Upload
chymyaa
View
227
Download
2
Embed Size (px)
DESCRIPTION
words
Citation preview
For continuing a common line of reasoning:
consequentlyclearly, thenfurthermoreadditionallyandin additionmoreoverbecausebesides thatin the same wayfollowing this furtheralsopursuing this furtherin the light of the... it is easy to see that
To change the line of reasoning (contrast):
howeveron the other handbutyetneverthelesson the contrary
For opening a paragraph initially or for general use:
admittedlyassuredlycertainlygrantedno doubtnobody deniesobviouslyof courseto be suretrueundoubtedlyunquestionablygenerally speakingin generalat this levelin this situation
Transitional chains, to use in separating sections of a paragraph which is arranged chronologically:first... second... third...generally... furthermore... finallyin the first place... also... lastlyin the first place... pursuing this further... finallyto be sure... additionally... lastlyin the first place... just in the same way... finallybasically... similarly... as wellTo signal conclusion:
thereforethishence in final analysisin conclusionin final considerationindeedFor the aforementioned reasonsFor the aforementioned reasons, there is no doubt thatTo sum up the foregoing,Given these factsIn conclusionIn closingTo conclude
To summarize
OverallTo summarizeIn summaryTo sum upParaphrasedBrieflyIn briefSumming up
To put it brieflyprcis - A sketchy summary, Make a summary (of)synopsis - A sketchy summaryapercu - A short synopsis
For the final points of a paragraph or essay:
Finally lastly
To restate a point within a paragraph in another way or in a more exacting way:
in other wordspoint in factspecifically
Sequence or time
afterafterwardsas soon asat firstat lastbeforebefore longfinallyfirst... second... thirdin the first placein the meantimelatermeanwhilenextsoonthen
To indicate time
AfterBeforeCurrentlyDuringEventuallyFinallyFirst, Second, etc.FormerlyImmediatelyInitiallyLastlyLaterMeanwhileNextOncePreviouslySimultaneouslySoonSubsequentlySubsequent - Following in time and orderHitherto, Heretofore - Used in negative statement to describe a situation that has existed up to this point or up to the present time, The sun hasnt rose hitherto.In due timeHenceforth
To indicate a result or an effect
Accordingly - because of the reason givenConsequentlyHenceSoThereforeThusThusly - In the way indicatedThence - From that fact or reason or as a resultTherefrom - From that circumstance or sourceThereof - Of or concerning this or that, From that circumstance or sourceCorollary - A practical consequence that follows naturally, "blind jealousy is a frequent corollary of passionate love"
To indicate more information
Besides - Making an additional point; anywayFurthermoreIn additionMoreoverLikewiseIndeed In truthIn factAlsoAs wellForemost - Ranking above all others; Preceding all others in spatial positionFirst, Second, Third, FinallyFirstly, Secondly, Thirdly
To indicate an example
For exampleFor instanceIn particularParticularly - Specifically or especially distinguished from othersSpecificallyTo illustrate
To demonstrateTo indicate a cause or reason
SinceBecauseBecause ofDue toForFor the reason thatAsInasmuch as - SinceWhereby - As a result of which, By which, "the means whereby we achieved our goal"
To express an opinionIn all due fairnessWith good judgment, (one/we may)To describe or make
vividportraydepictexhibitillustrateexposepresentpaint a portraitlimn - Trace the shape of, make a portrait ofdelineaterepresentdemonstrateconstitute - Form or composeembodied - (adj) Expressed byembody - (v) Represent or express in tangible formembodiment
To provemanifest - Provide evidence for; stand as proof ofattest - Provide evidence fortestify - Provide evidence forcertify - Provide evidence forendorse, indorse - Give support or one's approval toshew - Establish the validity of something, as by an example, explanation or experimentestablishinstance - (v) Clarify by giving an example ofexemplify - (v) Clarify by giving an example ofTo compare or contrast
WhereasIn comparisonIn contrastHoweverAlthoughOn the other handLikewiseSimilarlyButYetWithal - Despite anything to the contrary (usually following a concession)Withal - Together with thisNevertheless - Despite anything to the contraryNonetheless - Despite anything to the contraryNotwithstanding - Despite anything to the contraryEven so - Despite anything to the contraryAll the same - Despite anything to the contrary
To indicate certainty
TrulySincerelyGenuinelySurelyRightfullyAbsolutelyIndubitablyCertainlyWithout doubtNeedless to say
To indicate doubt
Most likelyMore likelyPossiblyProbablyDubitable - Open to doubt or suspicionDubious - Distressed with uncertainty or doubt
To provide a condition
provision, proviso - A stipulated conditionstipulate - Specify as a condition or requirement in a contractgivenifwhetherwheneverwhenwhile
To express positive words
magnificentgrandeur - The quality of being magnificent or splendid or grand, the quality of being exalted in character or ideals or conductmagnanimous - The quality of being exalted in character or ideals or conductFantasticfantasticalphenomenalwonderfulextraordinarymarveloussuperbgoodfinegreatavid - Emotionally desirableavid ambition to succeedexcellentspectacularprodigiousgrandbrilliantglorious - Bringing great happiness and thankfulnessillustrious - Widely known and esteemednotable - Worthy of noticerespectedimpressivesplendidsplendiferous - Having great beauty and splendorresplendent - Having great beauty and splendor, Richly and brilliantly colorfulflamboyant - Elaborately or excessively ornamented, Richly and brilliantly colorfulredoubtable - Having or worthy of prideformidable - Extremely impressive in strength or excellenceprowesssuperiorterrifictremendouswondrous - Extraordinarily goodwonderfulsublime - Inspiring awe, Lifted up or set highflair - natural talentknack - A special way of doing somethingoutshine - Attract more attention and praise than othersparamount - Having superior power and influencepredominantpreponderatingprevailing
To show intelligence
profoundshrewd hardheaded (practical experience and observation) intelligenceastuteacumen - Shrewdness shown by keen insightinsightfulsavvy - The cognitive condition of someone who understandscognition - The psychological result of perception, learning and reasoninggeniussmartsharpkeenmastermindEinstein - Someone who has exceptional intellectual ability and originalitywork of artfine artmaven - Someone who is dazzlingly skilled in any fieldmavin - Someone who is dazzlingly skilled in any fieldadept - Someone who is dazzlingly skilled in any fieldwhiz - Someone who is dazzlingly skilled in any fieldwizard - Someone who is dazzlingly skilled in any field
To intensify
incrediblyexceedinglytoppingly - extremely wellextremelyextraordinarilytrulyreallyveryutterly - Completely and without qualification; used informally as intensifiers, With sublimity; in a sublime mannerabsolutelyperfectlysublimelydramaticallysheer - (adj.) Complete and without restriction or qualification; sometimes used informally as an intensifier; (adv.) Directly "he fell sheer into the water"
Said
enounced, enunciated - Speak, pronounce, or utter in a certain waypronounced - Speak, pronounce, or utter in a certain wayarticulated - Express or state clearlyvocalized - Express or state clearlyposited - Put firmlystatedexpressedreportedalleged - Declared but not provedaverred - Report or maintain, To declare or affirm in a grave manner and formally as trueaffirmed, assertedwrotecomposedindited - Produce a literary workpenned - Produce a literary workspelt - Indicate or signifyvoiced, sounded - Give voice todemean - Reduce in worth or character, usually verbally
Noted (said)
remarkeddenoted - Be a sign or indication of, "Her smile denoted that she agreed"observedcommentedmentionedreferredannouncednoticed
VARIATIONS ON 'SAID'
announcedansweredarguedbeganbeggedbellowedbraggedchokedcalledclaimedcommandedcomplainedcrieddeclareddemandedexclaimedexplainedgaspedgiggledgroanedgrowledgrumbledgruntedhissedhootedinformedinquiredinsistedinterruptedjabberedjokedmentionedmurmuredmutteredorderedpleadedpledgedpoutedpromisedquestionedrambledremarkedreportedshoutedsighedsnappedspokesobbedstatedstormedstutteredsworetattledtoldutteredvoicedwarnedweptwhisperedyelled
Precisely
explicitlyaccuratelyexpresslyexactlyincisively
Numerous
innumerablemanyvariousseveraldiverseumpteenumteenmyriad (noun and adj.)
Praise
extol - (v) Praise, glorify, or honorexaltglorifylaudproclaimrevereidolizeworshipvenerate
Call Forth
evoke - Call forth (emotions, feelings, and responses)arouse - Call forth (emotions, feelings, and responses)elicit - Call forth (emotions, feelings, and responses)enkindle - Call forth (emotions, feelings, and responses)provoke - Call forth (emotions, feelings, and responses)inflame - Arouse or excite feelings and passionsawake - Stop sleepingconjure - Evoke or call forth, with or as if by magicinvoke - Evoke or call forth, with or as if by magicsummon - Gather or bring togetherinstill - deposit gradually
SYNONYMS FOR WORDS COMMONLY USED IN STUDENT'S WRITINGS
Amazing- incredible, unbelievable, improbable, fabulous, wonderful, fantastic, astonishing, astounding, extraordinaryAnger- enrage, infuriate, arouse, nettle, exasperate, inflame, maddenAngry- mad, furious, enraged, excited, wrathful, indignant, exasperated, aroused, inflamedAnswer- reply, respond, retort, acknowledgeAsk- question, inquire of, seek information from, put a question to, demand, request, expect, inquire, query, interrogate, examine, quizAwful- dreadful, terrible, abominable, bad, poor, unpleasantBad- evil, immoral, wicked, corrupt, sinful, depraved, rotten, contaminated, spoiled, tainted, harmful, injurious, unfavorable, defective, inferior, imperfect, substandard, faulty, improper, inappropriate, unsuitable, disagreeable, unpleasant, cross, nasty, unfriendly, irascible, horrible, atrocious, outrageous, scandalous, infamous, wrong, noxious, sinister, putrid, snide, deplorable, dismal, gross, heinous, nefarious, base, obnoxious, detestable, despicable, contemptible, foul, rank, ghastly, execrableBeautiful - pretty, lovely, handsome, attractive, gorgeous, dazzling, splendid, magnificent, comely, fair, ravishing, graceful, elegant, fine, exquisite, aesthetic, pleasing, shapely, delicate, stunning, glorious, heavenly, resplendent, radiant, glowing, blooming, sparklingBegin - start, open, launch, initiate, commence, inaugurate, originateBig - enormous, huge, immense, gigantic, vast, colossal, gargantuan, large, sizable, grand, great, tall, substantial, mammoth, astronomical, ample, broad, expansive, spacious, stout, tremendous, titanic, mountainousBrave - courageous, fearless, dauntless, intrepid, plucky, daring, heroic, valorous, audacious, bold, gallant, valiant, doughty, mettlesomeBreak - fracture, rupture, shatter, smash, wreck, crash, demolish, atomizeBright - shining, shiny, gleaming, brilliant, sparkling, shimmering, radiant, vivid, colorful, lustrous, luminous, incandescent, intelligent, knowing, quick-witted, smart, intellectualCalm - quiet, peaceful, still, tranquil, mild, serene, smooth, composed, collected, unruffled, level-headed, unexcited, detached, aloofCome - approach, advance, near, arrive, reachCool - chilly, cold, frosty, wintry, icy, frigidCrooked - bent, twisted, curved, hooked, zigzagCry - shout, yell, yowl, scream, roar, bellow, weep, wail, sob, bawlCut - gash, slash, prick, nick, sever, slice, carve, cleave, slit, chop, crop, lop, reduceDangerous - perilous, hazardous, risky, uncertain, unsafeDark - shadowy, unlit, murky, gloomy, dim, dusky, shaded, sunless, black, dismal, sadDecide - determine, settle, choose, resolveDefinite - certain, sure, positive, determined, clear, distinct, obviousDelicious - savory, delectable, appetizing, luscious, scrumptious, palatable, delightful, enjoyable, toothsome, exquisiteDescribe - portray, characterize, picture, narrate, relate, recount, represent, report, recordDestroy - ruin, demolish, raze, waste, kill, slay, end, extinguishDifference - disagreement, inequity, contrast, dissimilarity, incompatibilityDo - execute, enact, carry out, finish, conclude, effect, accomplish, achieve, attainDull - boring, tiring,, tiresome, uninteresting, slow, dumb, stupid, unimaginative, lifeless, dead, insensible, tedious, wearisome, listless, expressionless, plain, monotonous, humdrum, drearyEager - keen, fervent, enthusiastic, involved, interested, alive toEnd - stop, finish, terminate, conclude, close, halt, cessation, discontinuanceEnjoy - appreciate, delight in, be pleased, indulge in, luxuriate in, bask in, relish, devour, savor, likeExplain - elaborate, clarify, define, interpret, justify, account forFair - just, impartial, unbiased, objective, unprejudiced, honestFall - drop, descend, plunge, topple, tumbleFalse - fake, fraudulent, counterfeit, spurious, untrue, unfounded, erroneous, deceptive, groundless, fallaciousFamous - well-known, renowned, celebrated, famed, eminent, illustrious, distinguished, noted, notoriousFast - quick, rapid, speedy, fleet, hasty, snappy, mercurial, swiftly, rapidly, quickly, snappily, speedily, lickety-split, posthaste, hastily, expeditiously, like a flashFat - stout, corpulent, fleshy, beefy, paunchy, plump, full, rotund, tubby, pudgy, chubby, chunky, burly, bulky, elephantineFear - fright, dread, terror, alarm, dismay, anxiety, scare, awe, horror, panic, apprehensionFly - soar, hover, flit, wing, flee, waft, glide, coast, skim, sail, cruiseFunny - humorous, amusing, droll, comic, comical, laughable, sillyGet - acquire, obtain, secure, procure, gain, fetch, find, score, accumulate, win, earn, rep, catch, net, bag, derive, collect, gather, glean, pick up, accept, come by, regain, salvageGo - recede, depart, fade, disappear, move, travel, proceedGood - excellent, fine, superior, wonderful, marvelous, qualified, suited, suitable, apt, proper, capable, generous, kindly, friendly, gracious, obliging, pleasant, agreeable, pleasurable, satisfactory, well-behaved, obedient, honorable, reliable, trustworthy, safe, favorable, profitable, advantageous, righteous, expedient, helpful, valid, genuine, ample, salubrious, estimable, beneficial, splendid, great, noble, worthy, first-rate, top-notch, grand, sterling, superb, respectable, edifyingGreat - noteworthy, worthy, distinguished, remarkable, grand, considerable, powerful, much, mightyGross - improper, rude, coarse, indecent, crude, vulgar, outrageous, extreme, grievous, shameful, uncouth, obscene, lowHappy - pleased, contented, satisfied, delighted, elated, joyful, cheerful, ecstatic, jubilant, gay, tickled, gratified, glad, blissful, overjoyedHate - despise, loathe, detest, abhor, disfavor, dislike, disapprove, abominateHave - hold, possess, own, contain, acquire, gain, maintain, believe, bear, beget, occupy, absorb, fill, enjoyHelp - aid, assist, support, encourage, back, wait on, attend, serve, relieve, succor, benefit, befriend, abetHide - conceal, cover, mask, cloak, camouflage, screen, shroud, veilHurry - rush, run, speed, race, hasten, urge, accelerate, bustleHurt - damage, harm, injure, wound, distress, afflict, painIdea - thought, concept, conception, notion, understanding, opinion, plan, view, beliefImportant - necessary, vital, critical, indispensable, valuable, essential, significant, primary, principal, considerable, famous, distinguished, notable, well-knownInteresting - fascinating, engaging, sharp, keen, bright, intelligent, animated, spirited, attractive, inviting, intriguing, provocative, though-provoking, challenging, inspiring, involving, moving, titillating, tantalizing, exciting, entertaining, piquant, lively, racy, spicy, engrossing, absorbing, consuming, gripping, arresting, enthralling, spellbinding, curious, captivating, enchanting, bewitching, appealingKeep - hold, retain, withhold, preserve, maintain, sustain, supportKill - slay, execute, assassinate, murder, destroy, cancel, abolishLazy - indolent, slothful, idle, inactive, sluggishLittle - tiny, small, diminutive, shrimp, runt, miniature, puny, exiguous, dinky, cramped, limited, itsy-bitsy, microscopic, slight, petite, minuteLook - gaze, see, glance, watch, survey, study, seek, search for, peek, peep, glimpse, stare, contemplate, examine, gape, ogle, scrutinize, inspect, leer, behold, observe, view, witness, perceive, spy, sight, discover, notice, recognize, peer, eye, gawk, peruse, exploreLove - like, admire, esteem, fancy, care for, cherish, adore, treasure, worship, appreciate, savorMake - create, originate, invent, beget, form, construct, design, fabricate, manufacture, produce, build, develop, do, effect, execute, compose, perform, accomplish, earn, gain, obtain, acquire, getMark - label, tag, price, ticket, impress, effect, trace, imprint, stamp, brand, sign, note, heed, notice, designateMischievous - prankish, playful, naughty, roguish, waggish, impish, sportiveMove - plod, go, creep, crawl, inch, poke, drag, toddle, shuffle, trot, dawdle, walk, traipse, mosey, jog, plug, trudge, slump, lumber, trail, lag, run, sprint, trip, bound, hotfoot, high-tail, streak, stride, tear, breeze, whisk, rush, dash, dart, bolt, fling, scamper, scurry, skedaddle, scoot, scuttle, scramble, race, chase, hasten, hurry, hump, gallop, lope, accelerate, stir, budge, travel, wander, roam, journey, trek, ride, spin, slip, glide, slide, slither, coast, flow, sail, saunter, hobble, amble, stagger, paddle, slouch, prance, straggle, meander, perambulate, waddle, wobble, pace, swagger, promenade, lungeMoody - temperamental, changeable, short-tempered, glum, morose, sullen, mopish, irritable, testy, peevish, fretful, spiteful, sulky, touchyNeat - clean, orderly, tidy, trim, dapper, natty, smart, elegant, well-organized, super, desirable, spruce, shipshape, well-kept, shapelyNew - fresh, unique, original, unusual, novel, modern, current, recentOld - feeble, frail, ancient, weak, aged, used, worn, dilapidated, ragged, faded, broken-down, former, old-fashioned, outmoded, passe, veteran, mature, venerable, primitive, traditional, archaic, conventional, customary, stale, musty, obsolete, extinctPart - portion, share, piece, allotment, section, fraction, fragmentPlace - space, area, spot, plot, region, location, situation, position, residence, dwelling, set, site, station, status, statePlan - plot, scheme, design, draw, map, diagram, procedure, arrangement, intention, device, contrivance, method, way, blueprintPopular - well-liked, approved, accepted, favorite, celebrated, common, currentPredicament - quandary, dilemma, pickle, problem, plight, spot, scrape, jamPut - place, set, attach, establish, assign, keep, save, set aside, effect, achieve, do, buildQuiet - silent, still, soundless, mute, tranquil, peaceful, calm, restfulRight - correct, accurate, factual, true, good, just, honest, upright, lawful, moral, proper, suitable, apt, legal, fairRun - race, speed, hurry, hasten, sprint, dash, rush, escape, elope, fleeSay/Tell - inform, notify, advise, relate, recount, narrate, explain, reveal, disclose, divulge, declare, command, order, bid, enlighten, instruct, insist, teach, train, direct, issue, remark, converse, speak, affirm, suppose, utter, negate, express, verbalize, voice, articulate, pronounce, deliver, convey, impart, assert, state, allege, mutter, mumble, whisper, sigh, exclaim, yell, sing, yelp, snarl, hiss, grunt, snort, roar, bellow, thunder, boom, scream, shriek, screech, squawk, whine, philosophize, stammer, stutter, lisp, drawl, jabber, protest, announce, swear, vow, content, assure, deny, disputeScared - afraid, frightened, alarmed, terrified, panicked, fearful, unnerved, insecure, timid, shy, skittish, jumpy, disquieted, worried, vexed, troubled, disturbed, horrified, terrorized, shocked, petrified, haunted, timorous, shrinking, tremulous, stupefied, paralyzed, stunned, apprehensiveShow - display, exhibit, present, note, point to, indicate, explain, reveal, prove, demonstrate, exposeSlow - unhurried, gradual, leisurely, late, behind, tedious, slackStop - cease, halt, stay, pause, discontinue, conclude, end, finish, quitStory - tale, myth, legend, fable, yarn, account, narrative, chronicle, epic, sage, anecdote, record, memoirStrange - odd, peculiar, unusual, unfamiliar, uncommon, queer, weird, outlandish, curious, unique, exclusive, irregularTake - hold, catch, seize, grasp, win, capture, acquire, pick, choose, select, prefer, remove, steal, lift, rob, engage, bewitch, purchase, buy, retract, recall, assume, occupy, consumeTell - disclose, reveal, show, expose, uncover, relate, narrate, inform, advise, explain, divulge, declare, command, order, bid, recount, repeatThink - judge, deem, assume, believe, consider, contemplate, reflect, mediateTrouble - distress, anguish, anxiety, worry, wretchedness, pain, danger, peril, disaster, grief, misfortune, difficulty, concern, pains, inconvenience, exertion, effortTrue - accurate, right, proper, precise, exact, valid, genuine, real, actual, trusty, steady, loyal, dependable, sincere, staunchUgly - hideous, frightful, frightening, shocking, horrible, unpleasant, monstrous, terrifying, gross, grisly, ghastly, horrid, unsightly, plain, homely, evil, repulsive, repugnant, gruesomeUnhappy - miserable, uncomfortable, wretched, heart-broken, unfortunate, poor, downhearted, sorrowful, depressed, dejected, melancholy, glum, gloomy, dismal, discouraged, sadUse - employ, utilize, exhaust, spend, expend, consume, exerciseWrong - incorrect, inaccurate, mistaken, erroneous, improper, unsuitable
ADJECTIVES FOR WRITING REVIEWSThe AuthorCultured, intellectual, well-read, erudite.Sage, sensible, rational.Philosophic, analytical, imaginative, perspective, visionary, prophetic.Optimistic, broad-minded, idealistic, religious, orthodox, sympathetic.Sophisticated, unsophisticated.Original, clever, witty, humorous, whimsical.Conservative, progressive, radical, reactionary, unprejudiced, realistic, romantic.Uncultured, unintellectual, shallow, superficial.Bigoted, opinionated, intolerant, critical, fanatical.Provincial, narrow-minded, pessimistic, cynical, egotistical, sentimental.GeneralLucid, graphic, intelligible.Explicit, precise, exact.Concise, succinct, condensed, pithy.Poetic, plain, simple. homely, pure.Vigorous, forceful, eloquent, fluent, clean, clear.Natural, restrained.Smooth, polished, classical, artistic.Bombastic, extravagant, pompous, grandiose, obscure, vague.Diffuse, verbose.Ungraceful, harsh, abrupt, awkward, unpolished, crude, vulgar.Formal, artificial.The DictionPrecise, exact, concrete.Plain, simple, homespun.Learned, cultured, literal, figurative.Connotative, symbolic, picturesque, sensuous.Literary, provincial, colloquial, slangy.Inexact, non-specific.Bombastic, trite, artificial, obscure, grotesque, vulgar.The SentencesLoose, periodic, balanced, antithetical.Long, short.Euphonic, rhythmical.Forceful, emphatic.Varied.Ungrammatical, un-unified, incoherent.Involved, rambling, awkward, jerky.Cacophonic.Monotonous, dull.
SENSES
TouchcoolcoldicylukewarmtepidwarmhotsteamystickydampwetslipperyspongymushyoilywaxyfleshyrubberytoughcrispelasticleatherysilkysatinyvelvetysmoothsoftwoollyfurryfeatheryfuzzyhairypricklygrittysandyroughsharpthickpulpydrydullthinfragiletenderTasteoilybutterysaltybitterbittersweetsweetheartymellowsugarycrispripeblandtastelesssourvinegaryfruitytangyunriperawalkalinemedicinalfishyspicypepperygingeryhotburntoverripespoiledrottenSmellsweetscentedfragrantaromaticperfumedheadyfreshbalmyearthypineyodorouspungenttemptingspicysavorysharpgamyfishybrinyacidacridburntgaseousreekingputridrottenspoiledsourrancidsicklystagnantmoldymustymildeweddampdankstenchLoud soundscrashthudbumpthumpboomthunderbangsmashexploderoarscreamscreechshoutyellwhistlewhinesquawkbarkbraybawlblusterrageblarerumblegrateslamclapstompstampnoisediscorddinjangleraspclashclamortumultriotracketbrawlbedlampandemoniumhubbubblatantdeafeningraucousearsplittingpiercingrowdydisorderlySoft soundssighmurmurwhisperwhirrustletwitterpatterhummuttersnaphisscracklebleatpeepbuzzzinggurgleswishrushchimetinkleclinkhushstillspeechlessmutefaintinaudiblemelodyresonanceharmonymusicalSpeech soundsstutterstammergiggleguffawlaughsingyellscreamscreechsnortbellowgrowlchattermurmurwhisperwhimpertalkspeakdrawl
Sightdottedfreckledspottedblotchedwrinkledpatternedmottledflowerystripedbrightclearshinyglowingglossyshimmeringfluidsparklingiridescentglassyflashyglazedsheertransparenttranslucentopaquemuddygrimyyoungdrabdingydulldarkdismalrottedoldusedwornuntidyshabbymessytiredexhaustedaridawkwardcrookedloosecheapuglyramshacklecurvedstraightorderlyformalcrispprettyheavyflatstoutwiderigidnarrowoverloadedcongestedclutteredcrowdedjammedpackedbruisedtiedstretchedtallerectleanslendersupplelithelivelymuscularsturdyrobusthardystronghealthyfrailfragilepalesicklysmalltinyminiaturetimidshynervousfrightenedwildbolddramatictantalizingirresistibleenergeticanimatedperkyarrogantimposingregalstatelyelegantlargehugeimmensemassivegiganticshowydecorativedazzlingopulentjeweledlavishexoticradiantfieryblazingfreshcleanscrubbedtidyhandsomepleasantcalmserene