The Current Issue 10

Vol. XXIV April 9, 2010 St. Petersburg, Florida Issue 10

The Official Student Newspaper of Eckerd College

General Petraeus 47th commencement speakerHow did Eckerd make the choice?

News & Features — Page 3

The study abroad experienceAn unforgettable opportunity

Arts & Entertainment — Page 14

Staying afloat off-campusHe’s on a boat

Viewpoints — Page 12

Winter Term 2010 Photo Winners

By ABBy Gestl

Staff Writer

As a CPS event and part of the Plight and Promise of Africa initiative, Dr. Andy Tatem recently spoke at Eckerd about the emerging field of using technology to better track people and diseases. Tatem works in the Emerging Pathogens Institute and Department of Geology at the University of Florida.

The disease in question was a type of malaria caused by protozoan parasites carried by female mosquitoes--- a disease that can be fatal if untreated. In 2007, there were as many as 550 million cases of clinical malaria. The death count consists mostly of children under 5, and total deaths from malaria ranged from one to three million.

Malaria comes in three versions: the halo type, which is less severe, providing a better chance at survival; the meso type, which gives one a reduced chance of survival; and finally, the one strain of malaria with the least survival chance, hypo.

The major danger zone for being infected with malaria is in the tropics, which is, unfortunately, where about

48 percent of the global population lives. The type of treatment proposed for fighting malaria mostly depends location, though. Africa, India and South America are some of the biggest areas of infection.

According to Tatem, collected data suggests cities and urban areas are safer places in terms of malaria. Rural areas have the higher risk of malaria. The danger of catching malaria has become an expanding global threat. For example, a mosquito could get trapped in a plane from Africa and end up anywhere in the world, ready to bite. The threat of this occurring, however, is low. In the last 15 years, no more than 30 cases of airport malaria have been reported, many of which were in Europe during the summer when temperatures are best for mosquito survival.

According to Tatem, the first massive efforts to eradicate malaria began in the 50s. As a result, 25 countries were declared malaria free, thanks to the use of DDT, though the worldwide goal failed overall. The cause to wipe out malaria was taken up again by the Gates Foundation. There have been major movements since then to rely more on bed nets, drugs and fast diagnoses to counter infection rates. The most recent drug to help battle malaria also seems to help block the transmission of the disease, helping to lower infection rates.

One proposed way of measuring malaria cases is through the Entomological Inoculation Rate (EIR). EIR is a measure of the number of bites per person per year. This measurement was pioneered by a graduate student who agreed to sit outdoors overnight, and count the number of bites. Obviously, this was not the most popular method, and fortunately, a second type of measurement was developed: the Parasite Rate. With PR, an entire community is tested for malaria, and then the percent of the infected community is recorded.

The African island of Zanzibar was used as a test site to try to control malaria. Zanzibar has a population of about 1.2 million people, is humid, and has two rainy seasons, making it the perfect place to test malaria controls. Data from 1999 to 2006 shows a steady drop in malaria infections, though there was a small increase in 2003 because of drug resistance, which was solved with the development of a new drug. The problem with the test site is that it was next to a mainland country that had less control over malaria, so there was a fear of the continued transmission of malaria into Zanzibar from the mainland, especially since ferries run between the two.

Controlling and eliminating malaria will take a long time and be a continuing process for affected countries. Even in the best case scenario, it would still take about five years for Zanzibar, for example, to be called malaria free. A real estimate would be closer to 20 years.

During the CPS event, a concerned student asked about the collateral damage to the food chain brought on by killing all the mosquitoes with malaria. Tatem asserted that data strongly suggest mosquitoes do not play such an important role in the ecosystem that they would be missed if eliminated.

2 Friday, April 9, 2010

news & features

Executive Board

Managing EditorMeagan Bemis

[email protected]

Editor-in-ChiefPetra Stevenson

Copy EditorEmily Krumm

Director of AdvertisingCaitlin Gerry

Asst. AdvertisingAbby Gestl

[email protected]

Faculty AdviserTracy Crow

Editorial Board

News EditorLaurel Ormiston

[email protected]

Entertainment EditorFrancie Devine

[email protected]

Viewpoints EditorCatee Baugh

[email protected]

Photography EditorsShawn Craine

Erin Linebarger

Sports EditorMax Martinez

[email protected]

Sports PhotographerDoug Thayer

Staff Writers

Jaclyn NewJeralyn DarlingJohnny Jones

Sarah MalhotraSarah Yost

Will CreagerAbby Gestl

Kasey KilinskiEthan PackeySaige Liparulo

Contributing Writers

Brooke BargowskiAmy Share

Dexter HowardJames ClappierHolly Eikenberg

Ben Maxwell

• April 9, 2010 •• Vol. XXIV Iss. 10 •

Tracking malaria across the globeWho moved my human?

Friday, April 9, 2010 3

news & features

See BIO on PAGE 7

Petraeus to address 47th graduating class

By CAitlin Gerry

Special to The Current

he recent announcement of Army General David Petraeus, commanding

officer of Central Command, as Eckerd’s 47th commencement speaker, and the dialogue that later ensued among students, prompted us to take a closer look at the college’s selection process.

Just how does Eckerd College go about selecting a speaker, year after year?

Of the 97 students who responded to our survey, 10.4 percent are under the impression that seniors choose the commencement speaker, although 36.5 percent believe otherwise. Twenty-five percent, however, do believe seniors get a vote, and 28.1 percent believe the choice is made by a committee of student representatives.

The truth is, they’re all wrong. But this is not to say that the administration ignores student opinions. “Everything Eckerd College does attempts to be part of the undergraduate experience that is rich, diverse and thoughtful,” said President Donald Eastman about the selection process.

First of all, there is no formal procedure, though this hasn’t always been the case. Until four years ago, a formal committee consisting of students, faculty, Dean of Faculty Lloyd Chapin and Dean of Student James Annarelli generated a list of names of potential speakers. The list was then forwarded to Eastman. However, this formal process eventually ended since each year, although a lengthy list was compiled, the college was unable to secure one of the speakers because of scheduling or cost issues. As an example, former President Jimmy Carter always topped the list.

In today’s less-formal procedure, which is an “ad hoc system,” as Annarelli describes it, the names of potential speakers are provided to the administration through connections made by students, faculty, trustees and friends of the college. When a possible speaker is identified, the Student Affairs office assembles small focus groups of seniors from various backgrounds to gauge reaction and interest. According to Annarelli, these seniors are encouraged to gather feedback from their peers, and the feedback is then funneled back to Eastman and

Annarelli. If favorable feedback is gathered, Eastman extends an invitation to the potential speaker.

What most students probably don’t realize about this process is that Eckerd does not pay its commencement speakers. Fees for high visibility speakers can run into the tens of thousands of dollars in some cases. So not only does a potential speaker need to be available on commencement day but he or she must also be willing to speak without charge.

For this year’s commencement, the search started nearly a year ago, and not until late January did Eastman receive confirmation that Petraeus was available and willing to speak.

This is not to say Petraeus was a last resort. On the contrary. Many within the Eckerd community have voiced excitement that Petraeus will be the 47th commencement speaker. Others, because of the general’s obvious military connection to the current war, have voiced concerns. When asked his opinion, Annarelli stated, “When you are dealing with an individual who is playing an incredibly decisive role in the unfolding of U.S. foreign policy in this very complicated world, and when that individual also brings to the conversation not only extensive experiences but also impressive academic credentials – that individual, whether you agree with him or not, is a voice that should be admitted to the conversation about global affairs on a college campus.”

Since the announcement, Eastman has received more positive than negative feedback from students. However, a handful of students did recently organize a meeting to discuss concerns. No course of action resulted. When asked about students’ concerns, Eastman acknowledged that students may decide to protest. However, he suggested, “Commencement is a time where most people want to celebrate.”

In a perfect world, as it relates to future searches of commencement speakers, Annarelli says a committee comprised of juniors would begin working a year in advance and would have the necessary resources for acquiring their candidate. In the meantime, Annarelli acknowledges that the results of the survey suggest the need to help students understand the challenges in securing a commencement speaker and the need to continue to include seniors in the process in every way possible.

Courtesy of CentrAl CommAnd

General David H. Petraeus assumed command of the United States Central Command in October 2008, after serving for over 19 months as the Commanding General, Multi-National Force-Iraq. Prior to his tour as MNF-I Commander, he commanded the U.S. Army Combined Arms Center and Fort Leavenworth. Before that assignment, he was the first commander of the Multi-National Security Transition Command-Iraq, which he led from June 2004 to September 2005, and the NATO Training Mission-Iraq, which he commanded from October 2004 to September 2005. That deployment to Iraq followed his command of the 101st Airborne Division (Air Assault), during which he led the “Screaming Eagles” in combat throughout the first year of Operation Iraqi Freedom. His command of the 101st followed a year deployed on Operation Joint Forge in Bosnia, where he was the Assistant Chief of Staff for Operations of the NATO Stabilization Force and the Deputy Commander of the US Joint Interagency Counter-Terrorism Task Force-Bosnia. Prior to his tour in Bosnia, he spent two years at Fort Bragg, N.C., serving first as the Assistant Division Commander for Operations of the 82nd Airborne Division and then as the Chief of Staff of XVIII Airborne Corps.

General Petraeus was commissioned in the Infantry upon graduation from the United States Military Academy in 1974. He has held leadership positions in airborne, mechanized, and air assault infantry units in Europe and the United States, including command of a battalion in the 101st Airborne Division (Air Assault) and a brigade in the 82nd Airborne Division. In addition, he has held a number of staff assignments: Aide to the Chief of Staff of the Army; battalion, brigade, and division operations officer; Military Assistant to the Supreme Allied Commander - Europe; Chief of Operations of the United Nations Force in Haiti; and Executive Assistant to the Chairman of the

courtesy of Central

Command

Introducing the general

How EC finds commencement speakers

T


news & features

Campus Hillel gains new rabbiBy Amy shAre

Contributing Writer

What is Hillel (pronounced hil·lel)? According to their Web site, they are the largest foundation for Jewish life on college campuses in the world. Surprisingly though, unless you are of the Jewish faith, Eckerd students have no idea what Hillel is.

The Hillel at Eckerd College is actually part of a larger Hillel, called Sun Coast Hillel, which includes the Hillels of the University of Tampa, USF, Ringling College and New College. A few years ago, Hillel was actually quite popular on campus and they hosted many different events to celebrate the Jewish holidays throughout the year, but the last president did not leave a successor, which led to the downfall of the club.

But there is good news. For the first time, Eckerd has a campus rabbi, Rabbi Ed Rosenthal, originally from St. Louis. After graduating from the University of Illinois, he became the first rabbi of a new congregation in Auckland, New Zealand. After four years, he moved to Texas and was a rabbi at a congregation there before deciding to work for Hillel. From Texas, Rosenthal moved to Emory University for two years. He then relocated to New York to be the rabbi at Columbia University, where he stayed for eight years before moving to Florida.

Rosenthal’s motivation to move to the Sunshine State had little to do with the beautiful weather. At Emory and Columbia, Rosenthal restarted campus Hillels. He took them from small, unsuccessful groups to large popular clubs. The Sun Coast Hillel was looking for a rabbi because they never had one, and since Rosenthal specialized in improving groups, he took the job.

Rosenthal splits his time among all five campuses by dedicating one workday to each college. He is on the Eckerd campus every Tuesday, which is considered a lucky day in the Jewish faith. Thanks to him, the Hillel at Eckerd has been slowly growing. Hillel now has their own office in Campus Activities and a board of directors. This past December, 13 Eckerd students went on a Birthright trip to Israel for ten days. It was a great learning experience and has inspired other EC students to do a Birthright trip this summer. Hillel has hosted a few new events this year, the latest being the costume contest in honor of the Jewish holiday, Purim. The winner won a free night at the Don Cesar.

By ethAn PACkey

Staff Writer

To those few who do not know, we have made history. Late last month, President Obama and Congress signed a huge health care reform bill.

The bill itself passed on a very thin margin. In the House, 220 were in favor and 211 opposed. It was not universally accepted among democrats either, who comprised 35 of the 211 dissenting votes.

The bill is a phased bill, meaning that some reforms will be activated this year, and the rest will be enforced in 2014. While there are many topics to cover within the health care bill, what will affect us most significantly as college students?

First, you can stay on your parent’s health plan until you are 26. This is an improvement from the age of 22 or graduating college, which were the previous requirements. Another reform that comes into effect in six months is a

ban on discrimination for pre-existing conditions. This means that insurance companies can’t drop you because you’re sick.

In the past, health care companies could limit the amount of coverage used annually. That practice will be eliminated with implementation of the health care reforms.

A final reform of consequence to college students and recent graduates concerns health centers. The bill increases funding for these centers, allowing for them to see twice the number of patients they now serve in coming years. It also increases funding for health care plan awareness offices and prevents unreasonable rate hikes.

Overall, Obama and democrats have churned through an issue contested for the last two decades. The future of health-care reform is unknown. Many epublican states have already challenged it, but that is another battle. For now, rest assured that health care will be more affordable and easier to obtain.

courtesy of Ed Rosenthal

Monumental health carereform will affect students

Courtesy of eCkerd.edu

Eckerd College was recently named one of Tampa Bay’s Top Work Places 2010 by the St. Peters-burg Times. The 60 leading employ-ers in the Tampa Bay region were nominated by their employees, who were then surveyed about a variety of topics, including practices and policies that make these companies the top places to work. Eckerd Col-lege was ranked #15 in the Midsize Company (150-499 employees) cat-egory.

The companies were ranked based on leadership, compensation and training, workplace flexibility and diversity. The rankings were published on TampaBay.com, in the March 21 edition of the St. Peters-burg Times and on March 22 in tbt* Tampa Bay Times.

The Top Work Places 2010 in Tampa Bay program was created by the St. Petersburg Times and Work-placeDynamics.

“This report is significant because it is an unprecedented effort to un-derstand how Tampa Bay’s compa-nies are creating strong, productive work environments, even in difficult economic times,” said Neil Brown, Times executive editor and vice president. “We share the stories of the employees and offer an inside look into what’s working and where there’s opportunity to grow.”

Eckerd one of Tampa Bay’s 60 top employers


news & features

By holly eikenBerG

Contributing Writer

s graduation approaches, many seniors are beginning to contemplate what path they will choose. Does everyone have their future figured

out? Alumnus Marc Paranzino, class of ’08, does. In fact, Paranzino inspired me to think in depth about my own career choices.

Paranzino and I began talking one night while the bartender made our drinks. I do not remember what time it was, or where we were. I remember how he spoke about his desire to become a doctor. He was passionate about everything from scalpels to the periodic table. When I asked why he’d decided to become a doctor, he said, “I’ve been working at St. Anthony’s (hospital) for a long time. One night a lady came in and was bleeding everywhere. I was literally up to my knees in blood. As I held pressure on her wound she asked if she was going to live. I had to lie. I want to be able to tell people they’ll be okay and mean it.”

Two weeks later, I arrive at Paranzino’s apartment in downtown St. Petersburg. He sits at a small, round table with his laptop. His dog, Madison, lies between his feet. Her ears perk up as I enter and she stands to greet me. Paranzino’s glasses reflect his computer screen. He looks up and says hello. I sit down across from him on a wooden chair, and we chat for a little about his recent trip to Somerset, Mass., to visit his mother and father. After a few minutes, I direct his attention back to the purpose of our interview. I want to understand the sober truth about his love for science and medicine, and why becoming a neurosurgeon is his life’s vocation.

Paranzino was a Ford Scholar and the Vice President of the Eckerd College chapter of Omricon Delta Kappa, which is the National Leadership Honor Society. With aspirations of becoming a neurosurgeon, he has now applied to several graduate schools including Wake Forest, Florida State University, University of Miami, University of

Central Florida, University of South Carolina and Boston University.

I immediately feel comfortable with him because of his casual yet polite tone of voice. He seems to be genuinely interested in our discussion. This quality is important if he is to gain the trust of patients. I would never let a doctor I didn’t feel comfortable with near my brain.

He says he needs to complete four more years of medical school and seven years of residency before becoming a full-time doctor. I laugh and tell him eleven years of studying sounds horrible. He agrees; but says it will be worth it because he will be doing something that he loves.

I smile and think for a minute. Maybe this is the reason I am interested in his story. He is devoting

himself fully to his goal, no matter how long or how hard it might be to achieve. That type of patience is something I do not possess. I am ready to be finished with school and will probably accept any mundane job just to receive a paycheck. I ask, “Do you feel that it is your duty to help people?”

Paranzino rests his head on his hand and nods. After a moment he says, “Nemo vi qui mundum non reddac melicrum. That is Latin for ‘What man is a man who does not make the world a better place?’”

I compliment him on his Latin. He laughs. Again I sit in awe at his compassion for people and the world around him. This man truly

wants to make a difference by helping people.I ask, “Where are you working now?”“St. Anthony’s Hospital in St. Pete.”“And what job are you assigned?”“I’m the anesthesia technician. I assist the

anesthesiologists in providing anesthesia before, during and after surgery. I assist in intubation, medications and anesthesia machine diagnostics.”

Intubation is the insertion of a tube into a hollow body organ. This allows the anesthesia to enter the patient’s body.

I next ask Marc about some of the situations he has experienced at the hospital, and how they have helped shape his understanding of or respect for the profession. He says he has seen four patients die in the last four years he has been working at St. Anthony’s, and was involved with the direct care of three of them. He sighs, saying he remembers each death like it was yesterday, and that they are moments that he

will probably never forget. After a moment, he continues, “It will never become easy. However, it’s important to remember everyone has their time, and that there are many other patients who need your help.”

We sit for a moment in silence. Paranzino’s last statement is, to me, one of the most important things for a doctor to know. He understands that to perform your best, to save the next person, you cannot dwell on the lives you could not save. If I ever became a doctor, I think the hardest part would be watching someone who you have been working to save, die. I do not know if I could face their family. I would feel guilty forever. It takes a certain person to be able to do what Paranzino is destined to do. Not many are cut out for it.

I ask, “Have you ever experienced a situation that made you reconsider your choice to become a doctor?”

He thinks for a moment while stroking his dog’s ears. Then he says, “Medicine, as a science, is extremely controversial. I’m constantly reminded life is a gift and the quality of a person’s life is extremely important. I’ve questioned myself many times about why we have done certain procedures [at the hospital] and whether they were the right choices. However, I never have thought ‘this is not what I want to spend the rest of my life doing.”

Alumnus aspires to neurosurgery

“I’ve been working at St. Anthony’s (hospital) for a long time. One night a lady came in and was bleeding everywhere. I was literally up to my knees in blood. As I held pressure on her wound she asked if she was going to live. I had to lie. I want to be able to tell people they’ll be okay and mean it.”

—Marc Paranzino, ‘08

A

courtesy of Wikicommons


news & featuresnews & features

Celiac disease forces tough dietary restrictionsBy Brooke BArGowski

Contributing Writer

Two years ago, Eckerd student Sarah Morgan Lee, 22, began to feel the presence of a condition that started with violent bouts of vomiting, severe anemia and excessive weight loss, and ended with a lifelong ban from pizza and pasta.

Lee has Celiac Disease (CD), an autoimmune disease characterized by intolerance for gluten, a protein found in wheat, barley and rye. In many cases, the disease remains latent for many years, but can become activated at any time. For reasons still unknown to doctors, gluten becomes toxic to those with the disease and impairs the ability of the small intestine to absorb nutrients, resulting in a wide range of problems.

The gene which predisposes an individual to CD is inherited. Approximately 10 percent of a Celiac patient’s immediate family will have the disease.

According to the Celiac Disease Foundation, one out of every 133 people in the United States is affected by the disease. However, much of the population remains oblivious to its existence. When asked about her reaction to finding out she had CD, Lee laughed. “When they told me I was like… well what does that mean?”

Lee got lucky with a quick diagnosis; her doctor has two kids with CD and was able to recognize the symptoms. Unfortunately, this is not usually the case. According to an article by Charlene Laino on webmd.com, only about 5 percent of people with CD are correctly diagnosed. Many doctors only test for the condition in the face of obvious digestive symptoms. Dr. Mark Norstein of Skyway Family Practice

(affiliated with Eckerd’s health center), cited chronic diarrhea as the only symptom that would cause him to call for a Celiac test. “I see one patient with it maybe every five to six years,” he said.

“It’s not that common. Maybe the gastroenterologist sees it more.”

A simple blood test can confirm the existence of antibodies, followed by a biopsy of the small intestine to confirm positive results and assess damage.

Though the test is simple enough, misdiagnoses abound because CD was traditionally thought of as a gastrointestinal disorder. Doctors are now learning that it can manifest in a multitude of ways. There are two categories of symptoms: those of malabsorption (digestive) and those of malnutrition.

The signs of malabsorption include diarrhea, abdominal pain and light colored stools (caused by a hindered ability to digest fat), among other things.

The signs of malnutrition are less straightforward and harder to link to CD. They can manifest through anemia, unexplained weight loss or weight gain, fatigue, depression, joint pain and even infertility – just to name a few.

The only treatment for the disease is a gluten-free diet. Unfortunately, gluten is omnipresent in the American diet - everything from bread to pasta to beer contains it. If the disease is left unchecked, it seriously increases risks for other diseases including diabetes, osteoporosis and cancer.

While the medical world may be somewhat slow on the uptake, the marketing world is catching up fast. Many restaurants, such as P.F. Chang’s and Uno Chicago Grill, offer gluten-free menus. Bakeries that use alternative flours, such as rice or bean, are popping up everywhere, and even more mainstream stores like Trader Joe’s are beginning to carry a variety of products for the gluten intolerant.

Staying satisfied and nourished is no longer the challenge it once was for those with CD. In an online article for USA Today in August of last year, writer Kim Painter even suggests that gluten-free is becoming the next fad diet.

Lee confirmed this progress. She was initially frustrated by the strict diet and occasionally strayed from it when traveling or extremely tempted, but now she is all enthusiasm. “Betty Crocker just came out with new gluten-free baking stuff… it is the best thing in the entire world,” she said. “These cookies are amazing.”

photo courtesy of WikicommonsLove bread? Too bad, if you have Celiac disease.

The only treatment for the disease is a gluten-free diet. Unfortunately, gluten is omnipresent in the American diet—everything from bread to pasta to beer contains it.


news & features

Joint Chiefs of Staff.General Petraeus was the General George C.

Marshall Award winner as the top graduate of the U.S. Army Command and General Staff College Class of 1983. He subsequently earned MPA and Ph.D. degrees in international relations from Princeton University’s Woodrow Wilson School of Public and International Affairs, and he later served as an Assistant Professor of International Relations at the US Military Academy. He also completed a

fellowship at Georgetown University.Awards and decorations earned by General

Petraeus include two awards of the Defense Distinguished Service Medal, two awards of the Distinguished Service Medal, two awards of the Defense Superior Service Medal, four awards of the Legion of Merit, the Bronze Star Medal for valor, the State Department Distinguished Service Award, the NATO Meritorious Service Medal, the Gold Award of the Iraqi Order of the Date Palm, the French Légion d’Honneur, and the National Defense Cross of the Czech Republic. He is a Master

Parachutist and Air Assault and Ranger qualified. He has also earned the Combat Action Badge and French, British, and German Jump Wings. In 2005 he was recognized by the U.S. News and World Report as one of America’s 25 Best Leaders, and in 2007 he was named by Time magazine as one of the 100 most influential leaders of the year and one of four runners-up for Time Person of the Year. Most recently, he was selected by Foreign Policy magazine as one of the world’s top 100 public intellectuals and by Esquire magazine as one of the 75 Most Influential People of the 21st Century.

BIO continued from Page 3

Mammogram guidelines spark national debateBy ABiGAil sustAr

Contributing Writer

The U.S. Preventative Services Task Force stated in November 2009 that women ought to have mammograms biennially beginning at age 50. They also stated that women should no longer be taught self-exams. These statements were intended to be a nonpartisan set of clinical guidelines.

Instead, these recommendations from the USPSTF have created a fiery debate among Americans.

The guidelines contradict the ACS recommendation that urges women to have both clinical and self breast exams starting in their 20s, and to have a mammogram each year once they turn 40. It is the decade gap in starting yearly screenings between the ACS and task force recommendation that has so many doctors up in arms. As the nation moves toward government-run healthcare, such debates have many confused and concerned. How will these new guidelines affect insurance coverage? Whose advice can women trust?

According to the task force’s research, “There is convincing evidence that screening with film mammography reduces breast cancer mortality, with a greater absolute reduction for women aged 50 to 74 years than for women aged 40 to 49 years.” Researchers concluded that annual mammograms for those between 40 and 49 years old might save one life for every 1,000 screened. The research also shows that self-exams and yearly screenings at 40 can lead to psychological and physical

harm. The reasons include over diagnosis, false-positives, exposure to radiation and unnecessary biopsies. The new guidelines are therefore intended to balance possible harmful outcomes by starting the screenings a decade later than ACS recommends.

Despite this, ACS maintains its advice on yearly mammograms. And many doctors agree with them. According to an Associated Press article, Dr. Bernadine Healy is a supporter of the ACS guidelines. Formerly the director of the National Institutes of Health under former President George H.W. Bush, she says, “Women in their 40s have a very aggressive kind of breast cancer. To not screen women in that age group is astounding to me, and it goes against the bulk of individuals who are actually caring for patients.”

Other doctors are more outspoken about their political presumptions. Could this be a sign of President Barack Obama’s new plan to cut healthcare spending? Secretary of Health and Human Services Kathleen Sebelius responded to this very question, stating that the panel of task force members was appointed by former President George W. Bush. In an interview with CBS News, she said the task force is an independent group that has no power to make policy.

Still, some Americans worry that the new guidelines will allow private insurers to cut coverage for women under 50. The Associated Press highlights Dr. Tom Coburn from Oklahoma on this issue. A Republican, Coburn asks, “Do these recommendations make sense from a cost standpoint? Absolutely, from a

cost standpoint, they’re right…From a patient s t a n d p o i n t , they’re atrocious. And that’s the problem with a bureaucracy stepping between a physician and their patient.”

A 20-year-old Eckerd College student, Aprille Brooker, is worried about her future. “My grandmother had breast cancer, and my mother is around the age where she needs to be worried about it. There isn’t a strong history of it in my family other than that, but it’s something we’re going to have to pay attention to, especially if the insurance policies do change because of it.”

As the debate unfolds, women might cling to the advice of Secretary Sebelius. “Do what you’ve always done. Read the task force report, but then talk to your doctor.” She acknowledges that the task force’s job is to update preventive information, but the research should not dictate a woman’s decision. “We want individual patients and doctors

to make their own healthcare decisions and that’s exactly what’s anticipated in health reform.”

Eckerd College Junior Jamie Preira questions the panel on its conclusion about self-exams. “Without learning how to do them, how are woman going to know if a lump has developed at a younger age?” She said that no matter what the new guidelines report, she is still going to perform self-exams and hopes that others will become educated on how to do them as well.


viewpoints


“Amusing

Musings”

“I want to raise alpacas.”

—A creative writing professor on future goals.

EDITORIAL

By Petra StevenSon

Editor-in-Chief

I couldn’t afford to do much over spring break. I couldn’t go on a road trip or a cruise or fly back home to visit my family. Even a service trip was too expensive.

But I was okay with that. I would stay in St. Petersburg and spend some quality time with my boyfriend. I would hang out with my long-neglected friends. Maybe I would even go to the beach—you know, that sandy place with the salty water and the seagulls. Florida is a spring break destination for a reason, after all.

And, I vowed, I would clean out the newspaper office.

That’s right. I locked myself in the Campus Activities building and did some good, old-fash-ioned spring cleaning.

If you’ve ever been in our office, you know it’s fairly small. There is an long, L-shaped desk running the length of two walls, six black cushy office chairs and five white Mac computers with giant screens. We also have a small table, a printer, a two mid-sized filing cabinets and a couple whiteboards tacked up on the wall. That’s about it.

Except for the cupboards. High up on the wall are a row of tan cupboards.

They’re huge. We never use them. Why? Because they’re filled with stuff. And that’s what I wanted to clean out.

The Current (formerly The Triton, The Tri-ton Tribune, The Thimblerig, The Trident, and even The Fishwrapper) has been in Brown 122 for a few years now. Maybe more than a few. And judging by the things in the cupboards (and under the table), everyone who has worked here in the last 15 years has left something—some-thing more than just bylines and newspaper clippings. They have left things—physical, mate-rial things—and those after them have left more things, and on and on until our tiny room was utterly filled with stuff.

It is one thing to clean out your own closet or childhood bedroom. It is something completely different to clean out a room used by different groups of strangers for several years.

I found things that have no obvious place in a college newspaper office. A bag of feath-ers. Spray paint. A bottle of distilled vinegar. A

plastic bag filled with charcoal sketches of nude models. Fishing line. A leather whip a la Indiana Jones. A book titled, Spiriting Around: A Mod-ern Guide to Finding Yourself.

I found old things, outdated things. An ancient fax machine; an old school Mac monitor. Two 15-pound boxes filled with post-it notes with the masthead, The Triton. Triton mugs, too, and a Triton polo shirt. I can’t imagine what our bud-get must have been that year.

Hidden under the far corner of the table, I dis-covered a dusty carboard box filled with floppy disks labeled “Vol. 5, Issue 16 & 17,” “Fonts” and “Sports.” Years of newspaper archives that our modern computers can no longer read.

I found juxtaposition. Canisters of film along-side digital cameras. An electric pencil sharpen-er and a drawer of mechanical pencils.

I found a crusty tin of paint, and for the first time I noticed that one of the office walls is red.

I found faded papers and boxes of miscella-neous files. I found notes. I found doodles and article drafts. Oh no, I would moan, not another stack of manila folders. I emptied the trash twice and lugged two giant boxes of paper to the re-cycling bin. But after a while I started to read, and to learn. I looked at past layouts and head-lines. I noted differences in paper quality, size and color over the years. I laughed at the 2003 spoof issue with the headlines, “Career Resourc-es Center announces Demotivation Workshops” and “New intramural sport only at Nu: drunken brawling.”

Cleaning the office became more than just an exercise in organization: it became a study in contemporary archaeology. For the first time, I really thought about the people who had worked here before me. Who were they? What were they like? And what were they doing with a Barbie doll and an inflatable astronaut?

They helped me, too. I found a number of binders stuffed with handouts covering every-thing from the basics of AP style and the inverted pyramid to stress reduction tips and guidelines for successful leadership. Next year, I will make packets for our editors and staff writers. Next year, I will arrange my own newspaper binder according to theirs, with sections and tabs—not just a jumble of papers like it is now. The past will organize the present. Isn’t that the point?

And by the way, if you have a need for post-it notes (or clipboards or a fax machine or desk fan), feel free to stop by the office.

The Current officeSpring cleaning brings up old news

“Give me a ralph and a hugo, now!”

—A communications professor on the use of language as symbols.

“Guys can horndog all they want and it’s just... ‘what a stud.’”

—A communications professor on the differences between men and women.

“This takes a Ph.D. in journalism to figure out...”

—A creative writing professor on revising rough copy.

viewpoints


EDITORIAL

By JameS ClaPPier

Contributing Writer

9:30 a.m., T-minus thirty minutes. I should have plenty of time to make it to class. Except I have to row 75 yards and hide my rowboat in mangroves before I can even start walking.

These are the challenges I face when living on my boat anchored in the mooring field south of Eckerd College.

Going through my food this particular morning, I realize I ate my last bagel for breakfast yesterday. No matter. I already have the cream cheese and raspberry jam out of the cooler, so I pull out a tortilla, and my bagel becomes a breakfast burrito. I wash the burrito down with a few gulps of ice-cold milk and check the time.

With twenty minutes until class, I climb on deck to brush my teeth and take a leak. The sun is up, and the beginnings of the cool sea breeze contrast its warmth. I hop back down below to pack a few things into my backpack, quickly tidy up the cabin, pull on my sea boots and get ready to row ashore.

The dinghy I use is named Jujubean, a rowboat my friend who also lives on a boat, bought for $40. The oars are tied on with Spectra, one of them is splinted with driftwood and duct tape, but she has never let me down. The boat is only about 6 feet long and doesn’t track straight, so I meander my way to Eckerd.

Approaching the seawall, I aim for a gap in the mangroves and row full speed ahead. The bow grinds over razor-sharp barnacles, and I’m glad I have thick rubber boots on as I hop into shin deep water to pull Jujubean into the mangroves. I secure her to a tree with a bike lock – she’s been stolen twice before – and I head to my room in Kappa to pick up a book and my longboard.

Some people might think this is a ridiculous start to the day, but I think it’s fun.

***Whenever possible, usually

at night, I sail my Santa Cruz 27, Furthur, 24 miles from Tampa to Eckerd College in St. Petersburg with my roommate Cody Spruce or a motley crew of friends looking for some adventure. It’s pretty hard to navigate through Tampa Bay regardless; there are numerous shallows and shipping lanes to negotiate. At night, it can be downright treacherous, even with a GPS and a few beers. One night, we made it in three hours with a stiff easterly and rolling swell pushing Furthur downwind. Surfing these swells at night was great practice for Cody and I in preparation for the 2010 Pacific Cup, a 2,050 nautical mile sailboat race from San Francisco to Kaneohe Bay, Hawaii. The last delivery I did on Furthur took five hours,

with light winds forcing us to motor for half the time. Once we got to Eckerd, I anchored Furthur in the mooring field off

Maximo Park and get ready to live on the water for about a week.

Though the boat has a cabin, there is only sitting headroom, and half the interior space is taken up by sails. No stove, sink, running water or bathroom; life is about as primitive as camping. However, Furthur has an awesome cooler and I’ve taped two “Click-it” LED lights to the ceiling to provide lights. The only power I use comes from small batteries for lighting, and a large 12-volt battery I use occasionally to run an AC inverter, which I charge with a small solar panel. I definitely enjoy music on the boat and usually have my Ipod with me. If I feel daring, I’ll bring my laptop. While some people might balk at being so separated from

modern appliances, I relish living off the grid.

Doing schoolwork on Furthur can be a challenge, but being isolated on a boat also helps me concentrate. It’s easy to read when your only distractions are the slap of waves against the hull, wind in the rigging, and the possibility of a beautiful day in Florida. All too often, though, I fall asleep while reading.

However, when Florida isn’t beautiful in the winter, the cold fronts can be brutal.

One particular storm brought over 55 mph winds and 4-foot tall waves. Unable to row to Furthur without swamping Jujubean, I was stuck onshore hoping the anchor would hold. It’s always nerve-wracking when your home could end up beached and possibly destroyed. From my room looking over Kappa field, I could watch the mast above the tree line. Furthur rode out the storm just fine,

thanks to a hefty Danforth anchor and 20 feet of chain at the end of the anchor line.

After the storm, the cabin was a mess. If an anchor is holding well, the boat will tack back and forth in the wind. Since Furthur’s anchor held very well, each tack caused the boat to roll from side to side, sending my possessions flying. If I had been expecting the storm, I could have better prepared for it. Luckily, everything important stayed dry, including my food.

I’ve been off the meal plan for over a year, so cooking my own food isn’t a new challenge, but the absence of an oven, stove and microwave makes gourmet cooking difficult. To be honest, I find myself eating a lot of sandwiches and cereal, but PB&J, Golden Grahams and organic milk provide a lot of nutrients. I feel most healthy and in the best shape while living in the boat: it must be all the rowing, and the sailing.

Whenever possible, I go sailing to keep working on my feel of the boat, and to find new things to repair or upgrade. Last weekend, I took seven friends out on Furthur, three of them had never been sailing before. Sailing to the Skyway Bridge and back, we saw dolphins, kite boarders and the exposed ribs of a shipwreck. I taught anyone who was interested how to steer the boat, and everyone wanted the sun to hang longer in the sky.

After re-anchoring, some of my friends tried to row Jujubean back to Eckerd, but only made it 50 feet before I had to throw them a line. I pulled them back and rowed everyone to Zeta Beach in two trips to keep from swamping the dinghy. Watching the sunset, alone, I made a sandwich for dinner.

Staying afloat off campus: he’s on a boat

photo courtesy of Wikicommons


viewpointsEDITORIAL

Student finds man’s ultimate act a call to actionBy Dexter HowarD

Contributing Writer

The antiseptic light from a laptop screen dully illuminates my puzzled expression in my small, darkened bedroom. A headline, “Man Crashes Plane into Texas IRS Office,” stares out at me from cyberspace. I click. The man was Joe Stack, and before he became a headline, he wrote a letter. I read.

Each page breaks my heart. I identify with this man, even though his actions killed Vernon Hunter, a 20-year civil servant and Vietnam veteran. I, too, know this world is crueler than need be. I, too, lament the unbridgeable chasm between the reality of what is and the dream of what should be. I, too, suspect a twisted delight enjoyed by disinterested, institutional forces that make ants of human lives just to squash them beneath a megalithic pinkie. And, at times, I, too, feel the “storm raging in my head” that Stack’s letter describes. But was Joe Stack justified in quieting his storm forever in one final, violent act?

I admit I find more fault with the letter on literary grounds than I do on logical ones. Stack’s six pages, slathered in angry hyperbole and peppered with sloppy grammar, nonetheless do diagnose a real illness in our times. I share his belief that we—out of ignorance, denial or cowardice— suffer a situation that our Founding Fathers fought and died to resist and prevent. Stack writes this on his final page: “Sadly, though I spent my entire life trying to believe that it wasn’t so, violence not only is the answer, it is the only answer.”

Clearly, Joe Stack had rationalized the use of violence by the time he took the controls of his Piper Dakota the morning of February 19, 2010. To the rest of us, amid contemptuous diatribes against politicians (Stack calls them “self-serving scumbags.”) and big business (“thugs and plunderers”) and personal anecdotes of entrepreneurial frustration, he makes a simple case. To summarize, we live in a country that was rallied into being by the cry “No taxation without representation.” That we are taxed today is plainly

understood and accepted by virtually every citizen of this country. The nature of our taxation is less clearly agreed upon. However, anyone from the comfortable suburbanite to the would-be martyr can agree with Joe Stack’s grievance, aired in the following passage:

“Here we have a system that is, by far, too complicated for the brightest of master scholars to understand. Yet, it mercilessly “holds accountable” its victims, claiming that they’re responsible for fully complying with laws not even the experts understand. The law “requires” signature on the bottom of a tax filing;

yet no one can truthfully say that they understand what they are signing; if that’s not “duress,” then what is?”

By that logic, all taxpayers suffer this baseline injustice intrinsic to our tax code. But the reality Stack truly espouses is a system rigged to the continual advantage of a wealthy few at the expense of subjugating everyone else. How can this be in a democracy where the rest outnumber the rich a hundred times over?

Toward the end of his letter, inserted in mere parentheses, is Joe Stack’s

opinion of the right to vote in this country: “Elections are a joke.” It isn’t hard to substantiate that claim: I would venture to guess many of us has indeed lost faith in an election process now dominated by campaign cash, gerrymandered districts, media spin, targeted disenfranchisement and outright fraud. Stack’s own early attempts at voicing concerns to his elected representatives over tax code issues (“they universally treated me as if I were wasting their time”) reveal a government unresponsive and unaccountable to its ordinary citizens. But for the rich, “when it’s time for their gravy train to crash under the weight of their gluttony…the full federal government has no difficulty coming to their aid within days if not hours.” Such a government, allowing “two interpretations for every law, one for the rich and one for the rest,” is a democracy in name only.

So the powerful today enjoy a thriving system for taxing ordinary Americans coupled to one utterly failing to represent them. In 1776, that form of government was described by words like “despotism” and “tyranny.” In 2010, there is no one despot or tyrant, wearing a crown and sitting

on a throne, to whom one may mail grievances. Our entire political economy—the sum of our each and every action from waking till sleep, perhaps, too, our dreams at night—empowers the soft tyrannies, the “invisible handcuffs,” which now characterize this land. Make no mistake, the consequences of these soft tyrannies are hard as lead. For an obvious example, stop paying taxes but continue living in your home, and eventually a uniformed man will remove you at gunpoint.

One miserable, little lifetime of resistance, especially one fought by rules of engagement designed by the opponent, cannot halt such glacial institutional momentum. Joe Stack, in the name of independence, lost; he gave his life over to the most public and symbolic act of revolt he could muster. Toward the end of his letter, he writes, “It has always been a myth that people have stopped dying for their freedom in this country…I know there have been countless before me and there are sure to be as many after. But I also know that by not adding my body to the count, I insure nothing will change.”

That we are axed today is plainly understood and accepted by virtually every citizen of this country. The nature of our taxation is less clearly agreed upon. However, anyone from the comfortable suburbanite to the would-be martyr can agree with Joe Stack’s grievance.

By SaraH malHotra

Staff Writer

I recently joined Eckerd College Homeless Outreach (ECHO), to feed the homeless. At the first ECHO meeting, I was shocked at the poor attendance. Only seven students showed, but one volunteer told me she had never seen so many volunteers.

Why don’t more students care about the homeless?

We drove student vehicles to the Albright United Methodist Church across the street from my old high school, St. Pete High. Inside, we made bologna and cheese sandwiches. After a brief discussion on how to fit all the food, drinks (two coolers of water and coffee) and people in the two tiny cars, we were on our way to our first stop. A few people were already waiting

outside and went in to get the others after receiving their sandwich and a cup of coffee.

One man showed us the shirt he designed with the faces of President Obama and Martin Luther King Jr. He explained how Obama is a modernday prophet who was going to liberate the African American people. He seemed genuinely glad that we wanted to hear about his t-shirt.

Our second stop was downtown. We split in groups and handed out sandwiches. Once we set up the water and coffee near the cars, we informed people that a hot beverage was waiting for them around the corner. Sleeping bags lined the streets, and the homeless were either in their sleeping bags or talking to each other nearby, shivering in the cold night air. All of their possessions were either on their

person or very close by. One woman told me she carried the papers proving her car ownership in her pocket at all times, as she didn’t have anything else. She collected sandwiches for those who weren’t within our block of distribution at the time, so that they would have something to eat when they returned.

Several people asked how school was going and told me to study hard, although they felt it would do no good in the future with the way the economy is going. What I found most frightening, however, was that one man thought Rick Baker was still the mayor of St. Petersburg.

For those of you who aren’t local, Bill Foster was elected last November. According to the St. Petersburg Times, Foster promised that the city’s homeless would be a “priority in his administration” and that he would take a “caring and compassionate approach” to work with local shelters to provide more showers, beds and bathrooms for the homeless. If this is the case, and homelessness is considered such a priority, then why don’t the homeless

even know who’s trying to help them? Why are they still looking for the last mayor to help them?

Our last stop attempted to serve close to 100 people. We quickly ran out of sandwiches and coffee. Between our two beverages, coffee seemed to be the popular choice, probably because a hot beverage is often appreciated more on a cold night. Although several people asked for cream (we didn’t have any), they all accepted the black coffee without complaint.

After growing up in St. Pete and hearing so many negative opinions about the homeless, I’ve been forced to reconsider my view of those not fortunate enough to have a permanent residence. All of those we helped seemed grateful we were there. Several remarked that they couldn’t believe college kids were the ones motivated enough to help. They accepted our small bit of help, and nearly all of them said thank-you.

If you’re interested in joining ECHO, stop by a meeting. The group meets every Monday and Thursday at 6:30 p.m. and Saturday at 11 a.m. in the Gamma lounge.

PerspECtivesQ: What do you love most about your body?

By erin lineBarger

Photo Editor


viewpointsEDITORIAL

“My teeth.”

—Kelly Maiche, junior (second from left)

ECHO feeds homeless one sandwich at a time

“My lower back dimples.”

—Sierra Carlson, junior (second from

right)

“My eyes.”

—Marissa Brydon, senior (far left)

“My [butt].”

—Amanda Dale, junior (far right)

“My eyes, my lips and my burns.”

—Max Tuten, freshman

“My calves, my hair and my eyes. Those are the only three things.”

—Darcy McGuire, freshman“My ears.”

—Lauren Barron, junior

arts & entertainment


9 10 11 12 13 14 15

16 17 18 19 20 21 22

To advertise your event with The Current, contact Entertainment

Editor Francie Devine [email protected]

Friday Saturday Sunday Monday Tuesday ThursdayWednesday

Events

April 9-22

6 p.m.Second Friday Fire Night(Waterfront)

7 p.m.Int. Cinema Series: “Broken Embraces(Miller Aud.)

9 p.m.WECX Concert(Hough Quad)

9 p.m.Dirty Dollar Dance(Fox Hall)

7:30 p.m.Doug McAdam: The Long-term Civic Impact of Youth Activism(Miller Aud.)

7 p.m.ImaculeeIllibagiza- “Left to Tell: Dis-covering God Amidst the Rwandan Holo-caust”(The Fla. Holo-caust Museum)

6 p.m.Edie Widder: Exploring and Protecting Planet Ocean(Galbraith Ma-rine Science Aud.)

8 p.m.Open Mic(Triton’s Pub)

Explore Eckerd Days

Relay for Life(North Field)

Springtopia Events: April 16- May 2

7 p.m.Film: “The Reckoning: The Battle for the Interna-tional Crimi-nal Court”(Miller Aud.)

Week of ActivismApril 17-22

Explore Eckerd Days

7:30 p.m.Panel: The ICC’s Indict-ment of Presi-dent Bashir: A help or a hinderance to peace in Su-dan?(Fox Hall)

EARTH DAY

4 p.m.ASPEC Forum-Bill Foster : Priorities for our Community(Lewis House)

7 p.m. Jim Keady—Be-hind the Swoosh: Sweat-shops and Social Justice (Fox Hall)

9 p.m.CampusMinistries Night(Triton’s Pub)

April 2-30Darfur, Darfur Photo Exhibit *Museum admission fees apply*(Fla. Holo-caust Muse-um)

March 20-May 29Japanese Prints from Ringling Mu-seum (on display in Armacost Library)

11 a.m.Catholic Mass (Chapel)

7 p.m.Ecumeni-cal Christian Worship(Chapel)

100

100

100

100



By Francie Devine

Entertainment Editor

With seniors just 49 days shy of graduation, the inevitable question of “What are you doing after college?” arises. Some already have their answers such as entry-level positions or graduate school, but others of us are still searching. I am the latter.

Nevertheless, with several lingering job opportunities and impending interviews, it came time for the next step: I had to buy a suit.

This article should prove that fashion help can come from very unlikely sources, for one, my Dad. It was his suggestion that I look at Ann Taylor because, according to him, “their stuff always looks professional.” Once I got over my initial shock that he even knew about Ann Taylor, I realized he was right.

While fashion criticism seems to vary, the underlying motto seems to be less is more. Keep the clothes simple and let your personality shine through. Freebeauty.com suggests, “Keep in mind that, like a career, your wardrobe can be built over time starting with a few basics and adding gradually over a period of years. Keep it simple and straightforward for a look of timeless, understated elegance.”

Like many Eckerd students, my wardrobe consists of mostly jeans and swimsuits. Change can be daunting, but realize that the transition to post-college life does not happen over night. It is a process that we will adapt to and accept.

I ended up buying a standard black suit with a couple of bright feminine shirts to maintain a nice balance between classy and professional. The fact of the matter is, quality comes at a price. A well made, professional suit should run between $200-300, but it’s a timeless classic that should last you a long time. Also, shop with your potential job in mind. In other words, an artist is not going to have the same wardrobe as a CPA, but many experts agree that when it comes to accessories, choose a staple piece – like an eye-catching necklace or belt -- to show you care about the little details; keep the rest simple. And, don’t forget about shoes, which are a vital component to any wardrobe. Pay for a good pair; it’ll be worth it. Most fashion experts agree that work heels should be no higher than three inches. Of course, flip-flops are out of the question. Skirts and dresses should fall at the knee, or fall just slightly above or below.

I’m afraid I don’t have any significant advice tips for our guys, but I’m pretty sure the basic same rules apply: buy a decent suit with a classic fit, a crisp shirt, a smart-looking tie, and a great pair of shoes.

A professional wardrobe will be more expensive, and will certainly require more thought process than choosing a tank top and shorts, so take your time, shop around for a good fit and a good bargain. And have fun. Remember, this is a big step. Enjoy it.

By Jeralyn Darling

Staff Writer

BREAKFAST: Beverly’s La Croisette

Atmosphere and Service: From the outside it looks like any old diner. The inside is nicer and the service was very pleasant. Our waitress recommended my sandwich and it was delicious. My boyfriend ordered one of their “famous” omelettes and he said it was egg-celent. If you’re looking for something a little more upscale than IHOP, I recommend La Croisette. Location:

7401 Gulf Blvd.Order:

Croissant sandwich with 2 scrambled eggs and bacon and homefries ($5.95).

Campagnard 3-egg omelette with hard salami, onion and Swiss cheese served with home fries and croissant ($6.95).

Large orange juice to share ($2.25) TOTAL: $16.06

LUNCH: Dockside Dave’s

Atmosphere and Service: The whole restaurant is sunny and laidback,

and there is outside seating as well. The

service was super friendly and everyone we passed recommended the grouper so we had to try it. I’m not a huge fish person, but my grouper salad was fantastic, I’m so glad everyone suggested it. Location:

7141 Gulf Blvd.Order:

1/2 lb. Blackened Grouper with cole slaw and vegetable medley (14.95)

Grilled Grouper Caesar Salad ($8.25) TOTAL: $24.53

DINNER: Café Luna

Atmosphere and Service: Service was okay at best, but it was a busy

night. The dining room looked pretty fancy—a great place for a date.

TOTAL: $47.70

DESSERT: Larry’s Ice Cream and Gelato

Atmosphere and Service: Cute little place, like an old ice cream parlor. TONS of choices. Service was grumpy, but you forget about it after your first bite—the ice cream is absolutely delicious. Location: 6595 Gulf Blvd. Order: one cup, shared ($6).

COMPLETE TOTAL: $94.29

Breakfast, lunch, dinner and dessert on St. Pete Beach

Less than $100 for two? Can it be done?

artwork by Caitlin Gerry

Step foot into adult shoes

Choosing your interview wardrobe

Review


arts & entertainmentReview

To be or noT To be?

By aBBy gestl

Staff Writer

Recently, several of Shakespeare’s classic plays have been transformed into modern graphic novels. That is, they are like comic books, expect usually longer and printed in black and white. I recently read “Manga Shakespeare Hamlet,” illustrated by Emma Vieceli.

I was excited when I first heard of this graphic novel. Shakespeare’s prose is the same, but the graphic novel took some liberties with the plotline: it’s still Hamlet, but set in the future with robots.

The graphic novel format makes it easy to match up facial expressions with what is being said. The artwork is well done, with Hamlet drawn as depressed teenager. While I liked the use of Shakespeare’s own words, the language just doesn’t mesh with the futuristic setting. That said, the novel only makes reference to the story’s setting once in the beginning. Reading the book is thus a bit jarring when the language is still in Old English throughout, and yet in one scene Horatio plugs cords into his own head to read a hologram from Hamlet. So, although the book keeps the words the same, I feel that it was a mistake to change the setting. I rather would have liked to see a Hamlet done with only the themes carried into the futuristic setting, or to at least see a Shakespearian Hamlet. But alas, neither of them was to be. As Hamlet says, “The rest is silence.”

“Hamlet” re-envisioned as a graphic novel

By Jeralyn Darling

Staff Writer

I went to the Ben Folds concert at the Orlando House of Blues as a casual fan. I left unable to get a single song out of my head. It was the best concert I have ever been to, period.

The intimacy of the venue was fantastic for a single performer like Folds. He and his piano were the only things on stage and I had a perfect view. If you ever have the chance to see anyone at House of Blues and you’re skeptical because it’s far away, just go anyway. You’ll thank me later. It was well worth the traffic and parking was free and easy.

The audience was really into the show and many people sang every song they knew. Folds may be losing his hair, but he still rocks his piano. He played every song I wanted to hear: “Kate,” “Rockin’ the Suburbs,” “Don’t Change Your Plans,” “Jesusland,” “There’s Always Someone Cooler Than You,” “Army” and my personal favorite, “Landed.”

Folds literally got up off his piano chair and conducted the audience to sing backup vocals and different sections of chorus. At one point, he turned around and noticed that he was playing at the House of Blues and created a blues song on the spot, which he dubbed the “Orlando Blues.” After that he added blues-y flourishes to most of his songs. He also played a few new songs from his next album, including my new favorite, “Levi Johnston.” The song is about the boy who got Sarah Palin’s daughter pregnant. It is hilarious and catchy. The chorus is, “I’m a f***in’ red neck, I like to hang out with the boys, play some hockey, do some fishin’ and kill some moose. I like to shoot the shit, do some chillin’ I guess. You f*** with me and I’ll kick your ass.” Folds told the audience that the lyrics were “straight from Levi’s Myspace page.”

Ben Folds concert worth the drive to Orlando

Wish

YourGraduate

Congratulations!Here for $15!

3 3/8 in. x 2 6/8 in. only

E-mail: [email protected]

for details

Hurry!Only available to the 1st 48 submisssions!




By Johnny Jones

Staff Writer

Was McVicar the Trickster only here to amuse or do his skills offer medical benefits as well?

One thing is for sure: The Trickster is a master of his craft.

On the evening of March 19, Josh McVicar, aka McVicar the Trickster, set off on a hilarious journey of hypnotic proportions that left me in stitches.

He began the show by calling a group of volunteer Eckerd students to a stage set up in the middle of Hough Quad. The process began with a 20-minute period during which he guided a group of volunteer Eckerd students through hypnotic induction.

With a series of vocal instructions from a hypnotist, the person being inducted can gain more control over normally undesired behaviors or emotions. McVicar is a licensed hypnotherapist, but for the purposes of his show, his goal was some good old-fashioned humor.

When McVicar inducts someone, he does not have full control of them, as he reminded the audience

at the beginning of the show. But he does have substantial influence. His commands ranged from making students shout things like “I believe in fairies!” while jumping up and down, to arguing their way out of a speeding ticket. He can also provoke powerful visualizations, which he demonstrated by convincing the volunteers that they all had giant movie screens on the back of their eyelids.

The Trickster is a multi-talented man who performs stage and close-up magic in addition to his comedy hypnosis show and clinical hypnotherapy. According to his Web site, his therapy has helped people stop smoking, lose weight, overcome their fears, reduce stress, and help kids do better in school.

A person with the ability to induce hypnosis has to have a strong moral compass; McVicar could have forced volunteers to do far worse than to run out into the crowd and stroke their audience member “pets.” For the most part, he conducted himself in the utmost professional manner. However, on one occasion, he asked students to visualize an inappropriate image that is too vulgar to be mentioned in this paper.

His comedy show had a lewd tinge to it that made some members of the audience squirm in their seats.

But in general, he was fun and well-meaning, and people seemed to enjoy watching their friends act ridiculously in front of a crowd of their peers.

This was the third hypnosis show I’ve seen. I have yet to be disappointed. They are always entertaining and filled with relatively harmless, good-natured fun for all.

McVicar the Trickster hypnotizes Hough Quad

artwork by Caitlin Gerry

On the Cover: Winter Term Photo Contest

Winners

Top Center: Donald McMullen, Overall Winner

Top right: Alex Innes, People Winner

bottom right: Callie Ferraro, Nature Winner

bottom Center: Christopher Herrman, Students Winner

Left: Jamie Preira, Place Winner



sports


By Ben Maxwell

Contributing Writer

CallumGeorgallidesisasophomorefromLondon,England,andcurrentlythe number 1 player on the Eckerd College golf team. At the Don BenbowInvitational in Jacksonville, Georgallides finished tied for 7th overall with a two-round144,justtwoshotsoverpar.HisperformanceledtheEckerdsquadtoa7th place finish. Recently, I sat down with him to ask him a few questions about golf in England and about his thoughts on where he would be today withoutgolf.

What is it like playing golf in America rather than in England? What are some differences and similarities? Golf in England is all at club level. There is no high-school or college golf. On thatlevel,thereisabigdifference.Clubgolfisgoodasyoumeetnewpeopleandrepresentanothersetofvalues.However,withcollegegolfyouarerepresentingyourschoolandyourcommunitysothepassioncanbemoreintense.Thereisobviouslyahugedifferenceinweather.PlayinggolfinAmericaisgreatastheweatherinFloridaisusuallyperfect.Itallowsyoutoenjoythegamemore,asusuallyinEnglandit’srainingandit’smoreofastruggletokeepeverythingdry. Thegameisthesameinbothcountries,butthereisahugedifferenceinthecourses.GolfinAmericaismuchmoredemandingonhowfaryouhittheballasthecoursesarealotlonger.Also,AmericancoursesarealotbettermaintainedandmoremanicuredthantheonesinEngland.EnglishcoursesarenottothesamestandardofthatoftheAmericancoursesandthisprobablyhastodowiththeweatherandthefactthatAmericaputsmoremoneyintoitssports.

How have you adapted to those differences?Forme,thesedifferenceshavebeenpositive.Igettoplayonnicercoursesandplayinnicerweather,sointhatsenseithasbeeneasy.IhavehadtoadaptmygameandphysicalabilitysothatIamabletohittheballfarthertoreachthedemandofAmericancourses.Thishasn’tbeentoohardasit’sreallyonlyacaseofimprovingtechniqueandspendingtimeinthegym.

Why did you want to come to school in the U.S rather than go to school in England?ThereisnocollegegolfinEngland.IfIwouldhavegonetocollegeinEngland,IprobablywouldhavegivenupgolfandIdidn’twanttodothat.Americahasthebestcollegeathleticssystem,anditwasaneasychoiceformetomake.CouplingthatwiththegreatweatherofFloridaandthedecisionwaseasy.

Is there anything that is specifically better here than in England? Sport is taken more seriously here. America breeds athletes a lot better thanEngland. I feel like I am looked after and valued through sports over here.Howeverathome,it’severypersonforthemselvesandeveryoneistryingtogetaheadofeveryoneelseasopposedtoimprovingthewholegroup.

How hard was it to leave the golf life you lived in England to come here to Florida?The golf life of home was very different than over here. However, coming toAmericawasastepup,soIfounditprettyeasytochange.Igettoplaytoahigherstandardoverhere,whichisgreatfordevelopingmygame.Ienjoythecoursesastheydemandmuchmorefrommygameandhelpmeimprove.Idomissthesocial side of club golf, meeting new people and having weekends away. I find that over here the golfing days are a lot more rushed because we don’t want tospendtoomuchtimeawayfromschool.Inthatsense,itmakesithardertoperformtomybestabilityduringtournaments.

Is the atmosphere here in the U.S more golf friendly compared to England?Definitely. It feels like everyone over here wants me to succeed. Many of the othercoachescareandcongratulatemeeventhoughtheydon’ttrainme.Also,manypeopleatcountryclubsordrivingrangesaskmehowIamdoing,andIamconstantlymakingnewfriendsthroughgolf.IthinkAmericajusthasabetterabilitytobringthroughyoungathletesandgenuinelycareaboutthem.

Do you have a routine before every tournament or practice? And if so, what is it?Practiceisverydifferentthanatournament.PracticeisprettymuchwheneverI can fit it in between class. I will tend to work on different things at practice, and when my game requires me to work on something specifically, I will do it. Tournamentsareawholedifferentstory.Thereareanumberofwaysagolfershouldenterintoatournament.Youneedtobeinarestedstate,becalmandwithapositiveattitudeandhavegoodpsychologicalthoughts.Thiscanbeveryhardtoattainatthebestoftimes,letalonewithallthedemandsofschoolworkandlife.Therefore,beforeatournament,thereareanumberofdifferentthingsyoucantry,butthereisn’treallyasetroutine.

Is it hard on you that your family isn’t able to watch you compete because they are back in England?I actually prefer my family not to watch me. My father was the person who introducedmetogolfandhelpedmeearlyon.Whenhewatchesme,Ifeeladdedpressure.ItishardthatIamnotabletohavethemthereforsupport,though.

How is the competition here in the U.S compared to the competition in England? Better or Worse?ThecompetitioninAmericaisamuchgreaterstandard.Therearea lotmoreplayers trying to compete; therefore, it’s likely that you will find more players andmorecompetition.Therearemorepeopleplaying,butalsotryingtoachieveahigherlevel.Collegesportisalotmoreintensethanclubgolf,soplayershavemorehungeranddesiretoimprove.Alsothecoursesdemandamuchbetterlevelofplay,sogrowingup

Birdies, pars and bogies with top Triton golfer

Courtesy of Eckerdtritons.comCallum Georgallides, pictured here at the Matlock Invitational hosted by Florida Southern College where he shot a three-round, 58th-place 232.

See GOLF on PAGE 20

sports


on these courses means playersneedtobenaturallybetter.

What is it like being a golfer on the Eckerd golf team?GolfontheEckerdteamisgood.Wehaveagreatcoachandgettoplaysomeverygoodcourses.ItwasprettymucheverythingIhadimaginedandhopedforwhendecidingtocometoAmerica.Itisashamethattheschoolisnotthatbigonathletics,though.Itwouldbeniceiftherewasmoremoneyputintoathleticprogramsandiftheschoolwouldbemoreathletefriendly,suchaspreferentialscheduling,moreunderstandingprofessors.

Being only a sophomore, what is your goal for the next 2 years here at Eckerd?Personally,Ihavehadagreatseason.Iamnumberoneontheteamandhavehad three top-ten finishes this year including one top-five. I hope to improve my gametowhereIcanconsistentlycompetewiththebestplayersinthenation.I find that if you have enough motivation and determination, you can get to whatever level you want. My main goal will be to improve. I don’t really have an outcomegoal,butitwouldbegreatifIcouldactuallywinatournament.Itwouldalso be a great honor to play well enough to be named All-American.

If golf wasn’t in your life, where do you think you would be today? And what would you be doing?IfIdidn’tplaygolf,Iwouldprobablybeatabigschoolenjoyingmysociallifealot more. Golf has kept me disciplined and hard working. (Redundant)

What is your favorite part of the game?My favorite part of golf is when you visualize a shot in your head and then you executetheshotexactlyasyousawinyourhead.

What is your favorite club to hit/shot?Ienjoyputting.Whenyouholeaputt,itisthebestfeelingingolf.

What is your handicap?My handicap back in England is a 0.8. The English system is different from the American system. My handicap over here would probably be a +3, which is basically better than zero. It would mean I would have to add 3 shots to my score everytimeIplay.However,IhavenotputinanycardssinceIcametocollegesoI don’t know if a 0.8 is still an accurate determinant of my game.

How much time per week do you spend practicing? Strictly golf, I would say I spend around 20 hours per week playing golf. This is roughly divided by 12 hours of playing on the course and 8 hours of practicing onfundamentalsandtechnique.

Where do you see yourself after college? Still playing golf?I’mnotsure.It isadreamofmineisbeaprofessionalgolfer.However,Iamrealistic. I probably see myself working on Wall Street and playing golf as ahobby.

5000 34th St. South

727-866-7200

Eckerd College Student Discount

Medium 1 topping $5.55Large 1 topping $7.77

Medium 1 topping, bread stix, & 2-20oz sodas $11.50Large 1 topping, bread stix, & 2-20oz sodas $13.50

Valid for carryout & delivery($2 delivery charge applies)

Golf continued from Page 19


sports

SportsMen’s Tennis

Friday, April 9v.SaintLeo3 p.m.

Thursday, April 15throughSaturday, April 17

SunshineStateConferenceCham-pionships

TimeTBA

sofTball

Friday, April 9v.FloridaTech7 p.m.

Saturday, April 10v. Florida Tech (DH)1p.m.

Friday, April 16@ Rollins7 p.m.

Saturday, April 17@ Rollins (DH)1p.m.

baseball

Friday, April 16v. Rollins7 p.m.

Saturday, April 17v. Rollins (DH)1p.m.

Tuesday, April 20v.WebberInternational7 p.m.

Friday, April 23v.Lynn7 p.m.

WoMen’s Tennis

Friday, April 9v.SaintLeo3 p.m.

Thursday, April 15throughSaturday, April 17

SunshineStateConferenceCham-pionships

TimeTBA

By will Creager

Sports Writer

After a great start to the season, winning 10 of their first 12 games, the Eckerd baseballteamhasgonecold.

TheTritonshavelost11oftheirlast12games,andhasseentheirrecordfallbelow .500 (15-17, 1-11) for the first time since February 6, when they swept a doubleheader over Warner to become 2-1. In their 12 game skid, the Tritons offense has gone cold, scoring more than six runs in a game just once, whilebeingheldtolessthantworunsseventimes.

However, in this stretch, Eckerd did pick up their first conference win on March 27, with a 6-4 victory over then-#1 Florida Southern (30-5, 9-3). In that game, Eckerd was trailing 4-3 heading to the bottom of the seventh, but were able to rally for three runs in the next two innings to earn their first win. Designated hitterDanBrancahadtwohits,includingahomerun,andscoredthreetimes.

Eckerd’s hitting has not been their problem. They are hitting .314 as a team, and are led by shortstop Matt Heller (batting .415 with 12 doubles and 24 runs scored) and outfielder Minervino Labrador (.369 with a team high 10 homers and 29 RBI’s).

However,thepitchingfortheTritonshasbeenaverybigweakness,withateam ERA of 7.80. The only Eckerd pitcher with an ERA under 4.50 is closer Francisco Collazo, who is 1-1 with five saves and an ERA of 3.95 in a team high 14 appearances. Joey Cuda leads the team with his nine starts, four wins, and 56.1 innings pitched, with his 5.75 ERA.

On the neighboring diamond at Turley Athletic Complex, Triton softball has not fared any better. After a record-setting win total in 2009, hopes were high for the 2010 campaign. An alright start, splitting three straight doubleheaders, quicklywentsour.DespitebeingthehostoftheEckerdTritonSpringInvitationinClearwater,Eckerdsoftballlostallsixgamesofthetournament.

Threewinsandatieseemedtosignalachangeinfortune,butarecenteightgame losing streak dropped their record to 10-26-1. Confernce play has not been kind to the Tritons, who have a 2-10 record in SSC play. The two wins came against Saint Leo and Barry, both middle-of-the-pack SSC squads.

Offense has been the Tritons’ main weakness, averaging barely over 3 runs per game, while allowing 5.29 runs per game to opponents. Sophomores Amanda Kolonick, who leads the team with a .357 batting average, and Kirsten

Cox, batting .315 with 14 RBI, are the only players with averages above .300 for theseason.

ThebiggestbatfortheTritonssofarhasbeenfreshmanKristenSchurr.In114 at-bats, Schurr has maintained a .263 average while blasting five homeruns and racking up 23 RBI. As with most power hitters, Schurr has struck out a team-leading 26 times.

While the 2010 season may not be the year either team wins an SSC crown, both programs have had their fair share of improvement. Baseball’s non-conference record of 14-3 showed they can win games, and one must take into considerationthefactthattheSSCisoneofthetoughestDivisionIIconferencesinAmerica.Giventime,bothprogramshavethepotentialtothrive.

Baseball, softball continue on-field struggles

photo by Doug ThayerCelebrations like this one have been few and far between this year for soft-ball, who has struggled to a 12-26-1 record through April 5.


sports

By will Creager

Sports Writer

The Major League Baseball season kicked off in a major way, on April 4 when the defending World Series champion New York Yankees took on long-time rival and perennial playoff contender, the Boston Red Sox.

The game lived up to the hype, as late rallies handed Boston a 9-7 win. Both teams pounded out 12 hits, while Yankees left fielder Brett Gardner made the game’sonlyerroronapoorthrow.

The scoring started in the top of the second inning, when catcher JorgePosada and newly acquired center fielder Curtis Granderson hit back-to-back solo homeruns for the Yankees. It was Granderson’s first at bat as a Yankee, who cameoverfromtheTigersinoneoftheoffseason’sbiggestmoves.

Bostongotonerunrightbackinthebottomoftheinning,byplayingsomesmall ball. After hitting a lead off double, first baseman Kevin Youkilis was moved to third on a groundball by designated hitter David Ortiz, and driven in on a sacrifice fly by new third baseman Adrian Beltre.

The Yankees extended their lead to 5-1 with a three-run fourth inning, includingpullingoffadoublesteal,asshortstopandYankeecaptainDerekJeterstole second and Gardner stole home. However, the Red Sox came right back with a run of their own in the fifth and three more in the sixth to tie the game

5-5. The Yankees rallied for two two-out runs in the top of the seventh, only to

see Red Sox second baseman and 2008 American League MVP, Dustin Pedroia, tie the game with a two-run homerun over the green monster.

The Red Sox would take their first lead of the game that same inning, as Youkilis scored from third on a passed ball by Posada. The Red Sox then added an insurance run in the eighth on an RBI single by Pedroia.

The first win of the 2010 baseball season went to Boston left-handed reliever Hideki Okajima, while the loss went to right-hander Chan Ho Park, and Jonathan Papelbon, who has had at least 35 saves in each of the past four seasons, worked ascorelessninthforthesave.

Boston’s offense lead the way in this three hour 46 minute game, despite a very quiet game by Boston’s sparkplug, left fielder and leadoff hitter Jacoby Ellsbury. Pedroia had two hits, including his game-tying homerun, with three RBI’s and two runs scored, while Youkilis picked up three extra-base hits (two doubles and a triple), drove in two runs and scored three times.

Boston’s starter Josh Beckett, despite a poor performance, signed a four-year, $68 million contract extension the following day.

The two rivals will meet an additional 15 this year, including a three-game seriesontheseason’sclosingdays.Thosegames,hostedinBoston,arelikelytodeterminethefateoftheALEastcrown,aswellasbothteams’playoffhopes.

Red Sox commence 2010 season with defeat of rival Yankees

Baseball

By Max Martinez

Sports Editor

Twoyearsagothismonth,Ispentasoggy,overcastday at Citizens Bank Park keeping tabs on opening dayaction.IwasattheparktoseethePhillies’homeopener,asIhaddonethepreviousfouryears,butadifferentmatchupwasonmymind.

A short drive south, at Camden Yards inBaltimore, the Tampa Bay Rays were making their 2008 debut against the Orioles. Both teams had been the laughingstocks of the AL East for years,with records paling in comparison to the Red Sox and Yankees. The Rays lost that day, not a shock to anybodywhohadbeenwatchingbaseballinthenewmillennium.Iftherewasonethingthatwascertain,it was the fact that the Rays (or Devil Rays, as they had been known until that season) would never competewiththeirdivisionalrivals.

Weallknowhowtherestofthatseasonwent.Bythe end of April the Rays had already swept the Red Sox and Blue Jays, and were in first place in the AL Eastby thestartofJune,andmanaged toend theseasoninthesameposition.AmagicalWorldSeriesrun came up short, but not before the Rays became the hottest MLB team of the decade.

2009 was supposed to be a continuation of the previous year’s magic, with a return to theplayoffs expected at the very least. But the follow-up campaignnevercameclosetobecomingareality,asfaultypitchingthrewawaygameaftergame.Bythe

time October came around, the Rays were long out of theplayoffpicture,justliketheyhadbeeninallbutoneotheryearprior.

So here we are, with the start of the 2010 MLB season upon us. The AL East, which last year wasonceagainatthemercyofBostonandNewYork,isas powerful as it’s ever been. The Rays, who still have apayrollthatisrepresentativeofTampaBay’ssmallmarket size, are out-staffed.

But that’s nothing new for the Rays. If 2008 taughtusanything,it’sthatpayrolldoesn’tdetermineeverything. All-star players including Carl Crawford andB.J.Uptonarereturning,quitepossiblyfortheirlastseasonswiththeteam.Crawford’scontracthasbeengrowinginrecentyears,andheisdueforanewdeal next winter. It is unlikely the Rays will be able to afford him in 2011.

Thestartingrotation,headedbyJamesShieldsand Matt Garza, needs to vastly improve over last year’snumbersinorderfortheteamtohaveplayoffhopes. Phenom David Price, who went 10-7 with a 4.42 ERA in his rookie season last year, assumes the third spot in the rotation, while Jeff Niemannwill hold the fourth position. Wade Davis, whospent most of 2009 in the minors, is the team’s fifth starter. Despite the fact that only Shields and Garza have multiple years of major league pitching experience,therotationhasthepotentialtobeoneoftheAmericanLeague’sbest.

On offense, the lineup is mostly unchanged from

Is

Regrouped Rays aim for October

See RAYS on PAGE 23


sports

Back

2009. Jason Bartlett, who batted .320 with 14 HR and 90 runs last year, will bat leadoff, followed by Crawford (batted .305 with 15 HR and 60 steals in 2009) and Evan Longoria (.281, 33 HR, 113 RBI). With the departure of second baseman AkinoriIwamura, utility player Ben Zobrist will assume afull time role at second, batting fifth in the lineup. Zobrist had a breakout season in 2009, hitting .297 while slugging 27 homeruns and 91 RBIs.

The bullpen is truly the heart of the Rays. A stellar showing by the bullpen in 2008 was one of thekeyreasonsforthesuccessofthatseason.Lastyearthebullpenfaltered,throwingawaygamesandmissingsaveopportunities.

As a result, the Rays struggled to maintain a .500 record. This year features Rafael Soriano as the team’s closer, who converted 27-of-31 saves last year with the Braves. His 102 strikeouts and low 2.97 ERA would have been a welcome addition to the 2009 bullpen.

But despite a retooled rotation, restructuredlineupandanewcloser,theexpertsstilldon’tthinkthe Rays stand a chance in the AL East. Between themultiplecolumnistsandanalystsatESPN,TheSporting News and Sports Illustrated, only two,Bobby Valentine of ESPN and Albert Chen of SI,picked the Rays as 2010 AL East champs.

A few more had enough faith in the Rays to predict a wild card finish, but the vast majority thought the Red Sox and Yankees would continue their run as thetopteamsintheeast,withTampaBayinthird.

A third place finish in the AL East would typically translate to a first or second place run in any other

divisioninbaseball.Whetheritisseenasablessingor a curse, the Rays have 36 games to play against the Red Sox and Yankees combined this season. Performing to the best of their ability in those 36 matches will make or break 2010, and just one or two wins can be the difference between a first or third place finish in the division.

Iscourtesy of Wikicommons

As a Ray through his whole career, Carl Crawford is most likely beginning his final season in Tampa

RAYS continued from Page 22

Projected 2010 Divisional Standings(compiled from The Sporting News)

American LeagueEast: Yankees, Red Sox, Rays, Orioles, Blue JaysCentral: Twins, White Sox, Tigers, Royals, IndiansWest: Angels, Mariners, Rangers, AthleticsWild Card: Red Sox

National LeagueEast: Phillies, Braves, Mets, Marlins, NationalsCentral: Cardinals, Cubs, Brewers, Reds, Astros,PiratesWest: Rockies, Dodgers, Giants, Diamondbacks,PadresWildcard: Braves

Rays 2010 Lineup

1. SS JasonBartlett2. LFCarlCrawford3. 3BEvanLongoria4. 1BCarlosPena5. 2B BenZobrist6. CF B.J.Upton7. DH PatBurrell8. RF Matt Joyce9. C DionerNavarro

Bench1. 1B/3B HankBlalock2 C KellyStopach

Rays 2010 Pitching Rotation

1. James Shields (11-12, 4.14 ERA in 2009)2. Matt Garza (8-12, 3.95 ERA)3. David Price (10-7, 4.42 ERA)4. Jeff Niemann (13-6, 3.94 ERA)5. Wade Davis (2-2, 3.72 ERA)

Projected 2010 Bullpen

1. RHP AndySonnanstine2. LHP Randy Choate3. RHP DaveWheeler4. RHP GrantBalfour5. LHP J.P.HowellCloser: RHP Rafael Soriano

Divisional Round:Twins over Red SoxYankeesoverAngelsPhillies over Rockies

CardinalsoverBraves

League Championship Series:

YankeesoverTwinsPhilliesoverCardinals

2010 World Series:

PhilliesoverYankees

Projected 2010 Playoff Matchups

Slump continues on both diamonds

As 2010 Major League Baseball season kicks off, Rays aim for title

Eckerd golfer Callum Georgallides

Page 20

Page 19

Pages 22-23

photo by Doug Thayer

Senior Mackenzie Dawson starts her windup in a recent match at Turley athletic com-plex. Dawson, the staff ace, is 5-13 with a 4.37 ERA in 2010.

sports

The Official Student Newspaper of Eckerd College

Documents

The Current Issue 10