual practices gave

1st spot to Gayatri. There are thousands of verses in scriptures, texts,

Smritis, Puranas etc that throw light on Gayatri's greatness and spiritual

practices. If all these are collected a huge Gayatri Purana can be made.

Spiritual great men of the 20th century too have accepted the importance of

Gayatri just like Rishi-Munis of ancient eras. Today's era is that of high

intellect, logic and proof.

MAHATMA GANDHI used to say that Super Mantra Gayatri is useful for

curing diseases and soul advancement too. If with a cool calm psyche Gayatri

is chanted all dire situations get warded off.

LOKMANYA TILAK says that Indian citizens have been enmeshed in many

types of bondages. It shall not go away simply via political struggle. For it the

soul shall have to be illumined and as a result what is right and wrong shall

become clear. Thus people shall give up the tainted path so as to walk the

path of true greatness.

MADANMOHAN MALVIYAJI the great man had said that amongst the

priceless jewels given to us by great Rishis of yore the jewel of Gayatri

Mantra is much more beautiful. Due to it the intellect gets purified and God's

divine light illumines our soul. With the help of this light so many souls have

been liberated from material bondage. Gayatri possesses the power to elicit

faith in Almighty God. Along with this it wards off material lack too. ThatBrahmin who does not daily chant the Gayatri Mantra is at fault because he

has given up his religious duties.

RABINDRANATH TAGORE says that there is a Mantra that awakens

entire India and it is so easy that in one breath it can be chanted. And that

Mantra is called Gayatri. In practicing this Mantra there is no place for dry

arguments and difference of opinion.

YOGI AUROBINDO GHOSH at many places has directed regarding

Gayatri. He has shown that Gayatri possesses such divine energy that can

execute important tasks. With reference to spiritual practices he ordainedmany to chant Gayatri Mantra.

SWAMI RAMKRISHNA teaches us thus:


27/52

I tell people that there is no need to do long term spiritual practices. Instead

do this small spiritual practice of Gayatri. By chanting Gayatri Mantra one

attains huge Sidhis (success). This Mantra is small but its power is limitless.

SWAMI VIVEKANANDA says that one must ask for something from a king

that is equivalent to his glory. It is most apt to ask for a pious intellect fromAlmighty God. When God is pleased with us he bestows on us a pious

intellect. A pious intellect shows us the true path of life and via sacred

activities all types of happiness are attained. Those that advance on the path

of great activities never lacks any type of joy. Gayatri is a Mantra of a pious

intellect and hence it is the crest jewel amongst all Mantras.

ADI GURU SHANKARACHARYA informs us that it is beyond the capacity

of humans to describe the greatness of Gaytri. To possess a pious intellect is

such a great thing that it cannot be compared to any other task of this world.

That divine intellect which gives divine sight to attain God or Self Realization

gets inspiration from Gayatri. The latter is the primordial Mantra. It hasincarnated as an Avatar to destroy our sins and augment gentlemanliness.

SWAMI RAMTIRTHA has said that the biggest task is to attain Lord Rama.

The aim of Gayatri is to overcome desires and attain Rama. Only those

whose intellect is sacred attains God. Gayatri all the time says that the

intellect should be so sacred that it feels Lord Rama to be greater than

worldly desires.

MAHARISHI RAMAN teaches that in Yoga Sciences Mantra Science is very

powerful. Due to Mantra energy extraordinary success is attained. Gayatri issuch a Mantra that with its help one can attain both material and spiritual

prosperity.

SWAMI SHIVANANDA opines that if one does Gayatri chanting at

Brahmamuhurat (4 am to 6 am) the psyche and heart become sacred, the

body becomes very healthy and the character becomes humble. Since the

brain becomes subtle it attains farsightedness. Ones memory power evolves

very well. In trying times via Gayatri one gets divine help. Via this one can

attain God or Self Realization.

T SUBARAO the renowned Self Realized person from Southern India saysthat Gayatri is the divine nature of Lord Savita Narayana. Since it is

Primordial Energy it is called Gayatri. In the Bhagwad Geeta scripture it is

described as 'Adityavarna'. The very 1st part of Yoga practices is to do

Gayatri devotion.


28/52

SWAMI KARPATRI says that those who have the credentials for Gayatri

must daily and regularly chant it. For Dwijas Gayatri Japa or chanting is

very important.

SWAMI VIDYANANDJI who used to give discourses on the Bhagwad Geeta

scripture says that Gayatri sanctifies our intellect. In life there is no greaterbenefit than a sanctified intellect. Hence it is the mother of a real big benefit.

DR RADHAKRISHNAN says that if we cogitate over the universal prayer of

Gayatri we shall get proof of how it truly gives great benefits. Gayatri is a

prayer that starts a stream of a new life in us.

MAHATMA SARVADANANDJI a member of Arya Samaj says that right

since world creation the Lord has been worshiped via Gayatri. SWAMI

DAYANANDA too as per this tradition has said that we must do

Sandhyavandan and study the Vedas. By doing this our psyche gets

sanctified and because the intellect becomes pure human life becomes

beneficial for both oneself and others too. The more one harbors faith and

trust in such sacred activities to that extent spiritual ignorance and other

such harassments get destroyed. That devotee who does Gayatri Mantra

chanting with devotional love and with regularity for him it is a boat that

helps him cross over the sea of material bondage and a road to attain Soul

Divine Wisdom.

SWAMI DAYANANDA the founder of Arya Samaj was a devoted follower

of Gayatri with total faith. Swamiji told the King of Gwalior that Gayatri

Purashcharan is indeed much greater than a Shrimad Bhagwat Saptahdiscourse. He had shown the correct method of Gayatri chanting in Jaipur to

Sachidananda, Hiralal Rawal, Ghodal Singh etc. Before commencing a

discourse in Multan he chanted the Gayatri Mantra and he also said that this

Mantra is supreme amongst all other Mantras. The root of all 4 Vedas is

Gurumantra Gayatri and right since creation of this world Rishis-Munis

have continuously chanted it. Swamiji had conducted its Anushthan at many

places. In it around 40 Brahmins were called. This Japa or Mantra chanting

continued for 40 days.

Prof R Srinivas a high stature member of Theosophical Society said that in

the thinking trend of Hindu Religion Gayatri Mantra is most powerful thanothers. Its connotation is very farsighted and is full of mysterious import.

This Mantra has many meanings. Its effect on people with varied mindsets to

is different. In it one can notice a power to gather together all visible and

invisible, high and low, humans and demigods etc with a mysterious cord.

When a devotee having credentials to execute Gayatri Mantra chanting does

it by understanding its mysterious import, concentrating the mind and heart

and chants it with pristine purity it establishes a bond with the great


29/52

conscious energy dwelling in the sun. Wherever such a person chants this

Mantra there on himself and in the nearby surroundings a cosmic spiritual

effect manifests itself. It is this divine effect is a great spiritual blessing. It is

therefore that our ancestors prayed for this incomparable power to Gayatri

Mantra.

In the above quotes right from Vedas-Upanishads to great saintly people

have in unison accepted that in Gayatri resides all principles that by

sanctifying a person's inner foundation he is made happy and well advanced

both materially and spiritually. One sided progress never lasts long. This

Super Mantra Gayatri possesses extraordinary specialties. Only that Yoga

can said to be complete if it ushers in well being from the standpoint of

individual needs to social needs, this world and the next etc. All such

teachings dwell in Gayatri worship-meditation. Almighty God divinely

wishes that along with an individual's advancement both entire society and

the world reach peaks of glory. This process is fulfilled by Gayatri worship-

meditation.

In this world 2 energies are at work. One is conscious and the other is inert.

Inert objects appear steady but within it too movement exists. If we see

superficially sand, mountains, lake etc are steady but in it creation, growth

and changes take place. If it is seriously taken note of one can clearly see all

creatures think and do something or the other daily for their activities.

Similarly matter's visible and invisible mobility can shake up the world. The

cosmic macrocosm like earth, innumerable planets and stars with great

speed move on their axis and elliptical path. Due to their magnetic pull they

all are bound to each other. Not only this but that in their inner area strange

movements occur swiftly. To matter is conjoined mobility in an inseparablemanner. It is hence that their existence remains untarnished. Matter has

been created due to terrific activity and hence objects get created and

changed too. This mobility of matter/objects is called Apara Prakriti.

The atom is the smallest unit of objects. Its combined and gigantic

humungous form is the cosmos. This inert energy has so far been studied a

bit but it is not possible to describe consciousness in the same way. But

because of this energy so many creatures are seen alive. By itself the body of

creatures is created from so many chemicals but its inner consciousness is

very original. It is not created from material energy but due to its own

influence it influences the body and surroundings too. This itself is called

consciousness. Consciousness has 2 qualities wherein one is will and the other

is faith. Will is called sentiment and thinking is called intellect. One is the

inner soul and the other is called brain. At the root of thoughts created by the

brain dwells its home, faith, description and the combined inspiration that is

at work. A living creatures consciousness is called Para Prakriti.


30/52

That science which describes and analyzes inert matter is called Material

Science. That science which describes and analyzes consciousness is called

Spiritual Science. Gayatri overflows with both subtle energies that are

material and spiritual in nature. The atom is the smallest unit of matter. Its

combined form is the cosmos. In the name of microcosm and macrocosm that

smallness and gigantic nature can be understood. The conscious nature ofliving beings is called the soul and its cosmic form is called divine cosmic soul

or Almighty God. Due to activity that dwells in the cosmos atoms get

affected. This can also be explained in another way that the combined

consciousness of atoms create upheavals and movements in the cosmos. It

also can be said that in the arena of consciousness the soul gets boons from

Almighty God or else the combined consciousness of all souls Almighty God

gets created.

Gayatri is said to be the source of Para and Apara Prakriti. In the spiritual

realms it is mainly seen as Divine Aura. It is the manifest form of Almighty

God. It comfortably carries a devotee to Brahmanirvana or salvation. In theDevi Bhagwat scripture this has been further clarified:

Parabrahma swarupa cha nirvanpadadayini.

Brahma tejomayi shakti saadhishthatra.

Gayatri is God incarnate and giver of Nirvana or salvation. It is the presiding

deity of Divine Aura and Divine Energy.

What exactly is Gayatri? Consciousness' Manasarovar (lake) spread out inthe entire cosmos is called Gayatri. It works as divine knowledge and divine

sentiments in creatures and in material objects it works as creation and

activity of change. Its fount is divine consciousness.

This cosmos' evolution and propagation has taken place from one focal point

only. This has been accepted both by western scholars and Indian

philosophers. As per the opinion of leading astronomers too that initially

when world creation took place there was only one great element. In it an

explosion occurred wherein objects started flowing like a river. As a result

this cosmos became full of planets and galaxies. In this materialism based

belief matter does have place but since consciousness does not have it, itappears as incomplete.

The research of Indian scholars is much more important. We too have a

belief that during world creation only divine consciousness with Satatattva

(existence) was there. In its navel area gushed forth 'Ekoham bahusyama' i.e.

may I become many from one. That itself became its will power and world


31/52

manager became well known as Super Divine Power. It is called Gayatri. In

spiritual terminology this divine energy gets classified as Sata, Rajas and

Tamas. In Gayatri Super Science this itself is called Hreem or power of

wisdom or Goddess Saraswati, Shri or means or Goddess Lakshmi and

Kleem or predominating with energy or Goddess Kali. Due to the union of

Almighty God and Prakriti a mixed Rajas existence got created and it iscalled Jiva or living being. Just as a son has chromosomes of both parents

similarly a living being has existence of both his father and mother. In a

major way a child lives with the help of its mother. It is more conducive for

the child's nature. This fact has been experienced seriously by Indian

spiritual seers. It is hence that Gayatri worship and meditation has been

given so much importance. Since it includes devotion, action, wisdom,

detachment etc Gayatri's spiritual philosophy helps both in this world and

the next.

Subtle Prakriti is that which got created that after emerging from Primordial

Energy Gayatri got classified a Saraswati, Lakshmi and Kali. The rivulet ofall pervasive energy is much subtler than the 5 elements. Just as in the flow

of a river when water bangs with wind a gurgling sound is produced

similarly from the energies of subtle Prakriti (nature) 3 types of sound

emerges. In the Sata flow Hreem, from the Rajas flow Shree and from Tamas

flow Kleem sound emerges. Subtler than this is Brahman's Om sound flow.

Devotees undergoing Naadyoga spiritual practices in deep meditation hear

these sounds. With its aid they attain Brahman or Almighty God.

In ancient times our revered ancestors viz. Rishi-Munis via their sharp divine

eye had unfolded this subtle principle of science. They used up their entire

life to search and succeed in it. As a result in comparison to present daymaterial science they succeeded in attaining n fold more benefits. They

placed their own rights on the subtle flow of Adishakti or Primordial Energy.

It is quite clear that from within the human body varied energies manifest.

Via Yoga our Rishi-Munis awakened energy centers, Chakras (subtle

plexus), glands, 7 goddesses of Tantriks, lights and magnetic eddy fields

hidden in various parts of the body. Due to this awakening an energy flow

manifested and these were conjoined to various streams of Adishakti or

Primordial Energy as and when required. Since the electricity of both is

similar they would mix with each other. They would give and take the

conversation etc between these centers. Similarly by awakening secret

centers dwelling in Tandra (drowsiness) of the body we create a bond withenergy centers of subtle nature at that time a relationship is created between

Adishakti or Primordial Energy and man. Due to this relationship man starts

understanding the mysteries dwelling in Adishakti or Primordial Energy. As

a result man as per his will uses it to attain benefits because whatever exists

in this world is present in Adishakti or Primordial Energy. Hence this

bonded energy too can create a relationship with all objects of the world and

various means.


32/52

Today's scientists in order to create a bond with gross nature by remaining

within limits of the 5 elements use up expensive machines, electricity, steam,

gas, petrol etc and thus do some scientific research. The benefit attained from

this is quite miniscule. This solution is full of hard work and takes up a lot of

time. In it is the uselessness of taints, breaking things and changes. Work has

to go on continuously in order to set up technology, protect it and producethings. To change its place of work is very difficult. All this trouble was not

faced by Indian scientists of Yoga Science. Without taking help of any

machinery, without using fuel like petrol/gas they by establishing a bond

with centers of their subtle body and subtle nature executed such wondrous

tasks that its great potential is beyond the ken of today's modern material

scientists.

The basis of these Sidhis or divine powers is spiritual practices. A person via

spiritual practices by advancing his inner nature credentials (Paatrata)

attains benefits of that super power. This super power by proving the 3

Prakritis or nature viz. Sata, Rajas and Tamas manifests as wisdom, activityand worship of God in human life. Thus such a devotee becomes wise, active

and truly wealthy.

That person who via Gayatri spiritual practices makes efforts to advance

spiritually, mentally and soul wise they by awakening potentials dwelling

within them and by placing authority on them renders them so useful just

like today's scientists who after placing their authority on electricity, atoms

and other energies have rendered them useful for service to mankind. Those

energies and material wealth noted in this material world they in the inner

world manifest as spiritual wealth. The spiritual energy of Gayatri manifests

such good destiny for its devotee.

Anyone can benefit at least a wee bit via Gayatri spiritual practices. Special

benefits accrue from worship with desires, influence of Beej Mantras,

Anushthan and Purashcharanas. Due to it so many hardships of the devotee

get warded off and the sequence of attained desired results goes on. Such

benefits and miracles are seen often but they take place at a lower level. It is

certainly nothing big that certain hardships get overcome and certain success

was attained. Such benefits are accrued even by material efforts. The true

benefit of worship-meditation is to render the inner soul infinitely powerful.

Along with this akin to the sandalwood tree not only oneself becomes

fragrant but that renders other trees and plants around it quite fragrant. In

order to get such a high stature benefit man akin to a real Brahmin has to

imbibe those qualities, actions and inner nature. Only then that infinite

storehouse is attained for which Divine Wisdom exhorting Brahmins inspires

them to attain that storehouse.


33/52

In Super Mantra Gayatri divine powers overflow but it manifests only in

pious character devotees. When River Ganga descended on earth from

heaven in order to hold it Lord Shiva by spreading out his matted locks

created a foundation for the 1st manifestation. Pleased with Bhagiratha's

austerities River Ganga gave him the boon of it incarnating on earth. But

River Ganga also said that lest no foundation was in place while it descendedon earth it shall pass by earth and enter hell. Thus earth denizens would not

benefit at all. When this requirement was fulfilled by Lord Shiva River

Ganga successfully descended on earth. The same condition holds true for

Super Power Gayatri. In order to imbibe it a powerful foundation is

compulsory. And this requirement is fulfilled only by those devotees that

ooze with true great Brahmin qualities, actions and sacred inner nature.

Such Brahmins can imbibe the Super Energy of Mantras within themselves

and via it uplifts both individuals and society too.

Devadhinam jagatsarvam mantradhinashcha devataha.

Te mantra brahmanadhinastasyad viprohi devata.

....................Matsya Purana

This entire world is under the reign of demigods. All demigods are reigned

by Mantras. Mantras are used by Brahmins and hence true Bramins too are

demigods.

Maharishi Vashishtha was a deity of such an earth. He possessed

Kamadhenu (wish fulfilling cow) or the Super Power of Gayatri. When hehad to wage a war against King Vishwamitra the king's huge army had lost

this war. At that time the king uttered thus:

Dhig balam kshatriya balam, brahmatejo balambalam.

It means fie upon material might and it is lowly and useless. True strength

dwells in the divine aura of Brhmins. That itself is the power of Mantras, it is

true might etc and after saying thus King Vishwamitra gave up his kingdom

so as to do penance in order to attain a true Brahmin's strength.

In scriptures of yore there are many examples of the nature, action and usage

of Gayatri Divine Energy. Many times this energy has exhibited its own true

nature and deities and Rishis in the form of prayers by eulogizing its inner

nature have described it. Based on this description one can know that in this

world where and in what manner Gayatri Energy Principle is being used.

Gayatri paradevateti kathita brahmaiva chidrupini


34/52

This Gaytri is much bigger than other deities as is being said by all. This

Gayatri with divine consciousness is Almighty God only.

Gayatri tu param tattvam gayatri parama gatihi.

.................Brihad Parashar (5/4)

Gayatri is the supreme Divine Principle and it is the ultimate goal.

Gayatri sa maheshani parabrahmatmika mata.

..................Rudra Tantra

This Gayatri itself is Almighty God and Maheshwari (consort of Lord Shiva).

Gayatri paradevateti kathita brahmaiva chidrupini.

...................Gayatri Purashcharan Padhati

It is Gayatri that is supreme deity, consciousness in nature and Almighty

God himself.

Tadaksharam tatsaviturvarenyam prajna cha tasyaha prasrita para sa.

..................Guhyopanishad

It is imperishable God, it is tatsaviturvarenyam divine intellect and an all

pervasive Para or Divine Energy.

Ya devi sarvabhuteshu shakti rupena sansthita

Namastastyay namastastyay namo namaha

Indriyanamadhishthatri bhutanam chakhileshu ya

Bhuteshu satatam tasyay vyaptai devyay namo namaha.

..................Markandeya Purana

I bow down to that Super Power which dwells as energy in all creatures, is

the presiding deity of the 5 sense organs and manages the 5 elements.


35/52


36/52

Gayatri Japa or Mantra chanting gives important benefits. In order to give a

glimpse of this we are giving many proofs of it thus:

Sarvesham vedanam guhyopanishatsarbhutam tato gayatrim japet.

....................Chandogya Parishishtam

Gayatri is the gist of all Vedas and mystery based Upanishads and hence we

must do Gayatri chanting every day.

Sarvavedasarabhuta gayatraystu samarchana.

Brahmadayopi sandhyayam tam dhyayanti japanti cha.

.................Devi Bhagwat Skand 16; Chapter 16/15

The worship-meditation of Gayatri is the essence of all Vedas. Even deities

like Brahma etc do Gayatri meditation and Japa or chanting at dawn, noon

and dusk.

Gayatri matra nihnato dwijo mokshamapnuyat.

.................Devi Bhagwat Skand 16; Chapter 8/10

Those Brahmins who meditate and worship Gayatri attain salvation.

Ehikamushkikam sarvam gaytri japato bhavet.

.....................Agni Purana

Those that chant Gayatri attain all joys that are both material and spiritual

in nature.

Yodheetehanyahanyetam trini varshanyatandritaha.

Sa brahma parambhuyeti vayubhutaha ivamurtiman.

........................Manu Smriti

That person who daily chants Super Mantra Gayatri for 3 years he definitely

attains Almighty God and as per his wish he travels like wind does.


37/52

Kuryandanyanna va kuryat iti praha manuhu swayam.

Akshaymokshamvapnoti gayatrimantrajapanat.

...................Shaunak

In this manner Manu himself has said that whether you worship other deities

or not but via Gayatri Mantra chanting a Dwij attains salvation.

Omkar sahita japan tam cha vyahritipurvakam.

Sandhyayorvedavidvipro veda-punyena muchyatey.

.....................Manu Smriti (2/78)

That true Brahmin who does Japa of Om and Gayatri Mantra with Vyahriti

attains the fruits of studying Vedas.

Gayatri japate yastu dwikalam brahmanaha sada.

Asatprarihitopi sa yati param gatim.

...............Agni Purana

That Brahmin who always does Gayatri Mantra chanting both at dawn anddusk but takes donations in an inapt manner, even so he attains salvation.

Sakridapi japedvidwan gayatrim paramaksharim.

Tatkshanat sambhavetsidhirbrahmasayujyamapnuyat.

.................Gayatri Purashcharan 28

Even if a scholar chants Gayatri with supreme alphabets even once he

immediately attains success and also attains Sayujya salvation with Brahma.

Japyenaiva tu sansidhayet brahmano natra sanshayaha.

Kuryadanyatra va kuryanmaitro brahman uchyatey.

.....................Manu 97


38/52

Whether a Brahmin does anything or not even so he can attain Sidhi or

success via Gayatri only.

Nasti ganga samam tirtha na devaha keshavatparaha.

Gayatryastu param japam na bhutam na bhavishyati.

.................Vra.Yo.Yajnavalkya 102-7/8

There is no pilgrim spot akin to River Ganga, there is no greater deity than

Keshava and till today no greater Japa than chanting of Gayatri Mantra

exists and shall not manifest in future too.

Sarveshamjapasuktanamruchashcha yajusham tatha.

Samnam chaukaksharadinam gayatri paramo japaha.

.................Vru.Parashar Smriti Chapter 4/4

Amongst all Japa Suktas Rig, Yaju and Sama Vedas and one alphabet

Mantras Gayatri Mantra reigns supreme.

Yatha madhu cha pushpebhyo ghritam dugdhadrasatpayaha.

Evam hi sarvavedanam gayatri saar uchyatey.

....................Vyas

Just as the essence of flowers is honey, of milk is Ghee or clarified butter, of

juices is Paya similarly Gayatri Mantra is the essence of all Vedas.

Tadityarichaha samo nasti mantro vedachatushtaye.

Sarvey vedashcha yajnashcha danani cha tapas cha.

Samani kalaya prahurmunayo na tadityarichaha.

....................Vishwamitra


39/52


40/52

Sadhakaha kurute yastu tantrashakterapavyayaha.

Tam vinashayati saiva saaiva samoolam natra sanshayaha............81

That devotee who misuses Mantra Energy the latter totally destroys him.

Satatam sadhanabhiryo yati sadhaktam naraha.

Swapnavasthasu jayantey tasya divyanubhutayaha............82

That person who regularly is engaged in spiritual practices so as to attain

discipleship such a person gets divine experiences in dream.

Safalaha sadhako lokey prapnuteynubhavan navan.

Vichitran vividhashchaiva sadhunasidhyanantaram............83

In this world a successful devotee after attaining success due to spiritual

practices attains newer and strange types of experiences.

Bhinnabhirvidhibhi budhaya bhinnasu karyapanktisu.

Gayatrayaha sidhimantrasya prayogaha kriyate budhaiha..........84

A wise person for varied tasks succeeds first in Gayatri Mantra chanting soas to use it with Viveka or farsighted discrimination using varied methods.

In this manner in scriptures at many places one finds a description of great

benefits of Gayatri Mantra chanting. It has nothing to do with singing

praises just like that. Attaining success via Mantras and attaining both

material and spiritual benefits is quite scientific in nature. In pages after this

we shall see that via Mantras and via the energy of cosmic divine

consciousness what type of benefits accrue.


41/52

CHAPTER 3

GAYATRI SUPER POWER IS THE SUPREME ICON

DEITY OF THE 3 DEMIGODS

Gayatri is a root and inseparable energy of Almighty God. It is not any

independent god or goddess but is an active portion of Almighty God.

Brahman or cosmic divine consciousness is without any shape or form, it is

beyond thoughts, it is beyond the ken of the human brain and is a witness but

because its mobility is consciousness in nature it is worth worshiping.

Further one gets desired results of worshiping and meditating on it.


42/52

In Indian spiritual scriptures there is a description of many gods and

goddesses. Mention has been made there of their varied forms and varied

names and shapes. All these gods and goddesses are but different forms of

the divine energy of Almighty God. Just as speech lies in the tongue, vision in

eyes, brain in the intellect, strength in hands and mobility in legs similarly

innumerable divine energies of God are given different names as differentdeities. In order to render them divinely energized varied types of exercises

of varied organs are executed. But a person understanding the true reality

focuses his mind on the root life force of the human body, digestion,

purification of blood etc because by watering its root all leaves and branches

by themselves remain lush green. Different worship rites of deities too is

quite useful. There accrues no loss yet a farsighted person just like watering

the root focuses his vision on the root divine energy and after rendering

strong and nourished the seemingly different parts so as to attain all benefits

which they shower on a true devotee.

The basis of all divine energies is Almighty God's energy. It is this AlmightyGod's energy that is called Gayatri. In the divine principle it is divine energy

Gayatri that manifests mobility. Due to this all parts and demigods attain

nourishment. Hence spiritual seers take recourse to the chief shelter and that

which is attained only after roaming here and there aimlessly is got from one

place itself. By doing worship/Arti of so many deities little benefit is accrued

but n fold benefits are attained when we worship the root divine energy.

Gayatri is the root and divine energies are its branches and sub branches.

That energy too gets its energy from the root center and thus becomes

capable. By this energy it gives a devotee desired boons. This fact has been

described in Indian Mythology/Puranas and scriptures in such a way that all

deities worship Gayatri and pray to it and whatever it attains from thishumungous storehouse is shared in its region.

Sarvavedasarbhuta gayatrayastu samarchana.

Brahmadayopi sandhyayam tam dhyayanti japanti cha.

.....................Devi Bhagwat 16/16/15

Gayatri worship-meditation is the gist of Vedas. Brahma, Vishnu, Mahesh

etc along with Sandhya worship Gayatri.

Previously we have said that varied sparks of Almighty God are known as

divine energies. The number of demigods is unlimited. It is said that there

are 3.2 million deities but amongst all deities only 3 are said to be major ones

viz. Brahma, Vishnu and Mahesh. Via their power of creation, propagation

and destruction this world's life, growth and transformation take place.


43/52

Brahma, Vishnu and Mahesh do not have their own energy. It is but a loan

taken from Primordial Energy called Adishakti Goddess. The moon does not

have its own shine. It shines because of the sun's aura. The reflection of this

aura appears as the shining of moon. This fact has been described in Skand

Purana as a discourse and examples thus:

Sarvashaktihi paravishno rigyajuhu sam sanjnita.

Saipa trayitapatyanho jagatashcha hinasti ya.

Saishayvishnuhu sthitim sthityam jagataha palanodyataha.

Rigyajuhu samabhutantaha savitwijaha! Tishthati.

Goddess Primordial Energy called Adishakti that manifests this world in the

form of creation, propagation and destruction is an independent energy andhas names called Rig, Yaju and Sama. By itself in 3 fold form manifests in

this world carries out creation, propagation and destruction.

Masi-masi kheryam yastatra tatrahi sa para.

Trayi mayi vishnu shaktirnasthanam karotivai.

Richaha stuvanti purvahaney madhyahaney cha yajunshi vai.

Brihadrathantaradini samanyangakshayey ravau.

Anga saisha trayi vishno rigyajuhu samasanjnita.

Vishnu shakti swasthanam sadaditye karoti sa.

Gayatri is 3 fold image since Brahma imbibes Rajoguna for creation, Vishnu

imbibes Sattvaguna for propagation and Mahesh imbibes Tamoguna for

merging this world in Gayatri. Also by becoming Rig, Yaju and Sama in

Savita Gayatri dwells there. In the morning Rig eulogizes the sun, at noon it

is Yaju and at dusk Brihadrathantar etc Sama Shrutis. It resides in the sunand is Vedatrayi.

Na kevalam raveha shaktivaishnavi sa trayimayi.

Brahmatha purusho rudrastrayamettrayimayam.


44/52

Evam sa sattviki shaktivaishnavi ya trayimayi.

Adya saptaganastham tam bhaswantamadhitishthati.

This is not merely energy of sun's Vishnu form but that it is 3 fold in nature

viz. Brahma, Vishnu and Rudra. In this manner this 3 fold Adishakti orPrimordial Energy dwells in the sun with its 7 Gunas.

In the Devi Bhagwat Purana a detailed description of the deep import of

Goddess Super Power Gayatri. It is the icon deity of all gods and goddesses

and the crest jewel amongst all Mantras. Right since time immemorial it has

been highly praised and its worship-meditation is said to be a major one. In

scriptures this very description is found and via demigods unveiling the

mystery of its worship-meditation that very Super Power Gayatri is believed

to be their icon deity. Truly the center of all energies is this Super Mantra

Gayatri. Via its worship-meditation right from humans to deities it is proved

that all attain wellness.

Tasmannaham swatantrosmi shaktyadhinosmi sarvatha.

Tameva shaktim satatam dhyayami cha nirantaram.

Nataha parataram kinchijjanami kamalodbhava.

Lord Vishnu while eulogizing the energy manifest Goddess once told

Brahma, born from a lotus flower that I am not independent. I am at theservice of energy of this Goddess. Due to the might of her energy I have the

capacity to do many things. Hence I ceaselessly meditate on her because O

Brahmaji-seated on a lotus flower! Apart from her I do not know anyone.

Tena chapyahamuktosmi tathaiva munipungava.

Tasmattwamapi kalyanapurusharthaptihetavey.

Asanshayam hridambhoje bhaja devipadambujam.

Sarvam dasyati sa deviyadyadishtam bhavettava.

Devarshi Naradji told Vyas Muni that O supreme Muni! Brahmaji alsji also

had informed me about the powerful energy of that Goddess. Hence you too

in order to make full efforts without harboring any doubt devote yourself to

this Goddess in the lotus-heart. By devoting yourself at her hallowed feet she

will fulfill all your desires.


45/52

Chintayantu mahamamayam vidam devim sanatanim.

Sa vidhasyati naha karyam nirguna prakritihi para.

Brahmaviyam jagaddhatrim sarvesham jananim tatha.

Maya sarvamiha vyaptam trailokyam sacharacharam.

One day Brahma told the deities who were facing sorrow that they must

meditate on Mahamaya Sanatani Goddess. She that is divine Nirguna

(beyond all qualities) in nature shall fulfill all your tasks. She is Divine

Wisdom, one that nourishes us Divine Mother of all. She pervades all the

worlds whether animate or inanimate.

The other name of Gayatri is Savitri. In scriptures at some places it is called

Savitri and at others it is called Gayatri. When it is applied in the spiritualrealm it is called Gayatri and if it is applied in order to increase material

comforts and grandeur it is called Savitri. Du

Documents

Super Power Gayatri-The Icon Deity of Demigods, Avataras