Upload
others
View
2
Download
0
Embed Size (px)
Citation preview
Career Development
Explore the ICC Website . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2Career Planning Timeline . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3Career Planning: A Lifelong Process . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4
The Internship/Job Search
Ready to Launch a Job Search? . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6Informational Interviews . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7How to Research Employers and Jobs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8Managing Job Search Stress . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9Job Search Strategies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10Networking: The Number One Job Search Strategy . . . . . . . . . . . . . . . . . . . . . . 11How to Prepare for the Fair . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12Transferable Skills . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13
Resumes and Correspondence
Resumes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14Resume Tips for Specific Fields . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14Resume Content . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15Verb List for Resumes & Letters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16Resume Samples . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17Online Resumes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26Advanced Degree Resumes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27Curriculum Vitae Samples . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31CV Supplement and Grad Skills List . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34Asking for a Reference or a Letter of Recommendation . . . . . . . . . . . . . . . . . . . . 35Cover Letters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36Sample Letters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37
Interviewing for Employment
Interviewing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41Interview Questions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45Evaluating a Job Offer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46
CAREER RESOURCEMANUAL
2012-2013The Internship & Career Center
First, Second and Third Floors, South Hall
University of California
Davis, CA 95616icc.ucdavis.edu (530) 752-2855
ADMINISTRATIVE STAFFDirector:
Subhash H . Risbud 752-6659Associate Director and Project
Manager: Jeanne Shelby 752-6653
Project Managers:Chris Dito 752-8979Marcie Kirk Holland 752-0752Janice Morand 754-8332Administrative Assistant:
Stephanie Thompson 752-0722
PROGRAM AREASProgram Area
Information 752-2855Agricultural & Environmental SciencesEngineering & Physical SciencesGraduate Student & Postdoctoral Career ServicesHealth & Biological SciencesLiberal Arts & Business
Career Recruiting Programs 752-2286Community Service Resource Center 752-3813International Programs 752-2670Washington Program 752-6652
Table of Contents
ADVERTISER INDEX
University of California, Riverside, The A. Gary Anderson Graduate School of Management . . . . . . . . . . . . . . . . . 48
California School of Professional Psychology. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5Marcus & Millichap Real Estate Investment Services. . . . . . . . . . . . . . . . . . . . . . . 47New Mexico State University . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45Santa Clara University, MBA for Emerging Professionals . . . . . . . . . . . . . . . . . . . 48U.S. Air Force, Scholarships for MSN Programs . . . . . . . . . . . . . . . . . . . . . . . . . . 46U.S. Department of State. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47
College Recruitment Media and the University of California, Davis wish to thank the above participating sponsors for making this publication available to students.
2 University of California, Davis
Care
er D
evel
opm
ent
Students: Use our website to find internships and careers, learn about upcoming events and connect with advising staff .
Grad Students/Postdocs: We have career and professional de vel op ment re sourc es for graduate students and postdoctoral scholars .
UC Davis Alumni: Take advantage of the services available online such as Aggie Job Link and career fair information .
Internships and Jobs• AggieJobLink:CreateanAggieJobLinkprofileand
browse career jobs and internships, upload resumes and cover letters, submit applications, sign up for campus interviews, view dates for information sessions and keep track of your job search activities .
• Searchlinkstootherregional,nationalandinternationaljob search sites .
Fairs and Events• Findlocations,datesandtimesofupcomingcareerfairs
and meet with company representatives at one of our six career fairs held each year .
• Learnaboutcompaniesattendingupcomingfairsandfindcontact information for companies from previous fairs .
• ReadthequarterlyProgramofEvents(POE)onlinetolearnabout upcoming workshops, weekly events and special events like “Pathways Career Sym po sium for Graduate Students and Postdoctoral Scholars,” and “Career Speed Dating .”
Advising• Learnaboutourfocusedprogramareas:Agriculturaland
Environmental Sciences; Career Recruiting Programs; Engineering and Physical Sciences; Graduate Student and Postdoctoral Career Services; Health and Biological Sciences; International Programs; Liberal Arts and Business .
• Discoverourspecialtyprograms:CommunityServiceResource Center; Peace Corps; UC Center Sacramento; UC Davis Washington Program .
• JoinICCMailandgetthescooponnewinternshipsandcareer postings or special events .
• MeetwithStudentAdvisorsduringdailydrop-inhours.
• AttendanIntrototheICC/AggieJobLinkworkshoptolearn how to use ICC resources .
Career Help• AccesstheCareer Resource Manual online for samples of
resumes, cover letters, interview tips and more .
• CheckouronlineindexofcareerresourcesavailableintheInternship and Career Center Library, 215 South Hall .
• BethefirsttoenrollinourpopularCareerDecisionMaking course, AMS 95 .
• WatchanICCwebshoporcareervideoatyourcomputerdesk .
• Researchlabormarket/salaryinformationforvariousgeographic locations .
• Exploreeverycareerfieldwithourcareerexplorationtoolsincluding fastest growing occupations, employer profiles and job outlook .
Explore the ICC Web Site
icc.ucdavis.edu
icc.ucdavis.edu 3
Career Development
T he following “Career Planning Timeline” is intended to serve as a set of guidelines to help you integrate academic, co-curricular and career planning as you progress through UC Davis . Remember, these are just suggestions! Your personal career decision-makingprocessmaynotconformexactlytothisTimeline,andthat’sOK!(Foranothermodel, see “Career Planning: A
LifelongProcess”onpage4).
Career Planning Timeline
Fourth Year - “A Time to Make Decisions”
CAREER• Attend career fairs, workshops and events.• Begin conducting job search: online, by telephone and in
person.• Use Aggie Job Link, for on-campus interviews with the
Career Recruiting Program.• Research and develop a target list of potential employers.• Attend employer information sessions.• Develop an active network. (See page 11)• Join a professional organization or LinkedIn.
ACADEMICS• Research and apply to graduate schools.• Conduct a research project. Consider presenting at the
Undergraduate Research Conference in Spring.• Confirm your remaining degree requirements.
EXTRACURRICULAR• Explore lifelong learning interests.• Prepare for life after graduation.• Take a leadership role in a class, project, club or organization.
First Year - “A Time of Self-Discovery”
CAREER• Talk over career ideas with an ICC Student Advisor or
Coordinator, and with parents, friends and instructors.• Read about different careers in 215 South Hall.• Enroll in a First Year Seminar on Career Exploration.• Attend career fairs and ICC events.
ACADEMICS• Take a variety of courses to explore majors.• Meet and talk to instructors.• Attend study skills and time management workshops.• See an academic coordinator or peer advisor in the residence halls.• Explore undergraduate research opportunities.• Attend RHAT academic programs in the residence halls.
EXTRACURRICULAR• Get involved in residence hall activities, student
organizations or community service projects.• Nurture hobbies; balance work and play.
Second Year - “Expand Your Career Horizons”
CAREER• Register for Aggie Job Link through the ICC Web site and
complete your profile.• Begin to plan for internships.• Take AMS 95, the “Career Decision Making” course.• Talk with ICC Staff.• Attend a Resume Writing workshop and develop a resume.• Attend ICC workshops and Career Fairs.
ACADEMICS• Meet with an academic advisor.• Choose or change majors.• Investigate the UC Davis Washington Program and study abroad programs.
EXTRACURRICULAR• Volunteer for a committee or organization.• Take a leadership role.Third Year - “A Time to Test Options”
CAREER• Complete an ICC-approved or self developed internship
(or maybe two!).• Talk with ICC staff about your career goals and plans.• Attend career fairs, workshops and events.• Update your resume.• Conduct informational interviews. (See page 7)
ACADEMICS• Supplement major courses with courses that teach practical
skills (public speaking, statistics, accounting, computer skills, etc.).
• Study at the UC Davis Washington Program, the UC Center Sacramento or abroad.
• Research graduate or professional schools, and request letters of recommendation, if appropriate.
• Explore and consider research opportunities.• Develop a relationship with an academic mentor advisor or
faculty member.
EXTRACURRICULAR• Pursue leadership roles in organizations or other activities.• Apply for a Peer Advisor, Resident Advisor or Student
Assistant position.• Work at a part-time job to build leadership, communication
and office skills.• Volunteer for campus or community service.
Transfer StudentsDON’T MISS OUT! You can talk to ICC staff and Student Advisors about internships and other services.
4 University of California, Davis
Care
er D
evel
opm
ent Career Planning: A Lifelong Process
The model shown is designed to help you make career decisions throughout your lifelong career path.
Why Take Career Self Assessments? Assessments are tools to examine jobs, careers and voca-tions and help you identify what you might like to do . Assessments do not tell you what you “should do” or “should be .” They can help you identify professions that may be satisfying to you .
Take the Career Decision Making Course (AMS 95) Open to all majors, this 2 unit course will help you under-stand and apply career development theories and practices . Contact the Internship & Career Center for information about the next term the course will be offered .
Research Your Career OptionsInternship and Career Center Library, South Hall Room 215.
Browse through hundreds of up-to-date, career-related books, graduate and professional school information .
Identify Job TitlesLook into the Occupational Outlook Handbook (www.bls.gov) for thousands of job titles and information
oneducationrequired,joboutlookandajobdescription.
Conduct Informational InterviewsFind professionals working in careers or organizations that
interest you and gain a better understanding of the career or industry . See page 7 .
Job ShadowingOnce you have identified a professional who is willing to
talk to you about his or her career, ask if you may “shadow” them to gain a sense of what a typical work day is like .
VideosView our online videos “Careers in . . .” at icc.ucdavis.
edu/video.
Self Exploration
Internships Create an account on Aggie Job Link icc.ucdavis.edu to find internship postings . Choose according to your academic and career interests andqualifications;ordevelopyour own internship by networking with professionals who have jobs or work at orga-
nizations that interest you . See an ICC Student Advisor for assistanceorattendanIntrotoICC/AggieJobLinkworkshop.
Gain Practical Skills Through academic course work, volunteering and interning you can gain leadership, communication, interpersonal, teamwork,quantitativeandcomputerskills,allofwhichareimportant in today’s workplace .
Service Learning An effort to increase citizen involvement in community service, this is a combination of serving and learning which results in change for both the provider and the recipient . It provides a teaching approach that integrates community service with academic study to enrich learning, teach responsibility, and strengthen communities . Service learning links academic content and standards to community needs . Academic credit may be awarded in some classes .
World of Work Research Experiential Education
Now that you have narrowed your focus and set your goals, it’s time to prepare for your job search .
The ICC has workshops listed in our POE and online webshops at icc.ucdavis.edu/webshops.
• Howtotailoryourresumeand cover letter to the specific position for which you apply .
• Useavarietyofjobsearchmethods.
• Developstronginterviewingskills.
• Network,network,network!
• Onceyouareofferedanemploymentopportunity,evaluateit carefully before accepting .
University of California, Davis 5
There are several steps to take as you make decisions about your career . One model widely used in career development and created by America’s Career Resource Network, describes it as a cyclical process that can be entered at any point and repeated over and over until satisfaction is achieved . For examples visit:
www.acrnetwork.org/ decision.htm .
Congratulations, you’re ready to start your new job! The following tips will help you successfully manage your new career .
• Berealisticaboutyourexpectations .
• Promotionsareearnedthrough diligence, initiative and hard work .
• Arriveearly,staylate.
• Keepyoursupervisorinformedaboutyourinterestsandaccomplishments .
• Actandspeakprofessionally,offerfirmhandshakes,respect your co-workers .
• Beateamplayer.
• Establishamentorrelationshipwithaseasonedveteran.
• Participateincommitteesandprofessionalassociations.
• Benchmarkyourskillsandbealife-longlearner!
Attend one of our “What Can I Do . . .” workshops offeredeachquarter.CheckourmonthlyProgramofEvents(POE)forothereventstohelpyourdecision-making .
Job Search
Career Management
Decision-Making
Our Graduates Build Great Careers
Graduate Programs:
Clinical Psychology – APA-accredited
Couple and Family Therapy – COAMFT-accredited
Organizational Psychology
Clinical Counseling: MA Program – for LPCC licensure
Counseling Psychology – in Mexico City
International Study Abroad Options
Learn more
www.alliant.edu/cspp
1.866.U.ALLIANT
Locations
Fresno | Irvine | Los Angeles Sacramento | San Diego San Francisco | Hong Kong
Mexico City | Tokyo
Alliant is a private, nonprofit university. All degrees are accredited by the Western Association of Schools and Colleges (WASC). We are an equal opportunity employer and educator.
6 University of California, Davis
ARE YOU READY? Take this quick quiz! There’s more to job hunting than sending out resumes and cover letters . To assess whether you are “ready to launch a job search,” check all the statements below that you have accomplished .
___Identified my strongest skills and abilities
___ Know and can articulate my best accomplishments
___ Have identified my interests and how they fit into my career goals
___Know what I need to do to excel at a job
___Understand my values and priorities
___Have an achievable career objective
___Understand what skills employers are seeking
___Identified what skills I have to offer employers
___ Can clearly state to employers what I do well and enjoy doing
___Havesupport(family,friendsandmentors)forthejob/careerIwant
___ Know how to use the Internet to research occupations and employers
___ Can identify potential employers that I want to contact
___Know how to do an informational interview
___Know what to do at an Internship and Career Fair
___ Have developed a network of people that I can contact for referrals and job leads
___Knowhowtomarketmyinternshipand/orcommunityserviceexperience
___ Have secured at least three people to serve as references
___Have cleaned up my social networking websites
___HavepreparedaresumeandcoverlettertemplateandhadthemcritiquedbytheICC
___Havedevelopedresponsestotypicalinterviewquestions
___ Have a strategy to deal with my weaknesses and liabilities
___Havepreparedpotentialanswerstobehavioralinterviewquestions
___Have secured appropriate interview clothes
___Can follow up on job interviews
___ Have a strategy on how to negotiate salary and benefits
If you haven’t checked all the above statements, come see us so we can help you prepare .
Adapted from Job Search and Career Checklists 101 Proven Time-Saving Checklists to Organize and Plan Your Career Search, JIST Works, 2005. pg. 86-87.
The
Inte
rnsh
ip/J
ob S
earc
h
Ready to Launch a Job Search?
icc.ucdavis.edu 7
The Internship/Job Search
Informational Interviews1. What is an “informational interview,” and why is it beneficial to you? An informational interview is an arranged meeting with someone who works in a job, career field or orga-nization that interests you .
Benefits:
• Veryeffectivetechniqueforresearchingandscreeningcareers, jobs or employers .
• Answersquestionsaboutwhatit’sliketoworkin a particular career field or job or for a specific organization .
• Increasesyournetworkofcontacts(themajorityofjobsareobtainedthroughnetworking).
• Talkingtoindustryprofessionalsisagoodwayoffinding out if a field really is a good fit for you .
• Helpsprepareyouforthejobsearch.
2. How do I find people who will talk to me? This may be easier than you think . People typically enjoy talking about their work and sharing their experiences . Start with your own network:
• ICCandUCDavisfacultyandstaff • LinkedInandAggieJobLinkProfessionalNetwork • Friendsandfamilymembers(don’tforgetroommates
andclassmates) • Directories,otherprintresourcesorthroughwebsite
links • CalAggieAlumniAssociationCareerResourceNetwork • ProfessionalAssociationsandEvents • ICCEvents(infomeetings,careerfairs)
3. How do I initiate contact? Be clear about your objective before you initiate contact . Set clear goals about what you want to gain from the informational interview . Once you have a contact’s name or names, you may contact this person by letter, email or telephone . Let this person know how you found out about him or her . When you call, explain why you are calling andbepolite,positiveandbusinesslike.Requestamutuallyconvenient, thirty-minute face-to-face meeting . It’s best to prepare a “telephone script .” Following is a sample telephone script, but of course you can develop your own .
“Hello, my name is Max Mustang . Alex Aggie suggested I call you . I am a senior majoring in English at UC Davis, and am interested in learning more about careers in technical writing . Alex recommended you as someone who is well respected in this field . I’m wondering if I might make a half-hour appointment with you sometime soon to seek your advice . Thank you!” Youcanuseasimilarscriptforemailrequests.
4. How do I prepare for the informational interview? Do initial research on the career field or employer using the Internet or the print resources in the Internship and Career Center Library, Room 215 South Hall . Once you’ve done the research, develop a 30-second overview of yourself, including yourreasonsforcontactingthisperson.Planopen-endedques-tionstokeeptheconversationflowing,insteadofquestionsthatrequirea“Yes”or“No”answer(seesamplequestionsection).Dress neatly and appropriately, just as you would for a job interview . Take multiple copies of your resume and a notepad andpen,alongwithalistofprioritizedquestionstoask.
5. How should I conduct the informational interview? Start by thanking your contact for taking the time to meet with you, then establish rapport by engaging in a bit of small talk . After that, start withyourprioritizedquestions.Asarule,youshouldnottakemore than a half hour of this person’s time, so you may not be abletoaskallyourquestions.Remember,thisisaconversation,notaninterrogation,soletitflow.Followingaresamplequestionsyoucanask(again,youwon’thavetimetoaskallofthem).
Questions about the career: 1 . How did you become interested in this career?
2 . What is a typical workday like? What are your job responsibilities?
3 . What are the rewards, challenges and frustrations of working in this career?
4 . What entry-level jobs are available in this field?
5 . What experience is necessary to enter this career?
6 . What advice do you have for someone preparing to enter this career?
Questions about the organization/industry: 1. Howdoesyourpositionfitwithintheorganization/
industry/careerfield?
2 . What is your work environment like?
3 . What is the economic forecast for this industry?
4. Whatisuniquetoyourorganization?Whoareyour competitors?
Questions about future growth/salary information: 1 . What are the employment prospects for someone
entering this field?
2 . What are some of the current issues and trends in this field?
3 . What is a typical starting salary or salary range in this field?
Follow-up questions: 1. Wouldyoumindtakingaquicklookatmyresume?
How should I target my resume for your industry?
2 . Are there professional publications I should read or associations I should join?
3 . What other professionals in this field would you recom-mend I speak with for additional information? May I use your name when I contact them?
4 . May I have your business card?
Don’tbeafraidtoaskyourownquestions.Thisisyour chance to get the information you need from an industry professional .
Shortly after your interview, send a thank-you note or email . This will let the person know how much you appreci-ated their time and advice . That person might think about alerting you in the future when a job opportunity arises in that organization...or he or she might refer your resume to colleagues in other organizations. Also, keep that contact active for future use .
Remember: Always send a thank-you note and don’t ask for a job!
To view a sample of an Introductory Letter, visit icc.udavis.edu/students/ntltr.htm
8 University of California, Davis
The
Inte
rnsh
ip/J
ob S
earc
h
How to Research Employers and JobsResearch employers and jobs to discover:• Employerhistories,missions,products,services,
locations, profiles, cultures, expectations, financial status, salaries, benefits and retirement plans
• Industrytrends
• Jobtitles,responsibilitiesandduties
• Typicalcareerpathsinvariousindustries
• Locationofentry-leveljobs,minimumqualifications
• Appropriatevocabularytouseindiscussingspecificjobs
You can approach your research from one or more of the following directions . You can research:
• aspecificjob title
• a career industry/field
• employment sectors
• a specific employer
You can conduct two types of research: primary research and secondary research. Primary research involves talking directly with people in a specific occupation or people who work for a specific employer .
Secondary research involves gathering information from print materials(books,newspapers,directories,etc.)orInternetsites.
If you want to conduct primary research, consider one of the following two strategies:
• Conductinformational interviews with people to learn more about a job title, a career field, an employment sectororanemployer.( Seepage7)
• There’snobetterwaytoconductprimaryresearchonacareer or employer than by doing an internship . Research internships on Aggie Job Link at icc.ucdavis.edu; search by keyword or job function . Talk to an ICC staff member for more information and learn how to recieve transcript notationand/oracademiccreditfor an internship .
If you want to conduct secondary research, visit the ICC Career Library in Room 215 South Hall, where you’ll find numerous career resources to assist you, or utilize the Internet .
How can I research a specific job title?• ExploretheOccupational Outlook Handbook
bls.gov/oco/
• VisittheO*NETOccupationalInformationNetwork online.onetcenter.org
How can I research a specific industry or career field?• Attendemployerinformationmeetingsoncampus.
• Meetemployerrepresentativesatcareerfairs&ICCevents . Pick up a copy of the Program of Events at the ICC or check out the events calendar at our website .
• Joinacareer-related,registered,studentorganization.Visit csi.ucdavis.edu for a list of organizations .
• Readnewspapersspecifictoyourgeographicareaofinterest.(e.g.,sfgate.com/jobsfortheBayArea)
• Gotothefollowingwebsitestoconductindustryresearch:
rileyguide.com weddles.com/associations wetfeet.com
Employment Sectors To Research:• business/thecorporateworld/theprivate/forprofitsector
• thenonprofitsector
• local,stateorfederalgovernment
• education
How can I find out about employment in the corporate world?• UseAggieJobLinktoresearchemployersthatrecruitand
hire UC Davis students through On-Campus Recruiting . Also learn about employer info meetings and research the companies attending career fairs .
• Readperiodicals(e.g.,Sacramento Business Journal, Fortune Magazine, Wall Street Journal,etc.).
How can I find out about employment in the nonprofit sector?• AttendtheCommunityServiceFairduringfallquarter.
• Visitthefollowingwebsites:
- Nonprofit Resource Center in Sacramento: nprcenter.org(selectJobLink)
- Young Nonprofit Professionals Network: ynpn.org
- CA Association of Nonprofits: canonprofits.org
How can I find out about employment in government?• Talktogovernmentemployersatcareerfairs.
• Visiticc.ucdavis.edu/students/internships/ InternshipsbyInterests.htm, search for Government.
• Visitthefollowingwebsites: - Federal Government: www.usajobs.gov
- State of CA: www.spb.ca.gov
• Visitfederalandstateagencywebsitestolearnabouttheagency’spurpose,joblistingsandrequirements,examinformation, the hiring process, etc .
NOTE:Mostcareerpositionsinstategovernmentrequireyou to take a civil service examinationand/orcompleteanoral interview . You will achieve a numerical score on the exam which will then determine your eligibility for positions as they become available . This examination process can be lengthy, but worthwhile if you want to pursue a career in government .
How can I find out about employment in education?• Goto edjoin.org to search for jobs in schools, K-12 .
• UseAggieJobLinktoresearchschooldistrictsrecruitingat UC Davis .
icc.ucdavis.edu 9
The Internship/Job Search
How can I find out about employers?After you have identified your preferred employment sector,
research and develop a list of potential employers . To start:
• AttendemployerinfomeetingsandICCevents.
• Talktoemployerrepresentativesatcareerfairs.
• ConsulttheBookofListsforinformationaboutemployersin each city . Ask the ICC receptionst on the second floor, South Hall to view the book .
• ContacttheChamberofCommerceinthecityyouareinterestedinforinformationaboutlocal/small/privatelyowned employers: chamberofcommerce.com
• Visittheemployer’swebsite.
• Generatealistofpotentialemployersinaparticularcareer field or industry, try:
- Job Star: California Job Search Guide:
jobstar.org
• Forresearchinglargecompanies,trythesesites:
- HooversOnline: hoovers.com
- WetFeet .com: wetfeet.com
What job search sites can I use? The first preference of employers is for you to visit their websites. When searching online for a job, keep in mind that, in addition to using Aggie Job Link, you should visit:
Monster: monster.com
Career Builder: careerbuilder.com
America’s Job Bank: jobbankinfo.org
Craigslist: craigslist.org LinkedIn: linkedin.comFor a list of the employers who offer the most entry-level
jobs to college graduates, go to: collegegrad.com/ topemployers . AND don’t forget to ask ICC Coordinators for their favorite recommendations on other industry-specific job listing sites .
What if I just want a short-term, temporary position?If you want to “find a job for your year off” before graduate
school or while you travel abroad, search online or visit the ICC for a list of local temporary employment agencies . Use only “employer-paid” temporary agencies.
I know how to search for a job online. What else do I need to know?
Rememberaneffectivejobsearchusuallyrequiresmorethan just Google . Networking, Informational Interviewing, In-Person Visits, and using our on-campus Career Recruiting Programs, as well as Employment Agencies to help your job search . Read pages 7, 10 and 11 for job search help! Watch a Job Search Strategies workshop online at icc.ucdavis.edu/webshops .
For more websites about researching jobs and employers, visit icc.ucdavis.edu/students/researchhelp.htm
Managing Job Search Stress
Recent grads are surprised to discover the job search can take longer than expected . Many may have friends who luckily stepped right into a job straight out of college
andmayquestiontheirownabilitytofindwork.Whatmanydon’t know is that even in a good economy, a job search can typically take between three to six months and, in a more chal-lenging job market, even longer . Job searching is a stressful activity and when it stretches on longer than expected, stress can increase .
Here are some practical guidelines on how to view the job search and minimize stress levels:
• Jobsearchingisanumbersgame;ittakes15no’sforevery 1 yes . Don’t get discouraged by rejection . Stay positive and remind yourself that you have an excellent education and good skills . You will find a job—it takes getting the word out to everyone you know and submitting lots of resumes .
• Thinkbackonthetimesyoufacedatoughprojectorfinal exam . What stress management strategies did you
use to help you get through the situation? Use those same techniquesnow.Herearesomeideas:
4 Takegoodcareofyourself:getadequaterestandexercise .
4 Learn to distinguish things you can change from those beyond your control .
4 Find support from family and friends . Keep in touch with fellow job searchers—having someone to compare notes with is a good way to keep things in perspective .
4 If you feel overwhelmed and unable to deal with stress, find help through on-campus and community resources . Counseling and Psychological Services can assist currently enrolled students and provide refer-rals for alumni caps.ucdavis.edu . If you move outside the local area, contact the psychological counseling office of any major university for local referrals .
10 University of California, Davis
There are many ways to look for a job, some of which are better than others . Presented below are some of the most popular ways, as well as helpful hints and pros and cons of each .
Strategy Tools Pros Cons Helpful Hints
CAREER FAIRS Attend job fairs to network with recruiters and pass out copies of your resume .
•Fairinformationis available at icc.ucdavis.edu•Bulletinboardsandemails
Small amount of time to develop network of contacts . Guaranteed access to more than one employer of interest . Get pre-selected for on-campus interviews .
Student traffic can be heavy . Arrive early to maximize time .
•Followuponleadsand networking opportunities .•Obtainalistofcompanies
in advance to create a plan of action .
INTERNET Search online job banks and company websites . Submit resumeonline/postonjobboards .
•AccesstotheWeb•Electronicresume•AggieJobLink•USAJobs•CAStatePersonnelBoard
Actual job openings . Many employers use a wide variety of job listing services . Many listings have free to low-cost access . Worldwide geographic reach .
Competition is growing as use of the Web increases . Pay attention to multiple listings—one position posted on a few sites —to avoid applying multiple times .
•UsetheWebfrequentlyas information and sites changequickly.
TARGETED MAILING Develop a good cover letter tailored to a specific type of job and the needs of the company . Send letter with resume to selected companies .
•Listofwell-researchedcompanies•Tailoredcoverletters•Resumes•Emailandfax
Better approach than the mass-mailing method . Investment of time and effort should merit stronger response from employers .
Requiresasignificantinvest-ment of time in researching companies and writing cover letters as well as following up with contacts .
•Trytofindoutwhoisincharge of the area in which you want to work; send your materials to that person . Great method when used in conjunction with networking .
IN-PERSON VISIT Visit many companies . Ask to see someone in a specific department . Submit resume and application, if possible .
•Businessattire•Companyaddresslist•Resumes
Resume and application are on file with the company .
Requiresagreatdealoftimeto make a relatively small number of contacts .
•Researchthecompaniesprior to your visit . Ask for a specific person or ask about a specific type of job .
NETWORKING Approximately 80% of jobs are obtained through net-working . Talk to everyone you know to develop a list of possible contacts; ask for informationonjob/companiesand to circulate your resume .
•Listofcontacts•Resumes•Businessattire•Socialmediasitessuchas
May learn of unadvertised openings . May result in a courtesy interview . Often results in a closer match of your interests to a job .
A contact in itself is not enough to get you a job . You may exhaust all leads without landing a job . Quite time-consuming .
•Followthroughonallleads.•Keepbroadeningyour
network of contacts .
ON-CAMPUS RECRUITING Follow specific pro cedures to secure on-campus interviews .
•Schedulinginterviews•Employerliterature•Resumes•Businessattire
One of the primary ways in which companies recruit for technical and business posi-tions .
May be less effective for non-technical/businesscan-didates .
•Use the interview schedule as a way to identify possible employers, even if you don’t get to interview on campus with those employers .
Adapted and reprinted with permission from Career Services, Pennsylvania State University, University Park, PA.
PRINT/ELECTRONIC RESOURCES Scan want ads . Mail resume with cover letter tailored to specificjobqualifications.
•Newspapers•Journals•Newsletters•Trademagazines•Coverletters•Resumes
Involves minimal invest-ment of time in identifying companies . Resume and cover letter are sent for actual job opening .
Resume and cover letter will compete with large number of others . Ads follow job market; least effec-tive in times of economic downturn .
•Useasameteronthejobmarket in a certain career field .
•Trytogetyourmaterialsin as early as possible .
ONLINE NETWORKING Create a profile on profes-sional networking sites such as LinkedIn . Increasingly, recruiters are using online networking sites to source candidates .
•AccesstotheWeb•Listofpeopletoinvitein
as your contacts
Good way to find networking contacts, as well as profes-sional groups for researching and networking .
Takes a small amount of time to set up profile
•Everythingyoupostshouldbe strictly professional in tone and content .•Youcanusesocial
networking sites like Facebook, too .
The
Inte
rnsh
ip/J
ob S
earc
h
Job Search Strategies
icc.ucdavis.edu 11
The Internship/Job Search
M ost job opportunities are never formally published . Networking is the key to finding those jobs that are just waiting for you in the “hidden” job
market.
What Is Networking?Networking is the process of developing reciprocal rela-
tionships with others who can support you in your internship or job search . It’s an information exchange between you and peopleyouknoworacquaintanceswho,overtime,canhelpyou in your search and career development .
Eight Tips for Networking1) Identify Your Network
You may not realize it, but you already have a network . Create a worksheet listing all your personal contacts under theseheadings:family,schools,employers/co-workers(pastandpresent),neighbors,friends,workingprofessionals,volunteers, faculty, advisors, UC Davis alumni, clubs, sports, religious communities, etc . Look at your list of contacts . Don’t forget to look into your Facebook contacts . Who on the list can provide you with relevant career information, has the power to hire you or can refer you to another contact?
2) Develop Your NetworkYou may develop your network one-to-one, at a networking
event or online .One-to-one: Contact the people in your network by
telephone, letter or email . It’s best to arrange an in-person visit ifpossible.Yournetworkmeetingshouldinclude1)Anintro-duction,ifnecessary;2)Apersonal “overview”(prepareascriptaheadoftime);3)Prepared questionstoask;4)Asking for referrals(theseareyournextsetof“leads”thatwillhelpyouexpandyournetwork);5)Sharing your resume if appro-priate;6)Closing(remembertothankyourcontactforhisorhertimeandassistance.)Toviewasamplenetworkingletter,visit icc.ucdavis.edu/students/ntltr.htm .
At a networking event: On campus, you can attend career fairs, company information meetings, club and organiza-tion events, and you can even network in class! Off-campus networking opportunities include job or career fairs, trade-shows, conventions and conferences, employer visits, or participation in civic groups or religious organizations .
Online: Through social networking sites like LinkedIn, you can connect with employers, professionals in your field, profes-sional associations and alumni . Join the UC Davis Internship and Career Center LinkedIn group to start networking online today . ICC coordinators are available in the group to address etiquetteandstrategy-relatedquestions.Professionalismonlineis just as important as in person .
3) Create Your Personal Script (A “One-Minute Commercial”)Know yourself and be prepared with a summary of your
talents, skills, accomplishments, interests and goals . Highlight your background and experience .
Practice your “commercial” so it sounds natural and spon taneous and makes a positive first impression . Here’s an example:
“Good morning, Mr . Jones . My name is Jason King . I will complete my bachelor’s degree at UC Davis in Design in June and am seeking an entry-level position in Interior Design . I completed an internship recently with another design firm where I learned a lot about the interior design process including use of color, furniture and fabric selection, and overall space planning . Your firm, ABC Interiors, has the reputation as the region’s premier design firm and I am very interested in your current opening for a Design Consultant . Can you tell me a little about what it is like to work at ABC Interiors?”
4) Know How to Start Your ConversationWhenindoubt,useanicebreakerquestiontostartyour
networking conversation . Read page 7 for a list of great suggestions .
5) Be ProfessionalDo not ask your contacts for a job . The purpose of your
networking meetings is to gain advice and information from your contact . Put your best foot forward by starting with a firm hand shake, engaging in meaningful conversation about the field, being respectful of your contact’s time, avoiding sharing your life’s history and thanking the person after your meeting .
6) Ask for referralsThe people with whom you are networking may not have
a job opening, but they may know someone who is hiring . The key is to obtain additional referrals each time you meet someone new . Be sure to mention the name of the person who referred you .
7) Develop a SystemOrganize and track your networking contacts and meetings .
Update it with the names of new leads and information about how you followed through .
8) Maintain Your ConnectionsStay connected with your contacts as you continue to
develop your career plan . Update them with the results of any referrals or let them know how the discussion helped you in a given situation .
Important Protocols• Alwayssendathank-younoteoremail.• Requestfollow-upassistance,coachingoradvice.• Bepatientbutpersistentwithyourleads.• Rememberthatitisareciprocalrelationship,soalwaysask
yourself, “What can I do to help this person?”• Followuponanypromises.
Networking: The Number One Job Search Strategy
12 University of California, Davis
T he friendly and informal format of a career fair makes iteasytoaskquestions,exploreinternshipandcareeroptions, develop a network of professional contacts,
identify job openings and even land an interview… in a short amount of time! Here are some tips to help you make the most of your time at a fair .
What to expect at the fair...A typical career fair at UC Davis attracts 1,500-2,500
students and alumni and up to 178 employers . Allow yourself adequatetime.Fairsaretypicallylesscrowdedinthemorninghours and busiest during the lunch hour . Just have a few minutes? Don’t let a limited amount of time keep you from attending the fair.
Market yourself...A career fair is not the place to be passive or shy . Be ready
with a one-minute commercial of the skills and talents that set you apart from others who are competing for the same job( seepage11).Rehearsingyour“pitch”willhelpyoufeel and appear more confident, organized, and focused . For assistance in preparing a persuasive, upbeat and convincing “commercial,” visit the Internship & Career Center for help .
Research companies...See ICC’s website ( icc.ucdavis.edu), click on
Internship & Career Fairs for the list of companies, company descriptions and possible links to company websites and jobs . Update your knowledge of current events by watching news and business reports on TV or reading online .
Bring copies of your resume...Be sure to have your resume reviewed by an ICC student
or staff advisor before distributing it . See pages 17-25 for example resumes .
First impressions last...Greet recruiters with confidence, enthusiasm and a firm
handshake . Smile, make eye contact and don’t forget to express interest in their companies and internship, summer or career opportunities . Remember to ask for a business card for follow-up with that company .
State your purpose...When job hunting, state the type of position you are
seeking . Dress in business casual or professional attire . Getcompleteinformationonhowtoapplyand/orcontactinformation .
After the fair...Contact those companies in which you are most interested .
Be sure to mention in your letter how you made contact at the fair . Include an updated, tailored copy of your resume .
Internship and career fairs serve as recruiting tools for many employers and are popular events for savvy students . Following are the fairs you can look forward to in 2012-2013 . Visit our website for dates, times and participating employers .
Study and Intern Abroad FairCome learn about the world of internship and study abroadopportunitiesthatawaityou.(FallQuarter)
Fall Internship and Career FairAn annual event for all students, all majors . It’s a great waytokickofftheschoolyear!(FallQuarter)
Community Service FairA great opportunity to explore community service internshipsand/orcareeropportunitieswithnon-profitorganizations.(FallQuarter)
Engineering and Physical Sciences Internship and Career FairA huge event for engineering, physical and computer science students . Great for experience and networking! (WinterQuarter)
Winter Internship and Career FairAll students and every major are encouraged to attend . A great opportunity to network with employees and find internshipsandcareers.(WinterQuarter)
Spring Internship and Career FairAttend the last fair of the year to find a summer job, internshiporcareer.Allmajorswelcome!(SpringQuarter)
Career fair etiquette...Be polite and courteous to everyone . Don’t interrupt the
employer respresentatives or other career fair attendees . If you’re unable to speak to the representative immediately, consider visiting another employer and then returning . Don’t drop off your resume without speaking to the representative . Personal interaction could be key to your success . And finally, feel free to take the “give-aways,” but only if you’ve talked with the representative—to “grab and go” is a no-no!
Attend an ICC “Prepare for the Fair” workshop . Learn how to prepare, what to wear, what to ask and how to follow up . For dates visit icc.ucdavis.edu
How to Prepare for the FairTh
e In
tern
ship
/Job
Sea
rch
icc.ucdavis.edu 13
ExampleIf the only job you have ever had is working at a hamburger restaurant—what skills have you gained from this experience that are related to a lab research position?
•Followingprotocol •Cleanliness
•Timemanagement •Teamwork
Instead of focusing on the obvious: handling cash, making hamburgers and fries . Show your reader what skills you have gained that are related to the position you are applying for .
Transferable SkillsThe Internship/Job Search
CommunicationThe skillful expression, transmission and interpretation of knowledge and ideas.
__Speaking effectively__Writing effectively__Listening attentively__Expressing ideas__Facilitating discussions__Providing feedback__Negotiating__Persuading__Perceiving non-verbal messages__Presenting information__Describing feelings__Interviewing__Editing
Research & PlanningThe search for specific knowledge and the ability to conceptualize future needs and solutions.
__Predicting__Creating theories and ideas__Identifying problems__Imagining alternatives__Identifying resources__Gathering information__Solving problems__Setting goals
__Extracting information__Defining needs__Developing evaluations__Creating spreadsheets and databases__Calculating results
Human RelationsThe use of interpersonal skills for resolving conflict, relating to and helping people.
__Developing relationships__Being sensitive__Listening__Conveying feelings__Providing support__Motivating__Sharing credit__Counseling__Cooperating__Delegating with respect__Representing others__Perceiving feelings, situations__Asserting
Organizing, Management & LeadershipAbility to supervise and guide individuals and groups in the completion of goals.
__Initiating new ideas__Handling details
__Coordinating tasks
__Managing groups
__Delegating responsibility
__Teaching
__Coaching
__Organizing
__Advising
__Promoting change
__Selling ideas or products
__Decision making with others
__Managing conflict
__Enforcing policies
Character TraitsThe daily skills that assist in promoting effec-tive production and work satisfaction.
__Implementing decisions
__Cooperating
__Being punctual
__Managing time
__Attending to detail
__Meeting goals
__Enlisting help
__Accepting responsibility
__Setting and meeting deadlines
__Making decisions
Write Accomplishment PhrasesSet your resume apart from the compe-tition’s by listing your experiences as accomplishments rather than a listing of duties.UsetheSTARtechnique:
• S – Write about your work, school or volunteer environment and your role .
• T – Write about the task or problem you identified .
• A – Write a few sentences about the action you took to address the situation .
• R – Write a few sentences about the result your action had .
For example, “When I interned at the pediatric clinic, the sample medications cabinet was disorganized and it was difficult for the physicians and staff to quicklylocatesampledrugs.Idecidedto completely reorganize the cabinet and create a log sheet using Excel to track the supplies . As a result, the doctors andstaffwereabletoquicklyfindthenecessary patient medications and we
were able to reorder medications before running out .”
These sentences can be boiled down to a brief bullet statement on your resume as such:
• Reorganizedmedicationscabinetand created Excel spreadsheet tracking log which ensured sufficient productquantitiesandquickaccessand location of all sample drugs by physicians and medical staff .
Below is a list of five broad skill areas which are divided into specific skill sets . Use a
checkmark to indicate which skills you’ve developed . Write down examples of when you used your strongest skills and describe what the end result was .
14 University of California, Davis
Purpose Your resume is a concise summary of your education, experience, skills and accomplishments . The resume is a marketing tool to entice your reader to invite you to an interview! Employers are looking for well-rounded applicants intheseareas:academic,workaccomplishmentsandinterests/activities . Incorporating these three categories into your resume will demonstrate your overall accomplishments . There is no one perfect resume or resume format .
General Resume Guidelines•Onepageforrecentgraduates;twopagesifyouhave
extensive work history . Do not put more than 10+ years on your resume .
• Directthereader’seyeusinglayout/headings.
• Proofread!Notypographical,spellingorgrammaticalerrors.Don’t rely on spell-check .
• Tailorcontentstoeachjob/application.
• Listinformationinreversechronologicalorder.
• Sellyourself—beselectiveaboutwhatyouincludeand organize information logically .
• Useconsistentverbtense.
• Somejobboardsandemployersitesaskyoutouploadatextversionofyourresume( seepage26).
Let’s Get Started!1 . List accomplishments .
2. Analyze job description—highlight the most important skills and qualifications and incorporate these keywords into the resume.
Arts and Communication• Portfolios/worksamplesarerequiredandshouldbenoted
onresume:“Portfolioavailableuponrequest.”
• Graphicsareinvitedinthisfieldandwillbeseenasademonstration of your creativity .
• It’sOKtotranslateyourinternshipsintojobtitlesthataccu-rately describe your duties, e .g ., Public Relations Assistant .
• Forjournalismopportunities,includefluencyinotherlanguages .
Business• Inmostcases“management”isn’taveryrealisticobjective.
Focus on a particular area—finance, marketing, human resources—and express long-term interest in management .
• Businessemployersareinterestedinresults.Besureyourresume highlights specific achievements, times when you exceeded goals, etc .
• Quantifyyourexperience:“Increasedsalesby30%.”Showaccomplishments in previous experience .
• Stresstangibleleadershipexperiencewhenlisting extracurricular involvement .
• Listtransferableskillssuchastimemanagement,conflictresolution and decision making .
Human Services• Formanyoftheseoccupations,experienceasavolunteer
is considered a strong measure of knowledge and commit-ment . List key responsibilities and outcomes .
• Forteachingjobs,experienceyouhadworkingwithyoungpeopleandanytutoring/teachingexperienceareimportant.
Life Sciences/Physical Sciences• Researchandlabtechniquesshouldbelistedforjobsin
thesefields.Listscientifictechniquesyouaremostfamiliarwith or have recently used .
• Sincetheemployerwillbelookingforcertainmajors,youreducation should be near the top of your resume .
• Healthcarejobsplaceastrongemphasisuponcommunica-tion skills, including bilingual ability .
• Includescienceorganizationmemberships.
Technology• Employersinthisfieldpreferobjectivesthatareprecise,
indicating a particular area of interest or expertise .
• Includetechnicalcourses/projectstosupportinterestandobjective .
• GPAshouldbeincluded.
• Breaktechnicalskillsintosubcategories.Thiswillmakeiteasier for the reader to pick up the specific skills they are lookingfor.(i.e.,OperatingSystems,Hardware,Software,NetworkingandProgrammingLanguages.)
• Besureyourresumeisloadedwithkeywordsdenotingskills . Have a text version of your resume for sites requestingthisformat.
• Includingbothtechnicalandnon-technicalworkexperi-ence demonstrates experience working in professional settings .
Adapted from UCSD Career Services Center
Resume Tips for Specific Fields
ResumesRe
sum
es a
nd C
orre
spon
denc
e
icc.ucdavis.edu 15
Resume ContentResum
es and Correspondence
Content Essentials Hints
These components are ESSENTIAL for EVERY resume.
Contact Information
Education
Relevant Experience
The following categories are usually included on a resume—include the categories that best describe your skills and experience.
Objective
Skills/Abilities
Group/Class Projects/Relevant Coursework
Honors and Awards
Travel
Research/Publications
Volunteer Activities/Community Service/ Leadership
Certifications/Licenses
References
Name, address, phone number, email and web address you would like employers to see .
Make sure email address, phone number and webpage are “employer appropriate” and typo-free .
Name of school, degree earned, major and minor, expected graduation date and depending on the field, GPA ( seepage17).
List your highest degree first followed by other degrees you have received . List Education Abroad .
Job title, company name, dates of experience, describe job duties, significant accomplishments and contributions .
Include paid and non-paid positions, internships and military duty . Present achievements, contributions and results .
A one-line description of position desired .
Should be specific rather than a general statement .
Identify skills the employer is looking for . They may be grouped by category such as: •language,•laboratory, or•computer skills
List only the skills you can perform with little or no supervision . Think about“TransferableSkills”( see page13).
Relevantclassesand/orprojects.
Current students or recent grads can include honors and scholarships . Be sure to include a description .
Project title, where published and when .
List countries and travel experiences, if relevant to position for which you are applying .
Listorganization,office(s)heldandabrief description of accomplishments .
List if applicable to the position for which you are applying .
You do not need to end your resume with “References Available Upon Request”sincetheemployerknowsthisalready . Use the extra space to expand on accomplishments .
Always take a typed list of your references totheinterview( see “Asking for a Reference or Letter of Recommendation” onpage35forspecificinformation).
Can be listed separately or as a subsection under Education .
List the course title, not the course number .
May want to place internship positions under Experience section .
16 University of California, Davis
Management Skillsadministeredanalyzedassignedattainedchairedconsolidatedcontractedcoordinateddelegateddevelopeddirectedevaluatedexecutedimprovedincreasedorganizedoversawplannedprioritizedproducedrecommendedreviewedscheduledstrengthenedsupervised
Communication Skillsaddressedarbitratedauthoredcollaboratedconvincedcorrespondeddraftededitedformulatedinfluencedinterpretedlecturedmediatedmoderatednegotiatedpersuadedpromotedpublicizedspoketranslatedwrote
Research Skillsanalyzedclarifiedcollectedcritiqued
diagnosed
evaluated
examined
extracted
identified
inspected
interpreted
interviewed
investigated
organized
reviewed
summarized
surveyed
systematized
Technical Skillsassembled
built
calculated
computed
designed
devised
engineered
fabricated
maintained
operated
overhauled
programmed
remodeled
repaired
solved
upgraded
Teaching Skillsadapted
advised
clarified
coached
communicated
developed
enabled
encouraged
evaluated
explained
facilitated
guided
informed
instructed
set goals
stimulated
trained
Financial Skillsadministeredallocatedanalyzedappraisedauditedbalancedbudgetedcalculatedcomputeddevelopedforecastedmanagedmarketedplannedprojectedresearched
Creative Skillsacted conceptualizedcreatedcustomizeddesigneddevelopeddirectedestablishedfashionedillustratedinitiatedinstitutedintegratedintroducedinventedoriginatedperformedplannedrevitalizedshaped
Helping Skillsassessedassistedclarifiedcoachedcounseleddemonstrateddiagnosededucatedfacilitatedfamiliarizedguidedmotivatedreferred rehabilitated
representedvalidated
Administrative or Detail Skillsapprovedarrangedcataloguedclassifiedcollectedcompileddispatchedexecutedgeneratedimplementedinspectedmonitoredoperatedorganizedpreparedprocessedpurchasedrecordedretrievedscreenedspecifiedsystematizedtabulated
Leadershipachievedcoordinated
delegated
developed
directed
enlisted
executed
expanded
expedited
founded
improved
initiated
pioneered
recruited
reduced(losses)
resolved(problems)
restored
spearheaded
transformed
Adapted from The Damn Good Resume Guide by Yana Parker, Berkeley: Ten Speed Press.
Use strong actions verbs to describe your experience and skills . Choose words from the lists below to express yourself .
Resu
mes
and
Cor
resp
onde
nce
Verb List for Resumes & Letters
icc.ucdavis.edu 17
Freshman ResumeResum
es and Correspondence
Emma DacuyanCampus Address: Permanent Address:
My Dorm Room
12345 Elm Street
Tercero Hall
Any Town, CA 94567
Davis, CA 95616
(555)321-456x
Email: [email protected] Work study job that will combine my interpersonal and writing skillsEDUCATION
University of California, DavisBachelor Degree Expected June 2015, Major not yet declaredCoursework related to position: Beginning Composition, Children in the Garden (Enrolled Spring 2012)SKILLSComputer: Proficient in Word, use of Internet search engines, Outlook and email in
both PC and Mac environmentsLanguage: Fluent in spoken Tagalog (minimal written ability)Character Traits: Punctual, attentive to detail, organized, cooperative, patientEXPERIENCE
Receptionist, T & T Electronics, Any Town, CA 6/10-8/10Created a welcoming atmosphere for mid-sized manufacturing firm. Used proactive
communication to effectively manage Outlook calendars for four busy sales people.
Kept office clean and organized. Ensured packages were mailed in a timely manner
using the most cost effective carrier for the transaction.Child Care Provider, Self Employed, Any Town, CA 6/08-PresentProvide safe, reliable care for children (infant to12 years) in their homes. Effectively
adapt communication style and planned activities to meet the developmental needs of
children and create a positive experience. Partnered with parents to ensure consistency
and clear boundaries with children. Rapport building and reliability resulted in extensive referrals.
ACTIVITIES• Member, UC Davis Intramural Volleyball• Member, Any Town High School Marching Band, 8/06-11/10
18 University of California, Davis
Resu
mes
and
Cor
resp
onde
nce
Chronological Format for Internship Position
Jamar Jackson
jjackson@ucdavis .edu
Local Address:100AlvaradoAvenue,Davis,C
alifornia95616.(530)753-XXXX
Permanent Address: 123 Clover Lane, Any City, California 9XXXX.(555)421-XXXX
OBJECTIVE
A laboratory research internship with ABC Company .
EDUCATION
Bachelor of Science in Biological Sciences, June 20XX
University of California, Davis
RelatedCourseWork:GeneralC
hemistry(Lab),Microbiology(L
ab)
OrganicChemistry(Lab),Zoolo
gy(Lab),Biology
SKILLS
• Familiar with buffer preparation, microscopy, pH meter, and analytical balances .
• Excellent ability to accurately keep laboratory records .
• Experience using Microsoft Word, Excel and Access in PC and Mac platforms .
SPECIAL PROJECT
Iodine Shortage Project, UC Davis, Davis, CA1/XX-present
Worked with a group of seven students raising over $10,000 to help the current iodine shortage
in Indonesia . Raised funds for research, iodine distribution and literature . Researched the effects
of iodine deficiency and developed promotional materials including posters and flyers for in-class
presentations . Raised funds through classes, friends and on-campus activities, including numerous
presentations to sororities and fraternities .
EXPERIENCE
Shift Leader, In-N-Out Burger, Davis, CA10/XX-present
• Provided outstanding customer service and handled customer complaints .
• Acted as cashier; entrusted by supervisor to record and deliver bank deposits .
• Trained and supervised ten staff members . Provided input for new hire
performance reviews and identified areas for additional training .
• Maintained accurate inventory count of all products .
• Ensured proper food sanitation procedures were followed
by strictly adhering to all food handling safety protocols .
ACTIVITIES
Volunteer, Emergency Room, UC Davis Medical Center
Activities Coordinator, Black Student Union
Member, Biological Sciences Club
No need to mention
whether a position is paid
or voluntary.
Visit icc.ucdavis.edu for additional tips on writing your resume.
icc.ucdavis.edu 19
Resumes and Correspondence
Job Landis123 Maple Avenue • Davis, CA 95000 • 530-555-5555 • [email protected] position as a Laboratory Research AssistantEDUCATIONBachelor of Science in Biological Sciences, University of California, Davis Anticipated Graduation date June 20XXRELEVANT COURSEWORKMolecular and Cellular Biology (Lab) Pathology Organic Chemistry (Lab)
Neurobiology Microbiology Chemistry (Lab)LABORATORY SKILLSSDS-PAGE PCR/cloning
ELISAGas chromatography UV/VIS Spectrophotometry Computer data analysis
Microscopy DNA extraction/quantification Amino acid analysisSUMMARY OF QUALIFICATIONS• Familiar with fundamental lab procedures including pipetting, buffer preparation and SDS-PAGE
• Intelligent, analytical and highly motivated; ability to multitask, attentive to details• Excellent communication skills; dedicated to professionalism and high-quality work
• PC skills: Word, Excel, PowerPoint, Access• Fully fluent both orally and written in English and SpanishEXPERIENCEClinical Pathology Intern, Department of Clinical Pathology, UC Davis 5/XX-9/XX
• Developed a buffer system for liquid chromatographic isolation of pesticide metabolites in urine
• Accurately performed gas chromatography on purified samples• Recognized by supervisor for outstanding contributions to successful research project completionTeam Lead, Best Burgers, Davis, CA
6/XX-9/XX, 6/XX-9/XX
• Placed orders and performed cashiering duties in high-volume fast food establishment
• Suggested new method of packaging orders which reduced customer wait time by approximately 50%
• Promoted to Team Lead after 60 daysACTIVITIES/LEADERSHIPPresident, Biological Sciences ClubSwimming, Intramural basketball
COMMUNITY SERVICESociety for Prevention of Cruelty to AnimalsHabitat for Humanity
Laboratory Research Assistant
Visit icc.ucdavis.edu for additional tips on writing your resume.
20 University of California, Davis
Chronological Format for Career PositionA chronological resume presents your education and work experience in a straightforward, reverse chronological order format, listing your current or most recent job first . If the majority of your work experience is related to your stated job objective, the chronological format is generally preferred .
ANH NGUYEN
Campus
Permanent
999 University Avenue
XXX Green Street
Collegetown, CA 99999
San Francisco, CA 12345
(530) 75X-XXXX
(415) 48X-XXXX
OBJECTIVE A career position in sales and marketing at Dream Job International Co.
EDUCATION Bachelor of Science in Managerial Economics with a minor in Communication
University of California, Davis, June 20XX
Carlos University, Education Abroad Program, Madrid, Spain, Summer 20XX
SKILLS Computer: Proficient in MS Word, Excel, email and Internet Explorer in PC and Mac
environments.
Language: Knowledge of Vietnamese and Spanish (written and spoken).
Communication: Able to write clearly and convincingly and give public presentations to large
groups.
RELEVANT EXPERIENCE
Marketing/Sales Intern, Progressive Microproducts, Sacramento, CA (6/XX–Present)
Market personal computer hardware and software. Develop and implement marketing and
advertising strategies. Design and develop educational and entertainment software for Apple
computer system. Participate in numerous computer trade shows hosting more than 3,000 visitors
and more than 150 vendors.
Management Trainee/Salesperson, Grand Auto, Inc., Davis, CA (5/XX–9/XX)
Performed sales work for auto parts store with annual sales exceeding $35 million. Worked
effectively with customers and employees. Maintained a large store inventory using a
computerized inventory system. Supervised and trained a sales force of 34 representatives.
Implemented parts department reorganization for enhanced work flow. Developed effective
in-store and window displays.
Salesperson, Consumer Distributing Company, Woodland, CA (9/XX–4/XX)
Performed general merchandise sales for large catalog chain store. Processed over $10,000 per
week in cash, checks and credit cards, performed inventory control, and completed clerical tasks.
Received quarterly awards for sales performance.
LEADERSHIP Fundraising Chairperson, Delta Sigma Pi, a business fraternity (dates)
Member, Vietnamese Student Association (dates)
Visit icc.ucdavis.edu for additional tips on writing your resume.
Resu
mes
and
Cor
resp
onde
nce
View Anh Nguyen’s online resume on page 26.
icc.ucdavis.edu 21
Resumes and Correspondence
ANH NGUYENXXX Green StreetSan Francisco, CA 12345(415)48X-XXXXanguyen@ucdavis .edu OBJECTIVE A career position in sales and marketingEDUCATION Bachelor of Science in Managerial Economics with a minor in Communcations
University of California, Davis, June 20XX
Carlos University, Education Abroad Program, Madrid, Spain, Summer 20XXSUMMARY OF QUALIFICATIONS • Threeyearsincreasedresponsibilityinsales • Extensiveandup-to-dateknowledgeofthecomputersoftwareindustry
• Receivedawardsforsalesperformance • ProficientinWord,Excel,emailandInternetExplorerinPCandMacenvironments.
• KnowledgeofVietnameseandSpanish(writtenandspoken)Marketing/Sales •Marketedpersonalcomputerhardwareandsoftware • Developedandimplementedmarketingandadvertisingstrategies • Performedsalesworkforautopartschainstorewithannualsalesexceeding$35million
• Recognizedforimpressivesalesrecordandreceivedquarterlyawardsforoutstandingperformance
• Performedgeneralmerchandisesalesforlargecatalogsalesstore • ParticipatedinnumerouscomputertradeshowsOrganization/Planning • DesignedanddevelopededucationalandentertainmentsoftwareforApplecomputersystem
• Implementedpartsdepartmentreorganizationforenhancedworkflow
• Developedeffectivein-storeandwindowdisplaysCommunication Skills • Communicatedeffectivelywithcustomersandemployees • Revisedpolicymanualsanddevelopedcurriculafortrainingsessions
• Supervisedandtrainedsalespersonnel • Gavepresentationstogroupsof150ormorepeopleEMPLOYMENT HISTORY Marketing/Sales Intern,ProgressiveMicroproducts,Sacramento,CA,6/XX–Present
Management Trainee/Salesperson,GrandAuto,Inc.,Davis,CA,5/XX–9/XX
Salesperson,ConsumersDistributingCompany,Woodland,CA,9/XX–4/XXACTIVITIES Fundraising Chairperson, Delta Sigma Pi, a business fraternity Member, Vietnamese Student Association
A functional resume concentrates on skills you have demonstrated that relate to your stated objective rather than on the jobs you have held . This format is particularly effective if your past work experience is not directly related to your job objective, if you are changing careers or if you are seeking a promotion . Choose broad skill categories appropriate to the desired job and detail how you havedemonstratedthosesameskillsinpastpositions/jobs.
Functional Format for Career Position
Visit icc.ucdavis.edu for additional tips on writing your resume.
View Anh Nguyen’s online resume on page 26.
This type of objective is excellent for career fairs.
22 University of California, Davis
Theresumebelowusesachronologicalformat.Yourresumeshouldrepresentyou.BesuretohaveyourresumedraftcritiquedbyanICC staff member .
AUDREY KIM
1122 Aggie Avenue t Apt, # 33 t Davis, CA 95616
(530) 757-XXXX t (415) 48X-XXXX
OBJECTIVE Environmental Planner position with XYZ Consulting
EDUCATION Bachelor of Science, Environmental Policy Analysis and Planning
Bachelor of Arts, Communication
University of California Davis, June 20XX
Related Course Work:
Environmental Impact Reporting using GIS, Urban and Regional Planning,
Environmental Law, Water Policy and Politics, Urban Geography
SKILLS Familiar with CEQA, NEPA and CWA
Working knowledge of environmental impact assessments
Proficient in applications of Microsoft Office Suite, ERSI and ArcGIS
Excellent writing and editing skills
EXPERIENCE Planning Intern, Sacramento County Planning and Community
Development Department, Sacramento, CA 10/XX - 3/XX
Created a database of employment and housing for Sacramento County.
Conducted a jobs/housing balance study as directed by the General Plan.
National Network of Environmental Management Studies Fellow,
U.S. Environmental Protection Agency, Philadelphia, PA 6/XX - 9/XX
Reviewed and provided comments on Environmental Impact
statements. Formulated plan to coordinate Geographic Information
System data among different federal agencies. Participated in significant
public outreach efforts.
Environmental Education Intern, Student Landowner Education and
Watershed Stewardship Program (SLEWS), Davis, CA 1/XX - 4/XX
Planned and led high schools students in agricultural and stream corridor
restoration projects. Researched and taught students about native
species interaction and local ecosystem sensitivity. Designed, constructed
and maintained composting piles for on-site teaching purposes.
ACTIVITIES Association of Environmental Professionals, Student Member, 20XX - present
American Planning Association, Student Member, 20XX - present
Volunteer, Focus the Nation, UC Davis, January 20XX
Volunteer, Whole Earth Festival, Spring 20XX
1
2
3
A specific objective is highly recommended . However, a more general objective can be used at career fairs .
This is a sub-category of EDUCATION . The title should be bold, lower case, and indented .
If you have performed the protocol several times you may list your ability to perform procedures used in a lab as “adept at,” “proficient in” or other accurate terms .
1
2
3
t Double majors indicate: “Double Majors in ___ and ___” or state “Bachelor of Arts in ___, Bachelor of Science in ___ .”
Chronological Format for Entry-Level Career Position
Visit icc.ucdavis.edu for additional tips on writing your resume.
Resu
mes
and
Cor
resp
onde
nce
View Audrey Kim’s cover letter on page 38 and her list of references on page 35.
icc.ucdavis.edu 23
Resumes and Correspondence
MARIA GARCIALocal Address Permanent Address55 College Drive 1930 Grape AvenueDavis, CA 95616 Fairfield, CA 94533(530)75X-XXXX
mgarcia@ucdavis .edu
OBJECTIVEResearch position in biochemistry laboratory .
EDUCATIONBachelor of Science in BiochemistryUniversity of California, Davis Degree expected December, 20XX
SKILLSProtocol design for proteolytic digests SDS-PAGEGaschromatography UV/VISSpectrophotometryHPLC
Computer data analysisAbility to keep accurate laboratory records Laboratory animal handling
RESEARCH EXPERIENCEProtein Biochemistry Intern,Genentech,Inc.,SanFrancisco,CA.(JunetoSeptember20XX)Investigated structure-function relationships of interferon . Experiments included the use of limited proteolitic digests, SDS-PAGE, and HPLC .
Clinical Pathology Intern,DepartmentofClinicalPathology,UniversityofCalifornia,Davis.(March to June 20XX)Developedabuffersystemforliquidchromatographicisolationofpesticidemetabolitesin urine . Performed gas chromatography on purified samples .
LABORATORY ANIMAL HANDLING EXPERIENCELaboratory Helper,AnimalScienceDepartment,UniversityofCalifornia,Davis.(MaytoJuly20XX)Maintained murine colony used for transgenic experiments .
POSITION HELD TO FINANCE EDUCATIONSalesperson,Macy’s,Sacramento,CA.(MaytoSeptember20XX)Provided customer service, engaged in sales transactions, public relations, inventory control and balanced cash register receipts .
ACTIVITIESPresident, Biochemistry Club Member,Chicanos/LatinosinHealthEducationSwimming, intramural basketball
Thecombinationchronological/functionalresumeuseselementsofbothstyles.Thequalifications(areasofeffectiveness)ofthefunctionalresumeremainwithinspecificjob/experiencedescriptions.Thejobs/experiencesarethengroupedandcategorizedto show the strengths in two to four categories . This resume format is effective if at least some of your experience is related to the job objective, and also when the job objective has more than one component and you have experience in these different components (e.g.,technicalandmanagement;salesandorganizational).
Combination Format for Research Position
Visit icc.ucdavis.edu for additional tips on writing your resume.
24 University of California, Davis
The skills you gain from going abroad or working internationally can give you a competitive edge . Below is an exmple of how to highlight your international experience and skills gained .
MOHAMED SINGH(530) 555-5555
Permanent Address
Campus
123 Main Street
789 University Avenue
San Jose, CA 95116
Davis, CA 95616
(408) 555-5555
OBJECTIVE: Foreign Service Officer position with U.S. Department of State.
EDUCATION Senior standing, International Relations and French double major
Bachelor of Arts degrees expected June 20XX
University of California, Davis GPA: 3.23/4.00
Junior year at the University of Lyon II and l’Institut d’Etudes Politques—Lyon, France
SKILLSComputer: Advanced proficiency in Word, Excel, PageMaker, email and Internet applications, Proficiency
in PowerPoint, Familiar with PCs and MACs, Experience with LoanQuest loan processing software
and OMS web-based billing database
Languages: Professional fluency in written and oral French, Conversant in Farsi (limited written ability),
Elementary knowledge of written and oral Spanish
Character Traits: Excellent interpersonal communication skills, strong writing aptitude, confident, work
well in teams, culturally aware, sociable, leadership competent, teachable, and honest
RELEVANT EXPERIENCE
Intern, State Senate Office of International Relations, Sacramento, CA (9/20XX – 1/20XX)
Attended official meetings weekly between foreign dignitaries and Senators and/or Senate staff.
Communicated with Senate staff and Capitol staff to arrange meetings for incoming international
delegates. Performed open source research on foreign countries and summarize pertinent information
for outgoing delegations. Wrote correspondence (letters, emails, faxes) on behalf of Senators and the
Office of International Relations to Consulates, US embassies, and foreign governments. Compiled
a variety of reports and data into Excel and Word applications for publication in Senate Office of
International Relations Annual Report.
Billing Manager, CAL Internet Services, Inc., San José, CA (6/20XX – 7/20XX)
Used interpersonal communication skills to effectively network at business fairs resulting in increased
contacts and sales. Managed billing using OMS web-based billing database. Patiently provided tech
support to non-technical clients ensuring customer satisfaction and increased sales. Participated in
sales and marketing. Drafted official company correspondences in Word.
Caller, UC Davis Annual Fund, Davis, CA (7/20XX – 9/20XX)
Contacted UC Davis alumni and parents via telephone to promote continued relationships with
university. Fostered a positive image of UCD by implementing professional and sincere dialogue.
Encourage and solicit financial support. Conducted campaign for donations between $100-$1,000.
Cashier, ASUCD Coffee House, Davis, CA (9/20XX – 7/20XX)
Worked for on-campus food service venue that serves more than 4,000 meals per day; provided
customer service during busiest shifts. Effectively communicated with coworkers to ensure smooth
operations and a welcoming atmosphere.
ACTIVITIES/INTERESTS
Captain, Men’s Novice Curling Team, UC Davis (10/20XX – 6/20XX)
Running, weight-lifting, sketching, rock climbing.
International Experience
Visit icc.ucdavis.edu for additional tips on writing your resume.
Resu
mes
and
Cor
resp
onde
nce
You can use this section to also describe traits
icc.ucdavis.edu 25
Victoria [email protected] Main StreetDavis, CA 95676(530) 759-1957 Cell
OBJECTIVE:
A full-time software engineering positionEDUCATION:
Bachelor of Science Degree Expected June 20XX, GPA 3.2Computer Science and Engineering, University of California, DavisEXPERIENCE:
Software Development Intern, Hewlett-Packard, Palo Alto, CA, June 20XX-September 20XX
• Created a prototype in Visual Basic of an instant messaging concept involving multiple topics
• Created a prototype in Active Server Pages and Digital Dashboard for a customized central
webpage of web tools • Evaluated a virtual collaboration tool used by an engineering division • Built a prototype in Visual Basic of the next-generation instant messaging softwareIT Intern, Caltrans, June 20XX-September 20XX • Tested a web-based application used by the unit • Redesigned departmental Word template pages utilized • Provided phone and email support for a web-based computer training program
• Created web pages using Active Server Pages for automating the registrationCOMPUTER SKILLS:Programming Languages: BASIC, C, C++, Java, Java Server Pages, HTML, Perl, Visual Basic,
Active Server Pages, Standard ML Operating Systems: DOS, Windows, Macintosh, UNIX, LinuxPROFESSIONAL AFFILIATIONS:Computer Science Club, December 20XXTau Beta Pi National Engineering Honors Society, July-presentLEADERSHIP:
Filipino Americans in Science and EngineeringPresident (20XX-20XX), Website Programmer (20XX-present), Secretary (20XX-20XX),
We use this term to describe a resume that is used to apply for positions in information technology, engineering or consulting . Though the format is similar to other examples in the book we include it to demonstrate ways in which technical skills can be presented .
Students majoring in technical disciplines, e .g . engineering, are encouraged to include GPA if 2 .7 or above .
Technical
Visit icc.ucdavis.edu for additional tips on writing your resume.
Resumes and Correspondence
26 University of California, Davis
ManywebsiteswillacceptWorddocumentsbutsomerequestthatyoucutandpasteatextversionofyourresume.ResumessubmittedonlinefrequentlygetimportedintoadatabaseknownasanApplicantTrackingSystem or Hiring Management System . This includes resumes posted to employer sites and Internet resume banks . Your resume will usually not be seen until it has been retrieved from the database using keyword searchingtechniques.Manyoftheseresumesystemsrequestatextversionofyourresume.Thetextversionisdesigned to be read by a computer and eventually screened by human readers .
ANH NGUYEN
Campus999 University Avenue
Collegetown, CA 99999
(530) 75X-XXXX
Permanent
XXX Green Street
San Francisco, CA 12345
(415) 48X-XXXX
OBJECTIVE
A career position in sales and marketing
EDUCATION
Bachelor of Science in Managerial Economics with a minor in Communication, University of California,
Davis, June 20XX
Carlos University, Education Abroad Program, Madrid, Spain, Summer 20XX
SKILLSComputer: Proficient in MS Word, Excel, email and Internet Explorer in PC and Mac environments.
Language: Knowledge of Vietnamese (written and spoken).
Communication: Able to write clearly and convincingly and give public presentations to large groups.
RELEVANT EXPERIENCE
Marketing/Sales Intern, Progressive Microproducts, Sacramento, CA (6/XX-Present)
Market personal computer hardware and software. Develop and implement marketing and advertising
strategies. Design and develop educational and entertainment software for Apple computer system.
Participate in numerous computer trade shows hosting more than 3,000 visitors and more than 150
vendors.
Management Trainee/Salesperson, Grand Auto, Inc., Davis, CA (5/XX-9/XX)
Performed sales work for auto parts store with annual sales exceeding $35 million. Worked effectively
with customers and employees. Maintained a large store inventory using a computerized inventory
system. Supervised and trained sales force of 3 representatives. Implemented parts department
reorganization for enhanced work flow. Developed effective in-store and window displays.
Salesperson, Consumer Distributing Company, Woodland, CA (9/XX-4/XX)
Performed general merchandise sales for large catalog chain store. Processed over $10,000 per week
in cash, checks and credit cards, performed inventory control, and completed clerical tasks. Received
quarterly awards for sales performance.
LEADERSHIP
Fundraising Chairperson, Delta Sigma Pi, a business fraternity (dates)
Member, Vietnamese Student Association (dates)
Some employers still use the
term “scannable” resumes .
Scannable resumes are simply
older technology . A text
resume can be used when-
ever a scannable resume is
requested.
See the ICC website for additional information regarding online resumes: https://iccweb.ucdavis.edu/students/career/resume.htm
Online ResumesRe
sum
es a
nd C
orre
spon
denc
e
icc.ucdavis.edu 27
Advanced Degree Resume
Advanced D. Graduate1234 Spring Street Davis, California 95616(530)555-2230 [email protected]://www.linkedin.com/in/advancedgraduateOBJECTIVE: Project Manger, General Electric Power SystemsMechanical Engineering Ph.D. (June 20XX) with 4 years industry experience in project management, strategic planning,
research and development . Expertise in power systems and distributed grid infrastructure . Management and training
experience in production and use of technology for engineers and customers . Interested in globalization and international
issues . Additional skills include:• SolidWorks(CAD)• COMSOL(FEM/FEA)• MSOfficeSuiteanddatabase• Labview
• Oral&writtenpresentations• Matlab• Vibrationtest/analysis• L-edit(CAD)
• Mathcad• Machineshop/fabrication• Origin• SpeakbasicGerman
EDUCATIONPh.D. in Mechanical Engineering – University of California, Davis, June 20XX
Master of Business Administration in Finance & International Management – University of California, Davis, June 20XX
Bachelor of Science in Mechanical Engineering – University of California, Davis, June 20XXPROFESSIONAL EXPERIENCE
Manager, Business DevelopmentAnuvu, Inc . – Sacramento, California
September 20XX-present
• Managedtechnological/financialdevelopmentofPEMhydrogenfuelcellapplicationsinpowersystems.
• Createdcomplexengineeringmodelsandfinancialprogramsfortechnology/investmentvaluation.
• Presentedgridinfrastructureengineering/financialmodeltodomesticandforeignbusinesspartners.
• Wrotebusinessplanfora$4.5MOEMhydrogenfuelcellcontract.• NegotiatedcontractforproducttestingandintegrationwithOEMpartnerandStateTestingGroup.
• DevelopednetworkandrelationshipwithOEMcustomers.Research and Development EngineerMedtronic Vascular, Inc . – Santa Rosa, California
June 20XX-September 20XX
• Patentedmechanicaldesignofdeviceandledprojectfrominceptiontosuccessfulinternationalclinicaluse.
• Developedprocesses,equipment,andtrainedpersonnelformarketreleaseofmedicaldeviceproductlines.
• Managedproductionlineandpersonnelwhilecreatingandfabricatingsupporttoolingandequipment.
• CoordinatedjointR&D/Manufacturingeffortstoeffectivelymeetcompanyproductiondeadlines.
• WroteproceduresforprocessesanddatacollectionforGMPandISO-900Xqualitysystems.Total Quality Manager – Intern Hunter Innovations Inc . – Sacramento, California
June 20XX-December 20XX
• OrganizedandledtrainingofHunterAssociatesinQualityControlandGMPsystems.
• WroteandimplementedGoodManufacturingPractice(GMP)SystemforFDAregulatoryapprovalofartificial
hip joint implant sales and manufacturing . • DesignedandprogrammedcomponentsofCNClatheandmillmanufacturingresultinginsalesestimatedat
$10,000/monthforthesecomponents.Project Engineer – Intern AmesCo./FluidControlSystems–Woodland,California
June20XX-September20XX
• Leaderof“IntroductiontoProduction”teamandresponsibleforvendorcommunications.
• Createdandmaintainedengineeringdocumentation,billofmaterials,andbillofoperations.
• Researchedanddesignedprototypebackflowcheckvalvesandledpilotproduction.PATENTS/PUBLICATIONSList patents and publications here
PROFESSIONAL AFFILIATIONS/COMMUNITY SERVICEInstitute of Industrial Engineering - Engineers Without Borders
Chronological Format
Resumes and Correspondence
28 University of California, Davis
Advanced Degree Resume
Pat B. Graduate
1234 Spring Street, Davis, California 95616
(530)555-2233 pbgraduate@
ucdavis.edu
http://www.linkedin.com/in/pat
graduate
OBJECTIVE: Editorial Assistant at University of California Press
Anthropology Ph.D. (June 20XX) with progressive experience in expository, media and academic writing . Skilled in
proofing, editing and synthesizing content for publication . Outstanding organizational skills; meticulous attention to detail;
ability to juggle multiple tasks and meet tight deadlines . Additional skills include:
• Factchecking
• Copywriting
• Databaseadministration
• Marketresearch
• MicrosoftOfficeSuite,Maci
ntosh
• Quark,Photoshop,SASS,Dr
eamweaver
EDUCATION
Ph.D. Anthropology – University of California, Davis, June 20XX
Bachelor of Science Social Sciences – California Polytechnic State University, June 20XX
RELEVANT EXPERIENCE
Writing/Editing
• Editedsubmittedpapersfo
rcontent,coherenceandlangua
geusage.
• Accuratelytransferrededit
edcopyfromprinttoQuarkand
formattedmaterialforpublicati
on.
• CompletedPh.D.disserta
tion:currentlysynthesizingsele
ctchaptersforpublication.
Research
• Developed,implementeda
ndinterpretedten-pagequestio
nnaire.
• Createdsamplingtechniqu
esincludingspecialvariantofst
andardrandomsample.
• Preparedrawdataforcom
puteranalysis.
Organization/Administration
• Developedarchivalsystem
formuseumfilmcollection.
• Coordinatedallaspectsof
four-day,internationalprofessio
nalconferenceundershortlead
timeconstraints.
Developed agenda, scheduled speakers and organized discussion groups .
• Cataloguedandcuratedth
eAmericanIndianEthnographic
FilmCollectionfortheCaliforn
iaIndianMuseum.
• Scheduledandcoordinated
auditionsandinterviewsforperf
ormersandtechnicalstaffforco
mmercialandindustrial
film projects .
• Evaluatedandcontactedp
rospectiveclientsandtalentagen
ciesasproductionassistantinco
mmercialandindustrial
film projects .WORK HISTORY
Teaching Assistant Department of Anthropology, UC Davis, Fall 20XX-Present
Associate Instructor Department of Anthropology, UC Davis, Summer 20XX
Curatorial Intern Gorman Museum, UC Davis, Summer 20XX
FieldArchaeologist
SequoiaNationalPark,CA20XX
-20XX
List relevant Presentations/Publications/Associations here —if numerous, change section heading to “Selected Presentations”
or “Selected Publications” and only list a few.
Functional Format
Resu
mes
and
Cor
resp
onde
nce
icc.ucdavis.edu 29
Elissa Bowman1111 Tree Street, Davis, CA 95616
(555) [email protected] • www.linkedin.com/in/elissabowman
Objective: Evaluation Coordinator – Research Spacialist, Child Care Study (1234), University of ABC, Department of Education
Community Development Master’s Candidate (August 20XX) with six years’ experience in non-profit program management, including evaluation, research and program design. Expertise in qualitative research design and database creation.
• Fluent in Spanish• MS Office Suite, including Access and Excel• Excellent writing skills
• Courses in qualitative and quantitative research methods• Clear communicator and collaborator
educatiOn
Master of Science in Community and Regional Development – University of California, Davis, expected August 20XX.Relevant Coursework: Intermediate Social Statistics, Field Research, Professional Skills for Community Development, Qualitative Research Methods, Participatory Action Research.Bachelor of Science in Sociology – Eastern Mennonite University, June 20XX.
PrOfessiOnal exPerience
Graduate Student Researcher July 20XX-presentUC Sustainable Agriculture Research and Education Program, Davis, California • Conducted evaluation of local non-profit organization’s two-year USDA Community Food Project grant. • Designed and implemented surveys and interviews of project participants. • Synthesized data and completed annual and final reports of grant process. • Maintained relationship with grantee organization to ensure expectations were being met and evaluation tools were
satisfactory. • Edited the final report and verified data accuracy for an assessment of San Diego County’s food system.
Research Associate – Intern June 20XX-April 20XXUnited Green, Sacramento, California • Produced interactive tool called a “stakeholder analysis” to visually represent power and food access in
underrepresented Sacramento communities. • Engaged community members in two workshops to provide necessary data to build the tool. • Assessed software options to best present the tool and meet United Green’s needs. • Collaborated with multiple organizations and team members to ensure coordination of final products.
Graduate Student Researcher January 20XX-August 20XXUC Davis Center for Reginonal Change, Davis, California • Researched and wrote first draft of introductory chapter for Healthy Youth/Healthy Regions final report. Healthy
Youth/Healthy Regions is a multidisciplinary research project investigating the link between youth well-being and prosperity in the Sacramento region. This introductory chapter set the scene for the final report by highlighting the strengths and inequities in the region.
• Compiled data from Healthy Youth/Healthy Regions qualitative and participatory action research team to produce brief about the effect of transportation issues on youth well-being.
• Gathered data from secondary sources and online databases for use in REACH Youth Development Program evaluation reports.
• Produced annotated bibliography of academic literature about tyouth civic engagement.
Elissa Bowman Page 2
Home Garden Manager September 20XX-August 20XXCommunity Food Bank, Tucson, Arizona • Supervisory role involving gardening assistance, budget management, community outreach and program design. • Created and managed database to track department’s activities and identify areas for growth. • Outreach and coordination with other Tucson non-profits on community development projects.
Home Garden Coordinator September 20XX-September 20XXCommunity Food Bank, Tucson, Arizona • Taught vegetable gardening skills to low-income families through at-home assistance. • Designed and taught popular-education-style gardening workshops in English and in Spanish.
Community Organizer September 20XX-September 20XXBorder Action Network, Tucson, Arizona • Led outreach campaign in Latino immigrant community in Tucson. • Established new membership base. • Initiated campaign to pressure Arizona Congressional delegation for immigration reform.
In-home Tutor June 20XX-August 20XXPennsylvania Migrant Education, Millersville, Pennsylvania • Provided summer education services to elementary- and preschool-age children.
awards and certificatiOns
Community Service Award, 20XXUC Davis Community Service Resource Center, Davis, California
CITI Social and Behavioral Research Basic/Refresher Certification, 20XXUC Davis Department of Human and Community Development
Erna and Orville Thompson Graduate Student Fund, 20XXUC Davis Community Development Graduate Group, Davis, California
Block Grant Fellowhship, 20XX-20XXUC Davis Community Development Graduate Group, Davis, California
Employee of the Season, 20XXCommunity Food Bank, Tucson, Arizona
Honors Scholarship, 19XX-20XXEastern Mennonite University, Harrisonburg, Virginia
Chronological Format
Advanced Degree ResumesResum
es and Correspondence
30 University of California, Davis
Advanced Degree ResumesELIZABETH A. SAMUEL
[email protected] • www.linkedin.com/in/elizabethsamuel2413 Main Street, Davis, California 95616 • (530) 555-5555
QUALIFICATIONS SUMMARY
Microbiology Ph.D. (Spring 20XX) with progressive experience in analysis of the regulation of leucine biosynthesis by ppGpp in Escherichia coli. Additional research includes restriction endonuclease analysis of the satellite DNA component from two extremely halophilic bacteria. Highly organized, skilled in translating complex scientific concepts into easily understood terms. Work well independently, as well as part of a team. Excellent communication skills. Deadline oriented.
EDUCATIONPh.D., Microbiology, University of California, Davis. Degree expected Spring 20XXMaster of Science, Microbiology, California State University, Long Beach, August 19XX
EXPERIENCE University of California, Davis, 6/XX - present Graduate Researcher Conceived and optimized novel selection procedures using leu::Mud::lac fusions to isolate
1) mutations in the leucine promoter, and 2) unlinked mutations that give rise to decreased expression of biosynthesis in Escherichia coli. Genetically mapped unlinked mutations. Future work involves analysis in an S-30 in vitro system and cloning of the mutants. Dr. Sara Smith, Department of Bacteriology.**
California State University, Long Beach, 9/XX - 8/XX Graduate Researcher Isolated and characterized the satellite DNA component from Halobacterium sp. by density
gradient centrifugation and restriction endonuclease analysis. Dr. Paul Jones, Department of Microbiology.**
Veteran’s Administration Medical Center, Long Beach, 9/XX - 9/XX Research Assistant Collected, maintained and statistically evaluated data for ongoing studies including drug
evaluations, immunological studies, iron therapy studies and studies on long-term dialysis patient care. Dr. James Craig, Medical Hemodialysis.**
Other Experience Bacteriological Techniques Laboratory, UC Davis, 9/XX - 12/XX Associate Instructor Lectured class of 45+ students; demonstrated new techniques. Evaluated laboratory write-ups.
Bacterial Genetics and Physiology Laboratory, UC Davis, 9/XX - 6/XX Teaching Assistant Pre-ran experiments and produced detailed protocols for new experiments.
Demonstrated techniques and assisted students in everyday laboratory routines.
ELIZABETH A. SAMUEL Page 2
PUBLICATIONS*
Smith, S., and E. A. Samuel. 19XX. Use of M13mp phages to study gene regulation, structure and function: cloning and recombinational analysis of genes of the E. coli leucine operon. J. Bact. 26: 147.
Samuel, E. A. 19XX. Bacteriological Projects for Biological Sciences 1 Students. (In-house publication)
ABSTRACTS AND PRESENTATIONS*
Samuel, E. A., and S. Smith. Use of leu::lac fusions to isolate leucine operon regulatory mutations in Escherichia coli. Presented at the 19XX Annual Meeting of the American Society for Microbiology.
RESEARCH GRANTS
Co-authored proposal for National Institutes of Health (NIH). Funded $65,000. (Principal Investigator: William Craig, Ph.D.**)
HONORS
Recipient, Outstanding Graduate Student Teaching Award, UC Davis, May 20XX
PROFESSIONAL AFFILIATIONS/LEADERSHIP ROLES
American Association for the Advancement of Science (AAAS)American Society for Microbiology (ASM)
Chairperson, Microbiology Graduate Student Association, UC Davis (19XX - present)UC Student Representative to the Board of Admissions and Relations with Schools Subcommittee on
Research (19XX - 19XX)
* If numerous, list only the most relevant and add “Selected” in front of the heading (i.e., Selected Publications or Selected Presentations).
** Use name only if well-known in target industry.
Chronological Format
Resu
mes
and
Cor
resp
onde
nce
icc.ucdavis.edu 31
ELIZABETH A. [email protected]
Department of Microbiology 2413 Main StreetUniversity of California, Davis Davis, California 95616(530) 75X-XXXX (530) 55X-XXXX EDUCATION
Ph.D., Microbiology, University of California, Davis. Degree expected Spring 20XX. Dissertation: Analysis of the regulation of leucine biosynthesis by ppGpp in Escherichia coli. Advisor: Dr. Sara Smith.
Master of Science, Microbiology, California State University, Long Beach, August 20XX. Thesis: Restriction endonuclease analysis of the satellite DNA component from two extremely halophilic bacteria. Advisor: Dr. Paul Jones.
Bachelor of Science, Biological Sciences, University of California, Davis, June 20XX. AREAS OF SPECIALIZATION (Optional)
RESEARCH EXPERIENCE Doctoral Research, UC Davis, 6/XX - present.
Conceived and optimized novel selection procedures using leu::Mud::lac fusions to isolate 1) mutations in the leucine promoter, and 2) unlinked mutations that give rise to decreased expression of biosynthesis in Escherichia coli. Genetically mapped unlinked mutations. Future work involves analysis in an S-30 in vitro system and cloning of the mutants. Dr. Sara Smith, Department of Microbiology.
Masters Research, CSU Long Beach, 9/XX - 8/XX.Isolated and characterized the satellite DNA component from Halobacterium sp. by density gradient centrifugation and restriction endonuclease analysis. Dr. Paul Jones, Department of Microbiology.
Research Assistant, Veteran’s Administration Medical Center, Long Beach, 9/XX - 9/XX.Collected, maintained and statistically evaluated data for ongoing studies including drug evaluations, immunological studies, iron therapy studies and studies on long-term dialysis patient care. Dr. Khosrow Mirahmadi, Medical Hemodialysis.
TEACHING EXPERIENCE Associate Instructor, Introduction to Microbiology, UC Davis, 9/XX - 12/XX.
As sole instructor of 175 students, designed course curriculum, gave lectures, supervised three teaching assistants and held office hours.
Teaching Assistant, Bacterial Genetics and Physiology Laboratory, UC Davis, 9/XX - 6/XX.Pre-ran experiments and produced detailed protocols for new experiments. Demonstrated techniques and assisted students in everyday laboratory routines. Dr. William Wolff, Department of Microbiology.
ELIZABETH A. SAMUELPage 2
PUBLICATIONSSmith, S., and E. A. Samuel. 20XX. Use of M13mp phages to study gene regulation, structure and function: cloning and recombinational analysis of genes of the E. coli leucine operon. J. Bact.:26: 147.
Samuel, E. A. 20XX. Bacteriological Projects for Biological Sciences 1 Students. (In-house publication)
ABSTRACTS AND PRESENTATIONS
Samuel, E. A., and S. Smith. Use of leu::lac fusions to isolate leucine operon regulatory mutations in Escherichia coli (Poster). Presented at the 20XX Annual Meeting of the American Society for Microbiology, San Diego, CA.
ACADEMIC SERVICE
- Chairperson, Microbiology Graduate Student Association, UC Davis (20XX - present).- UC Student Representative to the Board of Admissions and Relations with Schools
Subcommittee on Research (20XX - 20XX). PROFESSIONAL AFFILIATIONS
- American Association for the Advancement of Science (AAAS)- American Society for Microbiology (ASM)
RESEARCH GRANTS
- Co-authored proposal for National Institutes of Health (NIH). Funded $65,000. (Principal Investigator: Don Pruitt, Ph.D.)
HONORS
- Recipient, Outstanding Graduate Student Teaching Award, UC Davis, May 20XX. REFERENCES
Sara Smith, Ph.D. [email protected] Department of Microbiology, University of California, One Shields Ave., Davis, CA 95616 530-75X-XXXX
Don Pruitt, Ph.D. [email protected] Department of Microbiology, University of California, One Shields Ave., Davis, CA 95616 530-75X-XXXX
Paul Jones, Ph.D. [email protected] Department of Biology, California State University, Long Beach, CA 95616 530-75X-XXXX
William T. Wolff, Ph.D. [email protected] Department of Microbiology, University of California, One Shields Ave., Davis, CA 95616 530-75X-XXXX
Acurriculumvitae(CV)isthenameoftheresumeusedbyindividualsseekingateachingand/orresearchpositioninapostsecondaryinstitution or a high-level research position in industry . For examples of curriculum vitaes that have been converted to resume format, please visit http://iccweb.ucdavis.edu/graduates .
Curriculum Vitae for Science Position
Resumes and Correspondence
32 University of California, Davis
Resu
mes
and
Cor
resp
onde
nce
Curriculum Vitae for Humanities PositionThe curriculum vitae can vary according to standards within a discipline . The humanities curriculum vitae is similar to Sample 1 but offers a different approach on the first page . Pay particular attention to the list of common support documents below . They may be expectedeveniftheyarenotspecificallyrequested.Ifindoubt,contactthehiringinstitution.
Morgan A. Smith
2020 Sunrise Court
Davis, CA 95616
(530) 756-XXXX
EDUCATION Ph.D. Comparative Literature, University of California, Davis, expected June 20XX
Major Field of Study: 17th Century British literature
M.A. Comparative Literature with honors, Michigan State University, East Lansing, MI,
June 20XX
B.A. English magna cum laude, San José State University, June 20XX
DISSERTATION
Title: “Three British Poets: A Compar
ative Study of the Conventions Used by
Chaucer, Beaumont
and Fletcher.” The dissertation exami
nes a comparative study of prominent
British poets tracing the
development of mock-heroic and mock-epic conventions in English poetry. Dissertation Advisor:
Suzanne Takahashi
DISTINCTIONS
Outstanding Graduate Student Teache
r Award Rhodes Scholar fin
alist
Ph.D. Qualifying Exam passed with distinction Jastro Shields Fellowship
TEACHING AND RESEARCH INTERESTS
• Areas of research specialization includ
e Renaissance and 17th century literature and metaphysical
poetry.• Teaching interests
include...(Visit the website of the prospective employer and provide a
list of courses you want to teach, including those in the listing.)
TEACHING EXPERIENCE
Associate Instructor, Department of Comparative Literature, UC Davis, January 20XX-present.
Interpretation of Literature. Developed course syllabus and lectures. Wrote and
evaluated examinations. Held weekly office hours.
Teaching Assistant, Department of English, UC Davis, September 20XX-January 20XX.
Solely responsible for lectures and exam evaluations. Held weekly office hours. Courses included:
Narrative Literature (3 quarters)
Freshman Composition (4 quarters)
Lyric Poetry (upper division, 1 quarter)
RESEARCH EXPERIENCE
From here, follow format provided on page 31.
icc.ucdavis.edu 33
ROBIN [email protected] Lake Blvd.Davis, CA 95616(530) 75X-XXXXEDUCATION M.S. Animal Biology, University of California, Davis, June 20XX. B.S. Biological Sciences, University of California, Davis, June 20XX. A.A. Sacramento City College, June 20XX. California Community College Credential, Biological and Zoological Sciences, 20XX.
Life Science Credential, University of California, Davis, June 20XX.QUALIFICATION SUMMARY • Five years teaching experience at the postsecondary and secondary levels with students
diverse in age, ability and cultural background. • Areas of teaching competence include Biology, Advanced Placement Biology, Evolution,
Human Physiology, Marine Biology, Family Life and Human Sexuality, among others.
• Experienced in developing course curricula as well as executing field trips, laboratory
exercises, and other activities beyond traditional lectures.TEACHING EXPERIENCE Instructor, Ohlone Community College, September 20XX - present. General Biology. Prepared curricula and lectured on the principles of cell biology, animal and
plant structure and function. Wrote manual on biological sciences projects. Arranged field trip
to Klamath Wildlife Refuge. Heredity, Evolution and Society. Taught contemporary issues in evolution and genetics to
non-science majors. Revised curriculum and prepared lab manual. Teacher/Department Head, Sacramento Country Day School, September 20XX - August 20XX.
Taught advanced placement courses in Biology and Human Physiology to 95% college-bound
student body. Developed laboratory resources and participated in design of teacher training
and evaluation program. Teaching Assistant, University of California, Davis, January 20XX - June 20XX.
Solely responsible for lectures, course syllabi, examinations, and final evaluations. Courses
included: Principles of Biology (two quarters) General Zoology and Laboratory (one quarter)RESEARCH EXPERIENCE (Optional—can combine under “Teaching and Related Experience”)From here, follow format provided on page 31.
(Optional)
Curriculum Vitae for Community College Position
Resumes and Correspondence
34 University of California, Davis
CV Supplement and Grad Skills List
General Skills Particular to Graduate Students
Communication Skills Ability to: write clearly and concisely
listen well speak publicly interpret the dynamics of interpersonal relations distinguish fine shades of meaning distinguish verbal and non-verbal messages teach and train counsel and advise serve as resource/referral person
General Research Skills Ability to: retrieve data
acquire data analyze data manipulate data use methodology produce survey work, e.g., develop questionnaires, interview observe classify test hypotheses for acceptance or rejection against known evidence identify and use resources
Technical Skills Ability to: program computers
edit
Field Research Skills Problem-Solving/Analytical/Conceptual Skills Ability to: analyze
reason logically identify problems analyze problems perceive parts in relation to whole see patterns develop theories out of pattern synthesize condense material to its important components manipulate abstract concepts formulate hypotheses think flexibly impose structure—create order out of “chaos” evaluate programs
Managerial Skills Ability to: supervise
evaluate performance of others assume authority delegate authority manage time establish goals set objectives motivate people tolerate ambiguity
More Categories and Clarifications
PUBLICATIONS: If lengthy, include subheadings such as refereed, non-refereed, textbooks, chapters, technical papers, etc. Distinguish between those in press, submitted, under review, limited distribution and in preparation. Use bibliographic style appropriate for your discipline.
PROFESSIONAL DEVELOPMENT: List workshops, conferences or courses related to training. For example, the seminar on college teaching or workshops related to teaching or research methods.
OTHER RELEVANT EXPERIENCE: Could contain non-academic position related to current field or field of study.
GRANTS AND CONTRACTS: Include only if you have authored or co-authored the proposal and received funding. Indicate the funding source and the name of the principal investigator.
SHOWS/EXHIBITS/PERFORMANCES: Cite works composed, conducted or performed.
CERTIFICATIONS/LICENSURE: Follows Education.
LANGUAGES: Indicate fluency: reading, writing, speaking.
RELEVANT COURSEWORK: Use only if requested or if it serves to clarify preparation. If more than 2-3 lines, substitute “See Addendum I” and attach the addendum.
SUPPORT DOCUMENTS: Cover Letter/Statement of Interest (Always included) Research Statement/Agenda Statement of Teaching Interests Teaching Philosophy Statement Evidence of Teaching Effectiveness Sample Course Syllabi Writing Sample/Reprints Dissertation Abstract Letters of Recommendation Transcripts (Only if requested)Re
sum
es a
nd C
orre
spon
denc
e
icc.ucdavis.edu 35
Resumes and Correspondence
References for Audrey KimCampus Address Permanent Address1122 Aggie Avenue #33 555 Home StreetDavis, CA 95616 Antioch, CA 9XXXX(530) 757-XXXX Messages (415) 48X-XXXXEmail: [email protected]
Anne RobertsonAssociate Director
Sacramento County Planning and Community Development Department
361 Capitol MallSacramento, CA 95XXX
(916) [email protected]
Robert Wood, Ph.D.Director
U.S. Environmental Protection Agency121 Green Avenue
Philadelphia, PA 19XXX(215) 71X-XXX ext. XXX
Janet CollierGeneral Manager
Student Landowner Education and Watershed Stewardship Program (SLEWS)
University of CaliforniaOne Shields Avenue
Davis, CA 95616(530) 75X-XXXX
Selecting People• References, a list of people you have worked, volunteered
or interned for such as faculty, current or former supervi-sorsand/orcampusstaffthatincludesallnecessarycontactinformation .
• Letters of recommendation vouch for your skills and character and are often written for a specific job opening .
• Bothcanincludeadvisors,coaches,mentorsoranyoneinaprofessional position who can speak about your character, skills and work ethic .
• ReferencesshouldNOTbefamily,friendsorpeers.
• Choosepeoplewhohaveknownyouforaminimumof three months . The longer they have known you the better; however, try to choose someone with whom you have interacted in the past year .
• Donotchoosepeoplewhoarenotwellversedonyour background and accomplishments .
if yOu list yOur email address check it daily
• Ifyoumustchoosebetweenseveralpeoplewhoknowyouwell, select those who hold a higher rank in their profession .
• Onepersonmaybeappropriateasareferenceforemploy-ment, while another would be better to write a letter of recommendationforgraduate/professionalschoolora scholarship application .
• Alwaysaskpermissionfromyourrecommendersbeforeyouuse their names . Ask your references if they are willing to provide a strong, supportive recommendation .
Try to Meet Face to Face• Anin-personmeetingisbesttoseehowinterestedan
individual is in serving as your reference . Discuss your career goals and what you’d like the letter to reflect .
• Trustyourinstincts—ifthepotentialreferenceseems reluctant, thank the person for meeting with you and leave on a positive note .
Help Your References• Provideyourreferenceswithacopyofyourresumeand
information about the position you are seeking . For a letter of recommendationforgraduate/professionalschoolincludeaone-page summary of any achievements or skills and a state-ment of your future goals as well as a resume .
• Remember—areferenceshouldattesttoyourskilland ability level . They may speak to your interpersonal, leader-ship, communication, conflict resolution, decision-making skills and grasp of your field of study .
• Giveyourreferencesampletimetocompletetheirlettersand provide them with pre-addressed stamped envelopes or instructions for online submission .
• Anyinconsistenciesbetweenwhatyousayaboutyourselfinan interview and a reference’s response could eliminate you from consideration for the position .
How Many References?• Itisstandardtoprovidethreetofivereferences.Seesample
for how to format a reference list .
Remember• Providereferenceswitharesume.Ifyourequestarecom-mendationforgraduate/professionalschoolincludeaone-page summary of your achievements or skills and a statement of your future goals .
• Giveyourreferencesampletimetocompletetheirletters;provide them with pre-addressed stamped envelopes, or instructions for online submission .
• Followupandletthemknowthestatusofyourplansandsearch .
Adapted from “Letters of Recommendation” by Roseanne R. Bensley, Career Services, New Mexico State University.
Asking for a Reference or Letter of Recommendation
Create a consistent and professional application packet .
• Yourfontandpaperchoicesshouldbethesameasthose used for your resume and cover letter .
36 University of California, Davis
Cover LettersRe
sum
es a
nd C
orre
spon
denc
e
DON’TsD Use a generic, “one size fits all” cover letter . You should write
acoverletterthatistargetedtoaspecificjob/organization.
D Write a long, wordy cover letter; one page in length is adequate.Usethecoverlettertoexpanduponskillsandexperiences beyond information contained in your resume .
D Exaggerate your skills or experience .
DOsC Use the same color, paper, and font you used in your resume .
C Address your cover letter to a specific individual or hiring authority .
C Limit your cover letter to three or four paragraphs and not more than one page .
C Check for typos, proper grammar, and accuracy . If possible askanICCstaffmembertocritiqueyourcoverletterbeforeyou mail it .
C Reformat and use for email applications .
Return Address City, State, ZIP Telephone with area code Date Name, Title Company Name Street Address City,State,Zipcode
DearMs./Mr.(employer’slastname):
In the first paragraph,tellhowyouheardaboutthejobopeningand/orthenameof the person who told you about the position . Mention the specific job title and say thatyouareenclosingaresumethatshowshowyouarequalifiedforthejob.
In the second paragraph, analyze your background and skills in relationship to the job description . Show how you make a “goodfit”withthisjob/organizationandhowyoucan contribute . Give examples of related experience from your past work, classroom, or extracurricular activities .
In the third paragraph, tell how you will follow through . For example, “I am eager to meet with you to discuss this opportunity . I will be available for an interview at a time convenient to you .”
Sincerely,
Type your name here
Enclosure (refers to your resume)
Cover Letter Format and Content Description
This information can also be set to the left margin.
Sign your name here or use a script font.
Caution: Write about what skills you can bring to the company, not what the organization can do for you.
Show your enthusiasm for the job throughout the cover letter.
Cover Letters When you apply for a job or for specific internships you should attach a cover letter to yourresumeand/orjobapplication.Acoverletterisimportantbecauseit:
• Bridgesthegapbetweenyourresumeandtheemployer.
• Introducesyouandyourresume.
• Explainswhyyouareagoodfitforthisopportunity.
• Promotesyourcandidacyforthejob.
• Canmakethedifferencebetweenlandinganintervieworhavingyourresumediscarded.
COVER LETTER DOS AND DON’TS
icc.ucdavis.edu 37
Cover Letter for Internship Position
555 A StreetDavis, CA 95616(520) [email protected]
November 10, 20XX
Human Resources Department – Internship ProgramNational Public Radio123 Government StreetWashington, DC 20301
Dear Internship Coordinator,
I am very interested in the internship with the Communications/Public and Media Relations Department
during the Winter Quarter beginning January 9th through March 14th. I am a Junior at the University of
California, Davis, pursuing a bachelor’s degree in American Studies with a minor in Communication.
My research experience has sparked my interest in the way that media is delivered through marketing and
advertising. I believe in the mission of National Public Radio and would be excited to be an intern with
your organization.
This summer while studying abroad I was able to look at American culture from a different perspective.
This has increased my interest in news delivery and how it helps to inform citizens. I was the only freshman
to be elected to the position of Senator for the Associated Students of UC Davis, and rose to the challenge of
representing first-year students while collaborating on larger university issues. Through these experiences I
learned the value of effective communication through all forms of media.I am confident that my experiences, skills and strong interests in the goals of NPR have prepared me to be a
strong intern for your program. I have attached my resume and look forward to discussing my qualifications
with you. Thank you for your time and consideration.Sincerely,
Josie BeechJosie Beech
Enclosure
Resumes and Correspondence
38 University of California, Davis
Cover Letter
Career Position
1122 Aggie Avenue, Apt. #33Davis, CA 95616(530) [email protected]
March 21, 20XX
Ms. Sally BlackABC Company456 Main StreetAnytown, CA 95XXX
Dear Ms. Black:
I am applying for the Environmental Scientist position you have listed in the Aggie Job Link database. I believe I am a strong candidate for this position as I have the qualifications and experience you are seeking.
I am a recent graduate from the University of California, Davis with a Bachelor of Science in Environmental Policy Analysis and Planning and a Bachelor of Arts in Communication. These degrees have prepared me well by developing my working knowledge of environmental impact assessments, CEQA, NEPA and other environmental regulations as well as honed my report writing and verbal communication skills. In addition to my coursework, I have experience in the field. As a fellow with the US EPA in Philadelphia, I reviewed and provided comments on Environmental Impact statements, used GIS to update publication quality maps, and interfaced with numerous federal and private agencies. As a planning intern with Sacramento County, I conducted a jobs/housing balance study where I incorporated input from the public with County needs. At the Student Landowner Education and Watershed Stewardship Program (SLEWSS), I honed my communication and organizational skills through weekly presentations about native species, ecosystems and soil characterization.
I feel I would make an excellent Environmental Scientist with ABC Company. I have a strong work ethic, I work well with teams, and I want to be part of a company that develops strategic solutions to make the world a better place. I look forward to an interview with you to further discuss my qualifications.
Sincerely,
Audrey KimAudrey Kim
Posted Date: 2/23/2011Job Category: GIS/MappingPosition Title: Environmental Scientist – Entry to Mid LevelSalary Range:Location: Baltimore-Towson, Maryland, USADesired Skills:
Description:Environmental Scientist – Entry to Mid LevelWould you like to work with a premier environmental services organization? Do you have a strong work ethic combined with personal integrity? Do you have GIS experience?
Our client specializes in environmental, applied engineering, industrial hygiene and information tech-nology services. Their strengths include remediation, compliance and pollution prevention. They have a friendly and teamfocused corporate culture. Grow your career with the best and brightest in the field!
We have an exciting opportunity for an Environmental Scientist in southern Maryland. The successful candidate will gain a breadth of experience and perform and support environmental compliance, planning, and remediation work for public agencies. Projects include preparing/reviewing NEPA Phase I and II ESA’s; conducting field investigations to characterize soils, groundwater, and other environmental media; using GIS to prepare various graphical and data products; conducting planning studies and assisting with business proposal development projects.
If you have 1-7 years of experience, and academic, internship, or work experience in one of more of the following, this may be the position for you.
- Knowledge of environmental science and policy - Knowledge of principles and practice of environmental engineering and analysis and ability to apply it to federal, state, and other public programs and activities- Ability to use GIS to support environmental analysis and generate publication-quality maps and work products- Knowledge of federal and state environmental laws and regulations and skill in applying this knowledge to guide projects- Excellent written and verbal communication skills are required
To apply, simply select Apply to job or you can email your resume to [email protected].
ETI Professionals provides technical support services and project support personnel to our govern-ment and industry partners. Our highly skilled experts support and supplement the mission, expertise, and skill sets of our clients. Utilizing our customer-intimate approach, we partner with our clients to provide strategic solutions that maximize the use of human and financial resources to ensure that mission-critical projects are completed on time and within budget.
Our website can be found at ETI PROS, where you will learn more about our company as well as an updated list of positions available nationwide.
ETI is proud to be an Equal Opportunity and Affirmative Action employer.
Write about what skills you can bring to the company, not what the organization can do for you.
It is often not possible to identify a specific person to address the letter to especially when submit-ting your cover letter to a website.
Match your cover letter to the job description. Avoid using a generic, “one size fits all” cover letter.
Limit your cover letter to three or four paragraphs and not more than one page.
Show your enthusiasm for the job on your cover letter.
Resu
mes
and
Cor
resp
onde
nce
icc.ucdavis.edu 39
Resumes and Correspondence
Additional Letter Samples
123 D StreetDavis, CA 95616(530)758-XXXX
March 21, 20XX
Ms . Sally BrownABC Company123 Main StreetAnytown, CA 95XXX
Dear Ms . Brown:
Please accept my apology for missing the interview scheduled with ABC Company on Thursday, March 20 at 2:15 p .m . I experienced an unforseen emergency that kept me from meeting with you . Your company offers an invaluable opportunity, and I appreciate any consideration you can give me in rescheduling my interview .
My internships with Look Public Relations and Real Marketing have providedmewiththeexperienceandqualificationsyoudesireintheMarketing Assistant position . This experience, in combination with my Managerial Economics major, make me a strong candidate for this position .
Thank you for your understanding . I hope we can meet in the near futuretodiscussmyqualificationsfortheMarketingAssistantpositionyou are offering .
Sincerely,
Joe GreenJoe Green
Apology LetterAn apology letter is a personalized note apologizing for a last-minute interview cancellation or no-show . The note is an effort to remain in good standing with the company .
1234 Raleigh CourtDavis, CA 95616(530)758-XXXX
March 12, 20XX
Ms . Karen Smith, CoordinatorThe Internship and Career CenterUniversity of California, DavisOne Shields AvenueDavis, CA 95616
Dear Ms . Smith,
Thank you for the opportunity to interview this afternoon . After the interview I am even more interested in being a student advisor at the Internship and Career Center . I would like to add that in addition to my Resident Advisor experience I gained excellent computer skills and used Access to generate many reports during my internship at PG&E . So, not only do I offer the interpersonal skills acquiredasaResidentAdvisorbutIalsohavestrongtechnicalskillsaswell. I would like to add Maggie Thompson, Customer Records, PG&E, mthompson@pge .com, as one of my references .
I am excited about the Student Advisor position and greatly appreciate being considered for the position . I look forward to hearing from you and can be reachedat(530)758-XXXXduringSpringBreak(March25throughMarch30).
Thank you again for your time and consideration .
Sincerely,
Stephanie AggieStephanie Aggie
Thank-You LetterThank-you letters can also be used to reinforce replies to interviewquestionsorgivealternateresponses.Ifyouthinkofabetterexample/responsetoaparticularquestionafterthe interview, you can use the thank-you letter to give that response . Here’s an example:
“During the interview you asked about my experience working in unpredictable situations . As a Resident Advisor at UC Davis, I managed a community of 110 new students . The position involved being prepared for unpredictable situations such as loud and unruly parties, policy enforcement, peer advising, and emergencies pertaining to individuals, groups and threats to the residence hall .”
40 University of California, Davis
192 Beta DriveDavis, CA 95616(530)75X-XXXX
March 28, 20XX Mr . Kevin JonesPersonnel ManagerABC Corporation3 Wallaby PlaceSan Francisco, CA 10XXX Dear Mr . Jones: Thank you for your letter of March 25, 20XX and your invitation to become a member of your organization following graduation . I am pleased to accept your offer of employment . I understand this is a 12-month career position, and I will begin employmenton(date).Ihavereadandunderstandtheinformationcontained in the benefits package and agree to my salary offer of ($_____).Ifanyofthisinformationisinerror,pleaseletmeknowassoonaspossible.Icanbereachedat(530)756-XXXX . I look forward to a satisfying and mutually productive career with ABC Corporation . Sincerely, Robyn Ryan Robyn Ryan
Letter to Accept a Job OfferNotify the employer as soon as you decide to accept a job offer . Confirm your acceptance in writing even if you’ve already accepted the offer by telephone . Restate the date of the offer, the position, the salary and the starting date . Express enthusiasm for the company and your position and future with it .
If you are relocating, let the employer know your travel plans and expected date of arrival . Inform the employer of your new (orinterim)addressandtelephonenumber.
1313 Ivory Tower LaneCollege Town, CA 91984(530)75X-XXXX
May 13, 20XX
Jeanne RichardVice PresidentXYZ,Inc.1000 Smith WayLos Angeles, CA 90XXX Dear Ms . Richard: I am grateful for the offer of a career position with your organization . My interviews with you and other members of the staff were pleasant, and I was very impressed with the excitement, productivity and strengths ofXYZ,Inc. Regretfully, I must decline your offer as I have accepted a position at another firm . I appreciate the opportunity to interview with your organization and want to thank you for your time and consideration . Sincerely, David Fox David Fox
Letter to Decline a Job OfferIt is courteous to inform employers from whom you’ve received offers that you have accepted another position . Your letter should be positive and gracious, but need not elaborate on the reasons for your decline . Indicate your appreciation of the offer and thank people who were particularly helpful .
Additional Letter SamplesRe
sum
es a
nd C
orre
spon
denc
e
icc.ucdavis.edu 41
InterviewingGetting StartedKnow Yourself The interview is your opportunity to promote yourself . It is about your ability to tell a story about yourself and articulate your:
•Values•Skills•Interests•Abilities•Longtermplans
Specifically discuss:
• Howyourprofessionalgoalsmatchwiththejobandhowyour skills and experiences will contribute to the job .
• Yourskillswithanexampleofatimewhenyoudemon-strated those skills . It isn’t enough to say you have great communication skills; support that statement with an example .
Page 13 offers a “transferrable skills” check list .
How to Prepare and PracticeKnow the Organization Research the organization’s website and understand the missionofthecompany.Noteanyimportantdetails(newproductsorservices,news,acquisitions,etc.)astheycouldbementioned in the interview .
Read the annual report and company literature, attend on-campus information sessions and meet representatives at internship and career fairs . Read newspapers and industry trade journals, and listen to the news to keep informed about trends .
Know the Interview Details Call HR or the recruiter to ask about interview details:
• The type of interview: “Is it a panel interview? Should I bring writing samples to the interview?” or “Are tests a component of the interview?” ( Seepage42).
• The length of the interview: “How much time should I allow for the interview?” If considering scheduling multiple interviews in one day, this will be important to know .
• Accurate directions to the interview location. Check the directions using multiple sources .
Review Review the responsibilities in the job description and determine specific examples of success for each responsibility based on your past experiences .
Reviewyourresumetoprepareforquestionsaboutitscontent .
Additional Tips: • Bringmultiplecopiesofyourresume,transcriptsand
references .
• Preparequestionstoaskattheendoftheinterviewifrequested.( Seepage45).
Rehearse
Practiceansweringquestionsbeforetheinterview( See page45).Herearesuggestions:
• Holdamockinterviewandaskforfeedbackaboutyourperformance .
• Practicewithataperecorder,videocameraormirror.
• Eliminatefillerwordssuchas“um,”“like”and“youknow .” Practice speaking slowly and clearly .
• Ifanemployerasksaquestionyouaren’tpreparedfor,repeatthequestionaloud,allowingyousometimetoformulate your answer . If you need more time to think, say“That’sagoodquestion;I’llhavetothinkaboutit.”
What to Wear What you wear to an interview makes a lasting impression . Wear clothing that is clean, pressed and businesslike . In most cases, “businesslike” translates to a suit . Women can wear a suit with either skirt or slacks . If you are uncertain about what to wear to an interview, call HR to find out what the typical work attire is and dress one level up, look at the company’s website to learn more about the company culture or watch the “Dress for Success” webshop found at icc.ucdavis.edu/webshops .
Tips • Pressedclothes,nowrinkles
• Cleanandpolishedshoes.Noopen-toeortennisshoes
• Nylonsordarksocks
• Minimaljewelry,nofacialpiercingsandcoveryourtattoos
• Nosleevelessclothing,spaghettistraps,baremidriffsorlow-cut blouses
• Skirtsshouldbejustabovethekneewhenseatedandnottoo tight
• Menshouldwearawhitet-shirtundertheirdressshirt
• Golightonthecologne/perfumeordonotuseatallsincesome people have fragrance allergies
• Nogumchewing
• Before the interview, turn off cell phone—not vibrate
• Haveacoupleofinterviewoutfitssoyou’llhaveoptionsifasked back for a second interview
To Stay Within a Budget To save money, shop at consignment stores such as, All Things Right and Relevant . Consider a versatile blazer and two matching trousers or skirts . Learn to mix and match with shirts and accessories . This is a cost effective option that provides interview variety .
Interview Emergency Bag Pack an interview emergency bag for your car with mints, mouthwash,deodorant,map,comb/brush,extranylons,bottledwater and employer contact info . You may want to bring an extra shirt/blouseandtieifyouhavemultipleinterviewsinaday.
Interview Help Anytime!Visit icc.ucdavis.edu/webshops and watch “Interviewing Skills” to get interview help whenever you need it .
Interviewing for Em
ployment
42 University of California, Davis
• engageinanactivesimulationorassessmentto demonstrate problem-solving capabilities
• communicatewithemployersviaphone,Skype,etc.
Day of the Interview It is likely you will be nervous before your interview .
Here are some tips:
• Personal hygiene. Shower and be well groomed .
• Leave time for mishaps. Traffic, road construction, flat tire—leave time in the event that something happens .
• Eat prior to the interview .
• Be courteous to everyone at the interview location. You don’t know who will be interviewing you, so be polite and pleasant to everyone . If you are rude to anyone, even a janitor, that information will, more than likely, get back to the interviewer .
• Arrive early . Arrive at the interview site approximately 15 minutes before your interview . Do not be late! If you know you will be late, call and let the interviewer know .
The Interview Process • Casual conversation. The interview begins with light
conversation meant to put you at ease . Use this time to build rapport .
• Down to business. The actual interview begins when the interviewer describes the position and organization . Listen for any recent changes and how the interviewer refers to the position .
• Employerwillaskquestionsaboutskills,education,training and work history . Many standard or behavioral-basedinterviewquestionswillbeasked.( See pages 44and45).
• Beselectiveabouttheexperiencesyoupresent.Alwaysemphasize the positive, but NEVER exaggerate or falsify information .
• Showconfidenceinyourresponseseveniftheyaskaboutaskillorexperienceyoudon’tpossess(example:“Ihavenot worked with that particular software package but have worked with similar packages such as _____ and feel confidentIcanlearnthisprograminminimaltime”).
• Whenaskedaboutyourweaknesses,donotrevealamajor flaw and be cautious about revealing a personal problem . Talk about an area you would like to improve and mention the steps you’ve taken to improve it as well as the results .
• Betruthfulaboutyourwillingnesstotravelorrelocate.
Types of Interview Questions Recruitersoftendrawfromvarioussetsofquestionsincludingtraditional,behavioralandcaseinterviewquestions.
Traditional Interview Questions.Thesequestionsseekinsightintowhoyouare,yourexperience(educational,workandlead-ership)andhowyouwouldfitintothejobandorganization. ( Seepage45forexamples)
References Contact your references to ask them for permission first, and email them an updated copy of your resume and the job description as a courtesy . Prepare your references to discuss your qualitiesthatrelatebesttothenewposition.Prepareyourrefer-ence sheet before the interview with at least three references and a heading that includes your name and contact information .
Types of Interviews • Screening. This interview usually lasts 30-45 minutes
and can take place in person or on the phone . It is used to determine whether the company will invite you to continue in the selection process .
• On-site interview. This interview is conducted at a company facility . If travel is involved, the company may offer to pay for your expenses; do not assume this is the case . Keep receipts and carefully follow the guidelines provided by the company .
• Interview over a meal. This interview is not a social func-tion, it is part of the formal process . Manners count!
• Phone interview.Makesureyouareinaquietloca-tion, able to focus on the call and speak clearly . Have your resume, job description, references and notes by the phone . If using a cell or portable phone, make sure your batteries are charged and you are in a location where you have good reception .
The interview may also vary in size:
• One-on-one interview. One interviewer and one inter viewee is the most common experience . You may have individual interviews with several members of an organization .
• Panel interview. You will be interviewed by a committee, usually between 2-6 people . When you enter the room, shake each interviewers’ hand while introducing yourself . It is important to make eye contact with all interviewers . At the end, shake their hands again while thanking them .
• Group interview. You will be interviewed simultaneously withothers.Theinterviewerswilltaketurnsaskingques-tions while the other group members observe . Show your listening skills by paying attention to what others say and try not to repeat their responses . Also be prepared for group projects . If your group is assigned a project, use this opportunity to show your leadership skills by keeping the group on track and completing the project .
• Group Panel. You and other interviewees are interviewed by a panel . Participate using the same skills as those needed for a group interview .
Other Possibilities Someemployersareusingmethodsotherthan(orinaddi-tionto)astandardinterviewinmakinghiringdecisions. You may be asked to:
• submitorevaluateawritingsample
• makeapresentationtotheinterviewcommittee(oftenusingelectronicmedia)
• takeapersonalityassessmenttoevaluatepotentialfit
Inte
rvie
win
g fo
r Em
ploy
men
t
icc.ucdavis.edu 43
Interviewing for Em
ployment
• Leavetheinterviewerwithapositiveimageofyoubeingconfident, enthusiastic and courteous .
• Send a thank-you letter within 24 hours. Refer to the interview, the knowledge you gained about the position andorganizationandyourqualificationsandinterest.Anemailthank-youisappropriate.( Seepage39).
Don’t • Exaggerateorlie.
• Apologizeifyouthinkyouinterviewedpoorly.
• Askforfeedbackonyourinterviewingstyle.
Behavioral Interview Questions.Thesequestionsarebasedon the theory that your past behavior is a key indicator of your future performance . Review your background for examples of class projects, work experience, community service, and leader-ship activities illustrating your talents, problem solving abilities, communication and leadership skills . Think of past situations that did not go well, how you resolved them, and what you learned.( Seeboxonpage44formoreinformation).
Case Study Interview Questions.Thesequestionsgiverecruiters an opportunity to observe how well you think on yourfeet.Youwillbepresentedacomplexquestionandaskedto find a solution . For example, “How many people are using the Internet right now?” or “How many airplanes are currently intheair?”Inthistypeofquestion,therecruiterislookingforinsights about your analytical and problem solving skills . You are expected to think out loud, walk the recruiter through your thought process .
At the End of the Interview At the close of an interview you will have an opportunity to askquestions.Remember,interviewsgobothways.Theywillinterview you to see if you are a right fit for the company, but you should take the same opportunity to see if the company isagoodfitforyou.Askstrategicquestionsthathelpyouassess the job or highlight your knowledge about the company orposition.( Seepage45foralistofpossibleques-tions).Questionsrelatedtosalary,benefits,vacationtimeandschedule should wait until the employer initiates those topics or you are offered the position .
Do • Re-emphasizeyourinterestintheposition.
• Askforabusinesscard—makesureyouhavetheinter-viewer’sname(oraskthereceptionist).
• Asktherecruiterwhenyoucanexpecttobecontacted.
• Shaketherecruiter’shandandsincerelythankher/himforconsidering you .
Illegal Interview Questions Itisillegaltoaskquestionsregardingrace,gender,sexual orientation and identity, religion, marital or family status, age, disabilities, ethnic background and country oforigin.Ifyouhavebeenaskedanillegalquestionyoucan choose to answer it, politely decline to answer it or answerthe“intent”ofthequestion.Forinstance,ifasked,“Wherewereyou/yourparentsborn?”youcouldrespond,“I would prefer not to answer, but I can legally work intheUnitedStates.”VisittheU.S.EqualEmploymentOpportunity Commission website at eeoc.gov for moreinformation.PleasereportanyillegalquestionstoanICC Staff Member .
7777 Hollywood RoadDavis, CA 95616(530)XXX-XXXXpmraidt@ucdavis .edu
March 12, 20XX
Mr . David William ArpHiring MangerEGP Laboratories123 Street NameSometown, ST 00000
Dear Mr . Arp,
Thank you for discussing the various laboratory positions available within your company at the UC Davis Career Fair on February 8, 20XX . Iamexcitedaboutboththemanufacturingandqualitycontroldivisionsof your organization and would like to work for EGP Laboratories after I graduate in June .
My background as a Biotechnology major has prepared me to understand the theory behind the work at your company and has supplied me with a number of the skills you described as necessary including PCR, gel electrophoresisandaseptictechnique.Youemphasizedthevalueofteamwork within your organization . I believe my participation in the Student Leadership Development Series and as a Student Advisor in the Human Corps office attest to my ability to work as a team member while being independently responsible for prioritizing my work and meeting deadlines .
I’m including an updated copy of my resume for your review and would welcome an opportunity to speak with you further . Please let me know if Icanansweradditionalquestionsaboutmyexperienceortoscheduleaninterview .
Sincerely,
Patricia M. RaidtPatricia M . Raidt
Follow-up LetterIf you don’t hear from a company within two or three weeks of submitting your resume or interviewing with them, follow-up with a phone call or a follow-up letter . It is also advisable to send follow-up letters to company representa-tives you speak to at career fairs .
44 University of California, Davis
Tips for the Behavioral Interview Behavioralinterviewquestionsassesshowyouhaveactedinpastsitu-ations, with the idea that past performance is a key indicator of your future efforts .
How to Prepare 4 Review and select some challenging experience that reflects posi-
tively on your behavior including work situations, project-based or team work, campus activities, community service and leader-ship experience . Employers are investigating how you deal with problems, failures, difficult teams or supervisors .
4 Focus on your strengths and positive attributes, without complaining or criticizing others .
4 Jot down ideas about each experience and examine your role . How did you handle problems, show initiative and contribute to the outcome?
4 Use the S.T.A.R. method to help you form an example: •Situation•Task/Problem•Action•Result
4 Expecttheemployertoaskanopen-endedquestionaboutapastexperienceandthencontinuetoaskquestionsthatrevealanyofthe following:
• communication skills, leadership and organizational ability • analytical and problem solving skills • your decision-making process • cooperativeand/orcompetitivenature • initiative • flexibility • creativity 4 Be honest . Don’t exaggerate . Your answers will be reviewed for
consistency . 4 Practice . Draw from several types of experiences to show depth . 4 Turnanyinterviewquestionintoabehavioralanswerwithan
example . 4 Examplesofbehavioralinterviewquestionscanbefoundat
icc.ucdavis.edu, click on Interview Do’s and Don’ts .
Example of a Behavioral Interview Question and Response:Question: “Give me an example of a time when you took the initiative to improve a project .”
Response Using the S.T.A.R. Method: “As a peer advisor at the InternshipandCareerCenter(Situation),studentsoftenaskedmehowtofindjobopportunitiesinbusiness(Task/Problem).SinceIwasalsocurious about my future in this industry and had taken a Web-authoring class, I asked my supervisor if I could create a website linked to our homepagediscussingmanyofthedifferentbusinessoptions(Action).After developing the site, I shared the online resource with the profes-sional staff at the ICC . They were so pleased with the resource that they nowreferstudentstothesiteduringtheiradvisingsessions(Result).”
Expectadditionalquestionssuchas:“Howdidyouprioritizethisaddi-tional work load? How did you decide what options to include? Where can I see this webpage?” Be prepared to back up your statements .
Salary • Waitfortheinterviewertobringupthetopic
ofsalary,benefitsandsick/vacationtime.
• Youcanaskaboutsalaryif you have been offered a job without the salary package being disclosed .
• Ifaskedhowmuchyouexpecttoearn,statethe market range, not a single figure . Visit the Salary/LaborMarketlinksontheICCwebsite:
icc.ucdavis.edu to find this information . When researching, take into account different aspects such as location . While the Internet has helpful salary information, often the best sources on salaries are current employees within your industry . You can also discuss salaryquestionswiththeICCstaff.
• Ifyouareofferedasalarythatisunac-ceptable, respond with a counter offer and support it with market salary figures and your qualifications.Knowinadvanceifyouarewilling to walk away from the job offer if your counter is not accepted .
• Alwaysapproachnegotiationwithtactandintegrity .
Inte
rvie
win
g fo
r Em
ploy
men
t
See examples of thank-you and apology letters on page 39 .
icc.ucdavis.edu 45
Interviewing for Em
ployment
Review books on “interview questions” in our Internship and Career Center Library, 215 South Hall, UC Davis:There are many resources to help you with tough interview questions,andothertipsonpreparingfortheinterview.
Employers May Ask You... • Tellmeaboutyourself.(Thisquestiongetsaskedthe
majorityofthetime—expectit.) • Whydidyouchoosetointerviewwithourorganization? • Describeyouridealjob. • Definesuccess.Failure. • Ofwhichthreeaccomplishmentsareyoumostproud? • Tellmeaboutatimewhenyouwereinaleadershipposition. • Whatskillsorideasdoyoubringtoajobthatanother
candidate may not be able to offer? • Wheredoyouwanttobeinfiveyears? • Whydidyouchooseyourmajor? • WhydidyouchoosetoattendUCDavis? • Inwhichcampusactivitiesdidyouparticipate? • Whichclassesdidyoulikemost?Least?Why? • Whatjob-relatedskillshaveyoudeveloped? • Whatdidyouenjoymostaboutyourmostrecent
employment? • Givemeanexampleofatimeinwhichyouprovideda
solution to an employer . • Howdoyouthinkaformersupervisorwoulddescribe
your work? • Tellmeaboutatimewhenyouhavepersuadedothersto
adopt your ideas .
• Whatkindofsupervisordoyouprefer? • Describeyourexperienceworkinginateam. • Howdoyouorganizeandplanmajorprojects? • Describeyourcommunicationstyle. • Tellusaboutyourexperienceworkingindiversework
environments .
You May Ask Employers... • WhattypesofassignmentsmightIexpectinthefirst
six months on the job? • Whatwillthefirstthreeweeksbelike?Istrainingprovided? • Whatdoyoulikebestaboutyourjob/company? • Whatproducts(orservices)areinthedevelopmentstage
right now? • Doyouhaveplansforexpansion? • Whatcharacteristicsdotheachieversinthiscompany
seem to share? • Istherealotofteam/projectwork? • Whatareyourgrowthexpectationsforthenextyear?
• Howdoyoufeelaboutcreativityandindividuality? • Inwhatwaysisacareerwithyourcompanybetterthan
one with your competitors? • Whatisthelargestsinglechallengefacingyourstaff
(department)rightnow? • Wheredoesthispositionfitintotheorganizational
structure? • Whatisthenextstep?WhenshouldIexpecttohearfrom
you or should I contact you? • Howwouldyoudescribethemanagementstyleinthis
company/department? • Wheremightapersonwhohasbeeninthisposition
expect to be in five years?
Remember that this is a time to show what you know about the company. Ask questions that highlight your knowledge e.g.:“I noticed on your website that teamwork is a core value of your company . How often do employees work in teams versus independently?”
Interview Questions
Second Interviews, Interviews over Meals, and More...The information presented here will assist you in successfullycompletingyourinitial/screeninginterview.For more detailed information on interviewing topics such as second interviews, interviews over meals, and dressing for success; talk to an ICC coordinator or go to the ICC website at icc.ucdavis.edu .
Interview TipWhile you will need to rehearse answers for an inter-view, remember: An interview is a business conversation . Avoidansweringaninterviewquestionwithamemorizedresponse! Share information and detail beyond what you summarized in your resume .
Succeed with us
/4-1
0/11
280
Our graduate students learn from and conduct research alongside renowned faculty who are leaders in their fields. New Mexico State University’s interdisciplinary programs,
pioneering centers and world-famous institutes give graduate students knowledge and experience that opens career doors.
575-646-2736prospective.nmsu.edu/graduate
46 University of California, Davis
Evaluating a Job OfferIn
terv
iew
ing
for E
mpl
oym
ent
Once you receive a job offer, you must decide if you want the job . Fortunately, most organizations will give you a few days to accept or reject an offer . Consider:
The OrganizationBackground information on an organization can help you to decide whether it is a good place for you to work . Factors to consider include the organization’s business or activity, financial condition, age, size, and location . For information and links on how to gather background information on companies see http://data.bls.gov/cgi-bin/print.pl/oco/oco20046.htm.
The JobEven if everything else about the job is attractive, you will be unhappy if you dislike the day-to-day work .
• Where is the job located? If the job is in another section of the country, you need to consider the cost of living, the availability of housing andtransportation,andthequalityofeducationalandrecreational facilities in that section of the country . Even if the job location is in your area, you should consider the time and expense of commuting . For a reality check see
http://www.relocationessentials.com/ and http://www.bestplaces.net/col/.
• Does the work match your interests and make good use of your skills? The duties and responsibilities of the job should be explainedinenoughdetailtoanswerthisquestion.
• How important is the job to the company or organization? An explanation of where you fit in the organization and how you are supposed to contribute to its overall goals should give you an idea of the job’s importance .
• What will the hours be? Most jobs involve regular hours—for example, 40 hours a week, during the day, Monday through Friday . Other jobsrequirenight,weekend,orholidaywork.Inaddition,somejobsroutinelyrequireovertimetomeetdeadlinesor sales or production goals, or to better serve customers . Consider the effect that the work hours will have on your personal life .
• How long do most people who enter this job stay with the company? High turnover can mean dissatisfaction with the nature of the work or something else about the job .
Opportunities Offered By EmployersA good job offers you opportunities to learn new skills, increase your earnings, and rise to positions of greater authority, responsibility, and prestige . A lack of opportunities can dampen interest in the work and result in frustration and boredom .
Some companies develop training plans for their employees . What valuable new skills does the company plan to teach you and what promotion possibilities exist within the organization? If you have to wait for a job to become vacant before you can be promoted, how long does this usually take? When opportunities for advancement do arise, will you compete with applicants from outside the company? Can you apply for jobs forwhichyouqualifyelsewherewithintheorganization,orismobility within the firm limited?
Salaries and BenefitsWhen an employer makes a job offer, information about earnings and benefits are usually included . Research to determine if the offer is fair . If you choose to negotiate for higher pay and better benefits, objective research will help you strengthen your case .
What is the compensation package? Consider base salary, commission, bonuses, and projected salary increases . Benefits can add a lot to your base pay, but vary widely . Find out exactlywhatthebenefitpackageincludes(e.g.,vacation,sicktime,insurance—health,life,dentalvision,401(k),pensionplansandstockoptions)andhowmuchofthecostyoumustbear .
To research salaries in your industry and geographic locations as well as how to negotiate successfully, see http://iccweb.ucdavis.edu/students/negotiation.htm.
Additional information is available from the U .S . Bureau of Labor Statistics, Occupation Outlook Handbook, 2010-11 . See http://data.bls.gov/cgi-bin/print.pl/oco/oco20046.htm for more details .
Growing up, I spent most summers with my grandparents in Honduras. From this early time in my life, I felt inspired by public service as I witnessed family and community members organize civil improvement projects such as protecting the culture of native Garifuna people. I became increasingly aware of the importance of political freedom and economic opportunity to national development, and I became interested in pursuing a Foreign Service career.
As a Foreign Service Officer (or U.S. diplomat) I have worked extensively throughout Latin America on myriad of issues from drug trafficking, human rights, poverty, women’s issues such as domestic violence, and economic security. With a passion for women’s rights and empowering them with knowledge, I have been instrumental in helping local women understand, and implement, tactics used to effectively lobby for human rights causes. In fact, I nominated a woman who received the first International Women of Courage award.
My career has purpose and when I think back to those summers in Honduras, I realize that my passion for public service and dedication to improving human rights worldwide have led me to where I am today.
To learn more about Heidi and careers with the U.S. Department of State, visit careers.state.gov/HACU12
I am an advocate for human rights.
Heidi, Foreign Service Officer
U.S. citizenship is required. An equal opportunity employer.
careers.state.gov/HACU12
Join the LeaderThe Industry’s Largest Real Estate Investment Sales Force
■ Careers in Investment Sales and Financing
■ Extensive Training and Development Programs
■ State-of-the-Art Technology and Marketing Systems
To access the investment market, contact the market leader
Ryan DeMarRegional ManagerSacramento Office(916) 724-1400
Chico State Career Fair 2012 7.25”w X 4.75”h 4C
AGSM.UCR.EDU
THE A. GARY ANDERSON GRADUATE SCHOOL
OF MANAGEMENT
ARE YOU READY FOR SUCCESS?
Get Your MBAGrowing businesses and economies need leaders who can think strategically. The MBA program at UCR offers a curriculum and faculty with strength in every discipline on which growth depends. The program offers an educational experience that trains students to develop leadership skills and become responsible leaders.
Become a Qualified CPABeginning in 2014, California will require a fifth year of accounting and ethics coursework for all licensed practitioners. Be prepared. Complete your Master of Professional Accountancy (MPAc) degree at UC Riverside in less than one year.
Santa Clara MBA for Emerging Professionals
Manage your transition into a successful career with the Santa Clara
MBA designed for new professionals.
Enhance your profile in the marketplace with the MBA that puts your
education to work.
Learn more about the Emerging Professionals MBA at:
www.scu.edu/emergingprofessional/[email protected]
“ The Emerging Professionals MBA is ideal for recent graduates who are as serious about improving their management skills as they are about enhancing their technical expertise.”
Jared Orrock, MBA ‘13 Accounting Manager/CPA
630.938.0200 • CRMpubs.com