Comparative in vitro analyses of the effect
of immunoglobulin 𝝀 light chain and fatty
acid free albumin on proximal tubular
epithelial cells-involvement of megalin
phosphorylation
Thesis submitted for the degree of Doctor of Philosophy at the
University of Leicester
By
Dalia Muhammed Alammari
(BSc, MSc)
Department of Infection, Immunity and Inflammation
University of Leicester
December 2015
I
ABSTRACT
Comparative in vitro analyses of the effect of immunoglobulin λ light chain and fatty
acid free albumin on proximal tubular epithelial cells-involvement of megalin
phosphorylation
Dalia Alammari
Kidney disease is a major challenge for health care systems, and the prevalence is
increasing. Proteinuria is a hallmark of progressive renal dysfunction and describes the
pathological excess of plasma proteins in urine, mainly albumin.
Multiple Myeloma is a cancer of plasma cells that leads to excessive presence of free
light chain protein (FLC) in blood. Renal failure due to overproduction of FLC and the
associated light chain proteinuria occurs as a result of decreased renal function or as a
direct toxic effect on the proximal tubular cells (PTCs) by excessive protein. Proteins
are normally reabsorbed by endocytosis via megalin receptor that binds proteins and
mediates their uptake. Exceeding the proximal tubular epithelial cells (PTECs)
reabsorption capacity might trigger inflammation detrimental to the kidney. In
proteinuric nephropathy the cytoplasmic tail of megalin (MegCT) is phosphorylated
after interaction between proteins and megalin on the PTECs, which activates signalling
cascades that regulate the phosphorylation.
An in vitro proteinuric model was established using HK2 cells (a proximal tubular
epithelial cell line derived from normal human kidney) treated with high concentrations
of essentially fatty acid free human serum albumin (FAF-HSA) or lambda light chain
(𝜆-LC) isolated and purified from the urine of a myeloma patient, to induce cellular
damage. The potential pathogenic role for FAF-HSA and 𝜆 -LC on HK2 cells was
examined. Also, renal toxicity that comes from the intracellular signalling through
phosphorylation of MegCT was addressed by utilising antibodies directed against
specific phosphorylation site (PPPSP) of the intracellular portion of megalin in HK2
cells stimulated with different concentrations of FAF-HSA and 𝜆-LC, so-called pre-
stimulated HK2.
In vitro analyses showed (i) a detrimental effect of FAF-HSA and 𝜆-LC on viability of
HK2, (ii) phosphorylation of the cytoplasmic tail of megalin in pre-stimulated HK2
cells. (iii) Production of inflammatory cytokines and H2O2 generation, activation of
autophagy process and increase in several kidney biomarkers/ injury mediators, which
are involved in different pathways in response to protein overload. All these reasons are
likely to contribute to direct PTECs injury and kidney failure in patients.
Potentially these mechanisms may be attractive for drug development to benefit patients
with kidney failure and help to inhibit the progression of proteinuric nephropathy and as
such may save lives.
II
STATEMENT
This thesis results from work undertaken at the University
of Leicester during the period of registration.
III
DEDICATE
To My….
Husband Mohammed
Mother Heyam,
Brother Hamzah
&
To the spirit of my Father (God mercy be
upon him)
IV
ACKNOWLEDGMENT
‘For his mercy and blessing all praise and gratitude goes to the Almighty God’
Writing of this thesis has not been an easy process. It required a lot of work, time and
patience. I could have never been able to write this thesis without guidance and support
from others.
I would like to take this opportunity to offer my deepest thanks, respect and gratitude to
my supervisor Dr. Cordula Stover. I am extremely grateful for her constant
encouragement, support, guidance, advice and patience throughout this research. I could
not have asked for a better mentor as I am blessed I got the best one.
I would like to thank my second supervisor Dr. Alan Bevington for his help and advice.
Also, I would thank my progress review panel members, Professor Nigel Brunskill and
Dr. Primrose Freestone for their positive feedback and advice.
It is a pleasure to acknowledge with sincere thanks to Dr. Simon Byrne for his time,
advice and help with many different methods in this project. I would like to express my
deep gratitude to Dr. Ravinder Chana for his time and help with the phosphorylation
work I really appreciate that. My thanks would be extended to Dr. Mike Browning for
his help to get the myeloma patient urine sample and to Professor Russell Wallis and
Dr. Chris Furze for their help in the purification work. I would like to thank the late
Stefan Hyman and Natalie Allcock of the electron microscopy laboratory for processing
my samples for scanning and transmission electron microscopic and for providing me
with such lovely images. It is a pleasure to extend my thanks to all my friends either in
the UK or in my country or anywhere (Amira, Sara and Nawal) and all people in lab
211B for their help, support and encouragement.
My thanks and appreciations are also offered to the Saudi Arabian Cultural Bureau in
London for their help. Also, I would like to thank all the staff at the University of
Leicester who was very kind and supportive. My thanks are also offered for any kind of
help, which I received from anybody and by any means.
Finally, a very special thanks to my lovely husband Mohammed. This degree cannot be
finish without his love, help, support and patience in this long journey. My special
gratitude to my mother, brother, and my family for giving me all the help and support I
needed.
Dalia Alammari
V
PUBLICATIONS ARISING FROM THIS THESIS
Dalia Alammari, Alan Bevington and Cordula Stover. Is Megalin Phosphorylation the
Reason for Kidney Damage in Myeloma?. Poster Presentation. The 7th Saudi Student
conference, Edinburgh, UK, February 2014, (Appendix I).
Dalia Alammari, Alan Bevington and Cordula Stover. Monoclonal Light Chain
mediated damage of Proximal Tubular Epithelial Cells – a mechanism of renal
pathology in Multiple Myeloma involving Megalin. Presentation (Talk). The 6th
Annual Postgraduate Student Conference, University of Leicester, Leicester, UK, April
2014.
Dalia Alammari, Alan Bevington and Cordula Stover. Proteinuria mediated damage of
Proximal Tubular Epithelial Cells (PTECs) - a mechanism of renal pathology in
Multiple Myeloma involving Megalin. Poster Presentation. Kidney Week 2014
conference, Glasgow, UK, April 2014, (Appendix II).
Dalia Alammari, Alan Bevington and Cordula Stover. How can we help blood cancer
patients reduce their kidney damage?. Presentation (Talk). Manchester Life Sciences
Ph.D. Conference in University of Manchester, University of Manchester, Manchester
UK, May 2014.
Dalia Alammari, Alan Bevington and Cordula Stover. How can we help blood cancer
patients reduce their kidney damage?. Poster Presentation. University of Leicester
Postgraduate Research Festival, selected as one of the 50 most promising researchers
among 1500 postgraduates at the University, University of Leicester, Leicester, UK,
June 2014, (Appendix III).
Dalia Alammari, Alan Bevington and Cordula Stover. Can Myeloma light chain
activate kidney proximal tubular cells to become pro-inflammatory cells?.
Presentation (Talk). The 7th Annual Postgraduate Student Conference, selected as one of
the best presentation, University of Leicester, Leicester, UK, April 2015.
Zwaini, Z., Alammari, D., Byrne, S., Stover, C., 2016. Mode of proximal tubule
damage: differential cause for the release of TFF3? Frontiers in Immunology. 7, 122.
Dalia M. Alammari, Ravinder S. Chana, Christopher Furze, Russell Wallis, Alan
Bevington, Nigel J. Brunskill, Richard J. Baines and Cordula M. Stover. Induction of
megalin phosphorylation at PPPSP motif by light chains (In preparation).
VI
TABLE OF CONTENTS
LIST OF TABLES ............................................................................................................. XI
LIST OF FIGURES .......................................................................................................... XII
LIST OF ABBREVIATIONS ..................................................................................... XVIII
Chapter One-Introduction ..................................................................................................... 1
1. Why is my urine foamy? ................................................................................................. 2
1.1 The Epidemiology of Renal Failure: ......................................................................... 2
1.2 Kidney Diseases: ....................................................................................................... 3
1.2.1 Acute and Chronic Kidney Diseases: ................................................................. 3
1.2.2 Nephropathies of Systemic Diseases: ................................................................. 4
1.2.3 Dysproteinemic: .................................................................................................. 5
1.3 Multiple Myeloma: .................................................................................................... 6
1.3.1 Myeloma Nephropathy: ...................................................................................... 7
1.3.2 Cast nephropathy: ............................................................................................... 7
1.3.3 Fanconi syndrome proximal tubulopathies: ........................................................ 8
1.3.4 Amyloidosis: ....................................................................................................... 8
1.3.5 Light-chain deposition disease: .......................................................................... 8
1.4 Monoclonal FLC and Myeloma Kidney: .................................................................. 9
1.4.1 Immunoglobulin and Light Chain Structure: ...................................................... 9
1.5 Kidney, anatomy and function: ............................................................................... 10
1.6 Protein uptake and Endocytosis: ............................................................................. 11
1.6.1 Proteinuria: ........................................................................................................ 11
1.6.2 PTCs and Endocytosis process: ........................................................................ 13
1.6.3 Megalin: ............................................................................................................ 15
1.6.3.1 Megalin Signalling Functions: ................................................................... 15
1.6.3.2 Megalin mutation and human diseases: ..................................................... 16
1.6.3.3 Description of megalin transgenic mouse: ................................................. 16
1.6.4 Megalin-Associated Molecules: ....................................................................... 16
1.6.4.1 Cubilin: ....................................................................................................... 16
1.6.5 Non Megalin/cubilin mediated up take of protein in PTCs: ............................. 18
1.6.5.1 Cluster of differentiation 36 (CD36): ......................................................... 18
1.7 Signalling role of megalin in PTCs toxicity: ........................................................... 21
1.7.1 Signalling pathway regulates protein endocytosis in PTCs: ............................. 21
1.7.2 Megalin phosphorylation and PTCs toxicity: ................................................... 23
1.8 Proteinuria and Proximal Tubular cells Toxicity: ................................................... 23
1.8.1 The effect of proteinuria on PTCs viability: ..................................................... 24
VII
1.8.2 Inflammatory cytokines/chemokines and fibrogenic mediators: ...................... 24
1.8.2.1 Interlukin-6 (IL6): ...................................................................................... 24
1.8.2.2 Interlukin-8 (IL-8): ..................................................................................... 25
1.8.2.3 Monocyte Chemoattractant Protein-1 (MCP-1): ........................................ 26
1.8.3 Complement components as pathogenic mediators of tubular toxicity in
proteinuria: ................................................................................................................. 27
1.8.3.1 Mechanism of alternative pathway activation and regulation: .................. 28
1.8.3.2 Evidence of complement pathway contributes to induce renal injury: ...... 28
1.8.4 Reactive oxygen species (ROS) and renal tubular injury: ................................ 30
1.8.5 Autophagy in renal tubular injury: .................................................................... 32
1.8.5.1 Evidence of autophagy induces protection/injury in PTCs in kidney
diseases: .................................................................................................................. 33
1.8.6 Apoptosis in proximal tubular injury: ............................................................... 36
1.8.6.1 Proteinuria and renal tubular apoptosis: ..................................................... 37
1.8.7 Evidence for toxicity of excess proteins to PTCs: ............................................ 38
1.8.7.1 Novel biomarkers/mediators of PTCs toxicity: .......................................... 38
1.8.7.2 Kidney injury molecule-1 (Kim-1): ........................................................... 39
1.8.7.3 Transforming growth factor beta (TGF-β): ................................................ 40
1.8.7.4 Tumor necrosis factor alpha (TNF-α): ....................................................... 41
1.9 Model for Proximal Tubular Epithelial Cells (PTECs): .......................................... 43
1.9.1 Human Embryonic Kidney Cells 293 (HEK293): ............................................ 45
1.10 Hypothesis: ............................................................................................................ 46
1.11 Aims: ..................................................................................................................... 46
Chapter Two-Materials and Methods ................................................................................. 48
2. General Methods ........................................................................................................... 49
2.1 Tissue culture: ......................................................................................................... 49
2.2 Scanning Electron Microscopy (SEM): ................................................................... 51
2.3 Histology: ................................................................................................................ 52
2.3.1 Immunohistochemistry staining protocol for endogenous Alkaline
Phosphatase: ............................................................................................................... 52
2.3.2 Immunocytochemistry: ..................................................................................... 53
2.3.3 Mouse PTECs preparation: ............................................................................... 53
2.4 MTT assay: .............................................................................................................. 54
2.5 LDH assay: .............................................................................................................. 54
2.6 Crystal Violet assay: ................................................................................................ 56
2.7 Reverse Transcriptase Polymerase Chain Reaction (RT-PCR):.............................. 56
2.7.1 Preparation of Ribonucleic Acid (RNA): ......................................................... 56
2.7.2 Preparation of Complementary Deoxyribonucleic Acid (cDNA): ................... 57
2.7.3 PCR Protocol: ................................................................................................... 57
VIII
2.7.4 Human Primers ................................................................................................. 59
2.8 Real-Time Quantitative polymerase chain reaction (RT-qPCR): ........................... 61
2.8.1 RT-qPCR analysis and calculation: .................................................................. 63
2.8.2 Primer Efficiency: ............................................................................................. 64
2.9 Protein Immunoblot (Western blot): ....................................................................... 66
2.9.1 Preparation of cell lysate: ................................................................................. 66
2.9.2 Protein Assay: ................................................................................................... 66
2.9.3 Western Blot Protocol: ...................................................................................... 67
2.9.4 Preparing the Maxi Gradient Gel for the Megalin Western blot: ..................... 72
2.9.5 Preparing the 4% Gel for the Megalin Western blot: ....................................... 74
2.10 Ultra structural analysis by transmission electron microscopy (TEM): ................ 74
2.11 Detection of Apoptosis: ......................................................................................... 75
2.12 Quantitative measurement by ELISA: ................................................................... 77
2.12.1 Mini Elisa for candidate cytokines and chemokine from HK2 (+/-GF)
cells: ........................................................................................................................... 77
2.12.2 Human TFF3 Immunoassay: .......................................................................... 78
2.13 Determination of H2O2 Production by DCFDA: ................................................... 79
2.14 Measuring Hydrogen Peroxide Production (H2O2) Production by Amplex®
Red: ................................................................................................................................ 82
2.15 Proteome Profile® analysis of HK2-GF cells: ....................................................... 83
2.15.1 Proteome profile Data Analysis: ..................................................................... 84
2.16 Phosphorylation of the recombinant expressed cytoplasmic tail of Megalin
receptor: ......................................................................................................................... 88
2.16.1 Rationale for use of pGEX-4T1 plasmid and MegCT-fusion protein: ........... 88
2.16.2 Preparation and collection of MegCT-GST Fusion protein: .......................... 89
2.16.3 Stimulation of MegCT-GST fusion protein phosphorylation in vitro: ........... 91
2.17 Statistics and Data analysis: .................................................................................. 96
Chapter Three-FLC Purification ........................................................................................ 97
3. Purification of monoclonal Free Light Chain (FLC): ................................................... 98
3.1 Source of Free Light Chain: .................................................................................... 98
3.2 Urine Sample analyses: ........................................................................................... 98
3.3 Dipstick test: .......................................................................................................... 100
3.4 Albumin Excretion: ............................................................................................... 102
3.5 Protein sequencing: ............................................................................................... 104
3.5.1 Gel Digestion Protocol (Protein Digestion): ................................................... 104
3.5.2 Matrix Assisted Laser Desorption/Ionization - Time-of-Flight (MALDI-
TOF): ....................................................................................................................... 105
3.5.3 Results of MALDI-TOF MS analyses: ........................................................... 105
3.6 Extraction of protein from the urine sample: ........................................................ 105
IX
3.7 Purified FLC Protein Sequencing: ......................................................................... 115
3.8 RSLCnano HPLC System: .................................................................................... 115
3.9 LTQ-Orbitrap-Velos Mass Spectrometer: ............................................................. 115
3.10 LC-MS/MS Sequance Results: ............................................................................ 116
3.11 Protein Concentrate column: ............................................................................... 116
3.12 Endotoxin Measurement: ..................................................................................... 117
3.12.1 Endotoxin Removal: ......................................................................................... 118
3.13 Human Serum Albumin Devoid of Fatty Acids: ................................................. 118
3.14 Calculation of protein load: ................................................................................. 119
Chapter Four- Characterisation of Renal Proximal Tubular Epithelial Cells ............... 121
4. Introduction ................................................................................................................. 122
4.1 Aim ........................................................................................................................ 122
4.2 Results ................................................................................................................... 123
4.2.1 Culture characteristics of Human Renal Proximal Tubular Epithelial Cell
line (HK2): ............................................................................................................... 123
4.2.2 Transmission Electron Microscopy analysis (TEM) for HK2 cell line: ......... 125
4.2.3 Scanning Electron Microscopy (SEM) analysis for brush border of HK2
(+/-GF) cells:............................................................................................................ 127
4.2.4 Villin-1 – A marker of brush border differentiation in renal cells: ................ 130
4.2.5 Mouse Proximal Tubular Epithelial Cells (mPTEC) preparation: .................. 131
4.2.6 Alkaline phosphatase enzyme marker of proximal tubular cells: ................... 133
4.2.7 Human Proximal Tubule Epithelial cell culture: ............................................ 135
4.3 Discussion .............................................................................................................. 139
Chapter Five- Establishing an in vitro Model of Protein-Induced Epithelial Cell
Damage ............................................................................................................................... 144
5. Introduction: ................................................................................................................ 145
5.1 Aim: ....................................................................................................................... 147
5.2 Results: .................................................................................................................. 148
5.2.1 Dose and time dependent influence of FAF-HSA and 𝛌-LC on cell
viability: ................................................................................................................... 148
5.2.1.1 MTT Assay: ............................................................................................. 148
5.2.1.2 LDH Activity Assay: ................................................................................ 153
5.2.1.2.1 PTECs Protein Overload Model: .......................................................... 154
5.2.2 Autophagy as a response of HK2 (+/- GF) to cell damage by protein
overload: .................................................................................................................. 161
5.2.3 Effect of overload protein concentration to induce apoptosis: ....................... 175
5.2.4 Effect of FAF-HSA and 𝛌-LC on mediators of inflammation in kidney
damage: .................................................................................................................... 184
X
5.3 Discussion .............................................................................................................. 191
Chapter Six-Megalin Phosphorylation in Renal Proximal Tubular Epithelial Cells ..... 199
6. Introduction ................................................................................................................. 200
6.1 Aim ........................................................................................................................ 203
6.2 Results ................................................................................................................... 205
6.2.1 Expression of mRNA and protein of Megalin in HK2 (+/-GF) cells: ............ 205
6.2.2 MegCT-GST fusion protein phosphorylation in HK2 (+/-GF) cells: ............. 211
6.2.3 Effects of protein overload on mRNA expression for Megalin and CD36 by
HK2 (+/-GF) cells: ................................................................................................... 217
6.3 Discussion .............................................................................................................. 220
Chapter Seven- Effects of Protein Overload on Proximal Tubular Cells in the
Progression of Damage In Vitro ....................................................................................... 227
7. Introduction ................................................................................................................. 228
7.1 Aim ........................................................................................................................ 229
7.2 Results ................................................................................................................... 230
7.2.1 Evaluation the effect of FAF-HSA and 𝛌-LC on cytokine production in
HK2 (+/-GF) cells: ................................................................................................... 230
7.2.2 Complement component production by HK2 (+/-GF) cells: .......................... 238
7.2.3 Effect of Protein Overload on H2O2 production: ............................................ 249
7.2.4 Study of potential biomarkers of human kidney injury using an in vitro
protein stimulation model: ....................................................................................... 255
7.3 Discussion .............................................................................................................. 267
8. Summary: ................................................................................................................ 283
Conclusion .......................................................................................................................... 290
Findings and Future work................................................................................................. 291
Appendix ............................................................................................................................. 293
References .......................................................................................................................... 302
XI
LIST OF TABLES
Table (1.1): Classification of systemic diseases that have adverse renal effects. ............. 5
Table (1.2): Main types of dysproteinemia diseases and renal complications. ................ 6
Table (1.3): Biomarkers of kidney injury. ...................................................................... 39
Table (2.1): Mammalian Ringer Fixation for SEM solution .......................................... 52
Table (2.2): Preparation of 5 x Tris/Borate/EDTA solution for electrophoresis. ........... 58
Table (2.3): Preparation of qRT-PCR reaction. ............................................................. 62
Table (2.4): The temperature cycling conditions of qRT-PCR. ..................................... 62
Table (2.5): Preparation of 10 ml Lysis Buffer .............................................................. 69
Table (2.6): Preparation of buffers for Western blot. ..................................................... 70
Table (2.7): Primary antibodies. ..................................................................................... 71
Table (2.8): Secondary antibodies. ................................................................................. 71
Table (2.9): Preparation for Gradient Gel. ...................................................................... 73
Table (2.10): Preparation of 4% gel. ............................................................................... 74
Table (2.11): Preparation of Paraformaldehyde and Methyl green. ............................... 76
Table (2.12): Luria Broth media and Glutathione Sepharose 4B preparation. .............. 90
Table (2.13): Table of agents used in the studies of MegCT phosphorylation.. ............ 93
Table (2.14): JNK and Kinase buffers preparations. ...................................................... 94
Table (3.1): Coomassie Blue Preparation. ...................................................................... 99
Table (3.2): The classification of urinary albumin excretion. ...................................... 103
Table (3.3): preparation of 1M Sodium Phosphate Buffer pH 9.0. .............................. 106
XII
LIST OF FIGURES
Figure (1.1): The basic structure of immunoglobulin......................................................10
Figure (1.2): Megalin-mediated endocytosis and recycling to the cell surface..............14
Figure (1.3): Schematic structures of megalin and cubilin receptors in relation to the
plasma membrane............................................................................................................18
Figure (1.4): Mechanism of multiple myeloma and kidney failure.................................20
Figure (1.5): Mechanism of activation and regulation of complement alternative
pathway............................................................................................................................30
Figure (1.6): H2O2 generation by NADPH......................................................................32
Figure (1.7): Diagram of the steps of autophagy.............................................................35
Figure (1.8): Light microscopic appearance of Human Kidney (HK2) cells…………..44
Figure (2.1): Light microscopic appearance of human embryonic kidney 293 (HEK 293)
cells……………………………………………………………………………………..50
Figure (2.2): Lactate Dehydrogenase (LDH) detection mechanism…………………....55
Figure (2.3): 1 Kb Plus DNA Ladder in 1% agarose gel electrophoresis........................59
Figure (2.4): Quantitative Real Time-Polymerase Chain Reaction (RT-qPCR) for β-
actin (Housekeeping gene) expression in HK2 cells.......................................................65
Figure (2.5): Example for the standard curve showing the absorbance of different
concentrations of BSA by Pierce 660nm Protein assay..................................................67
Figure (2.6): Protein marker (Precision Plus ProteinTM Standards, BIO RAD (10-250
kDa))……………………………………………………………………………………72
Figure (2.7): Examples for Standard curves for (A) IL-6, MCP-1 (B) and (C) IL-8 Mini
ELISA..............................................................................................................................78
Figure (2.8): Formation of fluorescent DCF by ROS activity.........................................81
Figure (2.9): Conversion of Amplex Red to resorufin by HRP using H2O2...................82
Figure (2.10): Standard curve for Measuring Hydrogen Peroxide Production (H2O2)
Production by Amplex® Red..........................................................................................83
XIII
Figure (2.11): Example of the Human Kidney Biomarker Array result for HK2-GF
control sample..................................................................................................................85
Figure (2.12): (A) The Human Kidney Biomarker Array coordinates. (B) The table
shows the reference of the 38 proteins............................................................................87
Figure (2.13): Preparations steps of MegCT-GST Fusion protein..................................91
Figure (2.14): Phosphorylation of Meg-CT.....................................................................96
Figure (3.1): Characterisation of urinary protein profile from a multiple myeloma
patient............................................................................................................................100
Figure (3.2): Comparing the urinary proteins in the patient (P) and the control (C)
sample…………………………………………………………………………………101
Figure (3.3): Estimation of albumin concentration in MM patient urine sample..........103
Figure (3.4): The purified free light chain…………………………………………....106
Figure (3.5): Comparison of FLC binding to different resin types using dialysis urine
sample with pH 7.6 sodium phosphate buffer in 12 % SDS-PAGE stained with
Coomassie Blue reduced condition...............................................................................108
Figure (3.6): Optimizing the volumes of dialysed protein sample loaded in 1ml Q
Sepharose Fast Flow column for better binding............................................................109
Figure (3.7): Electrophoretic (SDS-PAGE) final analysis of FLC purification............110
Figure (3.8): Chromatogram of Ion exchange column High-performance liquid
chromatography (HPLC) system...................................................................................112
Figure (3.9): Chromatogram of removal of impurities from FLC sample by size
exclusion High-performance liquid chromatography (HPLC) system..........................113
Figure (3.10): SDS-PAGE analysis for fractions eluted from Ion exchange column
1.5ml/min.......................................................................................................................114
Figure (3.11): Protein Sequence Coverage, 87/106 amino acid (~82%), (covered
locations were indicated in yellow)...............................................................................116
Figure (3.12): Methodology of Monoclonal Free Light Chain Protein Purification.....120
Figure (4.1): Microscopic appearance of HK2 cells......................................................124
Figure (4.2): Transmission electron microscopy (TEM) for HK2 (+/-GF) cells...........126
Figure (4.3): Typical scanning electron micrographs showing microvilli on the surface
of HK2 cells...................................................................................................................130
XIV
Figure (4.4): Western blot analysis of Villin-1 as a marker of brush border
differentiation................................................................................................................131
Figure (4.5): Microscopic documentation of isolation of murine renal tubules............132
Figure (4.6): Histochemical alkaline phosphatase staining (ALP)................................135
Figure (4.7): Differences in proliferation in HK2 and HK2-GF cells...........................138
Figure (5.1): Effects of FAF-HSA overload on cell viability measured using MTT assay
in HK2 (+/-GF) cells for (2, 4 and 6h)………………………………………………..150
Figure (5.2): Effects of FAF-HSA overload on cell viability measured using MTT assay
in HK2 (+/-GF) cells for (24, 48 and 72h)……………………………………………151
Figure (5.3): Effects of 𝜆-LC on cell viability measured using MTT assay in HK2 (+/-
GF) cells for (24, 48 and 72h)………………………………………………………...152
Figure (5.4): Impact of FAF-HSA on HK2 (+/-GF) cells viability, assessed by
measurement of LDH (2,500 cells/well)……………………………………………...156
Figure (5.5): Impact of FAF-HSA on HK2 (+/-GF) cells viability, assessed by
measurement of LDH (5,000 cells/well)…………………………………….………..157
Figure (5.6): Impact of FAF-HSA on HK2 (+/-GF) cells viability, assessed by
measurement of LDH (10,000 cells/well)…………………………………………….158
Figure (5.7): Impact of 𝜆-LC on HK2 (+/-GF) cells viability, assessed by measurement
of LDH (10,000 cells/well)………………………………...………………………….159
Figure (5.8): Impact of 24 and 72h incubation of HK2 (+/-GF) cells with excess
amounts of FAF-HSA or 𝜆-LC on LDH release into the medium……………………160
Figure (5.9): Representative transmission electron micrographs (TEM) showing
different stages of autophagocytosis in cells exposed to (0.2 μM) tunicamycin ……..164
Figure (5.10): Representative transmission electron micrographs (TEM) of HK2-GF
cells incubated in serum free media for 24 and 72h (control cells)...............................165
Figure (5.11): Representative transmission electron micrographs (TEM) of HK2-GF
cells treated with (5mg/ml) FAF-HSA for 24h.............................................................166
Figure (5.12): Representative transmission electron micrographs (TEM) of HK2-GF
cells treated with (5mg/ml) FAF-HSA for 72h.............................................................167
Figure (5.13): Representative transmission electron micrographs (TEM) of HK2 cells
incubated in serum free media for 24 and 72h (control cells).......................................168
XV
Figure (5.14): Representative transmission electron micrographs (TEM) of HK2 cells
treated with (5mg/ml) FAF-HSA for 24h……………………………………………..169
Figure (5.15): Representative transmission electron micrographs (TEM) of HK2 cells
treated with (5mg/ml) FAF-HSA for 72h……………………………………………..170
Figure (5.16): Representative transmission electron micrographs (TEM) of HK2-GF
cells treated with (5mg/ml) 𝜆-LC for 24h……………………………………………..171
Figure (5.17): Representative transmission electron micrographs (TEM) of HK2-GF
cells treated with (5mg/ml) 𝜆-LC for 72h……………………………………………..172
Figure (5.18): Representative transmission electron micrographs (TEM) of HK2 cells
treated with (5mg/ml) 𝜆-LC for 24h…………………………………………………..173
Figure (5.19): Representative transmission electron micrographs (TEM) of HK2 treated
with (5mg/ml) 𝜆-LC for 72h…………………………………………………………..174
Figure (5.20): Specific staining of DNA fragmentation associated with apoptosis
(ApopTag®) in stimulated HK2 (+/-GF) cells with overload proteins.........................177
Figure (5.21): Western Blot analysis of Caspase-3 from stimulated HK2 (+/-GF) cells
with overload proteins……………………………………………………………….. 182
Figure (5.22): Effects of FAF-HSA or 𝜆-LC on Caspase-3 mRNA expression from HK2
(+/- GF)..........................................................................................................................183
Figure (5.23): mRNA expression of TGF-𝛽 from stimulated HK2 (+/-GF) cells with
overload proteins...........................................................................................................187
Figure (5.24): mRNA expression of TNF-𝛼 from stimulated HK2 cells (+/-GF) with
overload proteins……………………………………………………………………...188
Figure (5.25): mRNA expression of KIM-1 from stimulated HK2 (+/-GF) cells with
overload proteins……………………………………………………………………...189
Figure (5.26): Semi-quantitative analysis of clusterin mRNA expression from HK2-GF
cells after stimulating with 5mg/ml FAF-HSA or 𝜆-LC for 24 and 72h……………...190
Figure (6.1): The Megalin receptor…………………………………………………...204
Figure (6.2): Analysis of megalin mRNA expression in HK2, HK2-GF and HEK 293
cells. .………………………………………………………………………………….205
Figure (6.3): RT-qPCR efficiency for megalin and β-actin gene expression in HEK293
cells................................................................................................................................207
Figure (6.4): RT-qPCR for mRNA megalin and β-actin gene expression in (5 𝜇𝑔
mRNA) HK2 (+/-GF) cells……………………………………………………………208
XVI
Figure (6.5): Gel electrophoresis analysis for RT-qPCR product (megalin receptor)...209
Figure (6.6): Western blot analyses of megalin……………………………………… 211
Figure (6.7): Time course of PDBU stimulated phosphorylation of MegCT-GST fusion
protein by HEK2293………………………………………………………….......…...213
Figure (6.8): Time course of PDBU stimulated phosphorylation of MegCT-GST fusion
protein by HK2 (+/-GF) cells…………………………………………………………214
Figure (6.9): Effect of FAF-HSA on phosphorylation of MegCT-GST fusion
protein…………………………………………………………………………………215
Figure (6.10): Effect of 𝜆-LC on phosphorylation of MegCT-GST fusion protein…..216
Figure (6.11): Effect of FAF-HSA or 𝜆-LC on megalin and CD36 mRNA expression
from HK2 (+/- GF) cells………………………………………………………………218
Figure (6.12): Interactions of Albumin or 𝝀-LC with PTECs and different signalling
kinase pathways that regulate MegCT phosphorylation………………………………224
Figure (7.1): The effects of 𝜆-LC and FAF-HSA on IL-6 protein production and mRNA
expression by HK2 (+/-GF) cells……………………………………………………...232
Figure (7.2): The impacts of 𝜆-LC or FAF-HSA on IL-8 protein production and mRNA
expression by HK2 (+/-GF) cells……………………………………………………...234
Figure (7.3): The effects of 𝜆 -LC or FAF-HSA on MCP-1 protein production and
mRNA expression from HK2 cells (+/-GF)…………………………………………..237
Figure (7.4): Effects of FAF-HSA or 𝜆-LC on C3 mRNA expression from HK2 (+/-
GF)…………………………………………………………………………………….240
Figure (7.5): Impacts of FAF-HSA or 𝜆-LC on FB mRNA expression from HK2 (+/-
GF)…………………………………………………………………………………….241
Figure (7.6): Effects of FAF-HSA or 𝜆-LC on FH mRNA expression from HK2 (+/-
GF)…………………………………………………………………………………….242
Figure (7.7): Effects of FAF-HSA or 𝜆-LC on Properdin mRNA expression from HK2
(+/-GF)………………………………………………………………………………...243
Figure (7.8): Effects of exposure to FAF-HSA or 𝜆-LC on C3 protein production from
HK2 (+/-GF) cells……………………………………………………………………..245
Figure (7.9): Effects of exposure to FAF-HSA or 𝜆-LC on FB protein production from
HK2 (+/-GF) cells……………………………………………………………………..246
XVII
Figure (7.10): Juxtaposition of mRNA and protein for AP components (C3, FB, P and
FH) from HK2 (+/-GF) stimulated with FAF-HSA and 𝜆-LC for 24 and 72h………..248
Figure (7.11): Time course of H2O2 generation in HK2 (+/-GF) cells………………..253
Figure (7.12): Effect of FAF-HSA or 𝜆 -LC on H2O2 production by HK2 (+/-GF)
cells……………………………………………………………………………………254
Figure (7.13): The human kidney biomarker array detects multiple analyses cell culture
lysates samples………………………………………………………………………..262
Figure (7.14): Densitometric intensity for Western blot semi-quantitative analysis of
TFF3 production from stimulated HK2-GF cell lysates; cells stimulated with FAF-HSA
(5mg/ml) or 𝜆-LC (1 or 5 mg/ml) for 72h.……………………………………………264
Figure (7.15): The effects of 𝜆-LC and FAF-HSA on TFF3 production by HK2 cells
(+/-GF)………………………………………………………………………………...265
Figure (7.16): Compilation of proteins detected by proteome profile human kidney
array, which are differentially influenced by 𝜆-LC and FAF-HSA…………………...266
Figure (7.17): The biomarkers were measured by proteomic profile assay that might
have a role in the process of PTECs injury in our protein overload condition………..282
Figure (8.1): Hypothetic signal pathways of proximal tubule cells in response to
overload 𝜆-LC…………………………………………………………………………287
Figure (8.2): Hypothetic signal pathways of proximal tubule cells in response to
overload FAF-HSA……………………………………………………………………289
XVIII
LIST OF ABBREVIATIONS
AKD Acute Kidney Disease
AKI Acute Kidney Injury
ATP Adenosine Triphosphate
AP Alternative Pathway
𝛽2m Beta 2 Microglobulin
bp base pair
CKD Chronic Kidney Disease
C3 Complement component 3
CYR61 Cysteine-rich angiogenic inducer 61
dH2O Distilled water
ELISA Enzyme Linked Immunosorbent Assay
EGF Epidermal Growth Factor
EGFR Epidermal Growth Factor Receptor
FAF-HSA Fatty Acid Free- Human Serum Albumin
FB Factor B
FH Factor H
FP Factor P
FLC Free Light Chain
GST Glutathione-S-transferase
GSK-3 Glycogen synthase kinase-3
g Gram/gravity
h Hour
HBSS Hank's Balanced Salt Solution
HEK293 Human Embryonic Kidney 293
XIX
HK2 Human Proximal Tubular Cells without EGF cocktail
HK2-GF Human Proximal Tubular Cells with EGF cocktail
HK2 (+/-GF) Human Proximal Tubular Cells with and without EGF cocktail
H2O2 Hydrogen Peroxide
Ig Immunoglobulin
IL-6 Interleukin-6
IL-8 Interleukin-8
IL-10 Interleukin-10
IPTG Isopropyl 𝛽-D-thigalactpyranoside
𝜅 Kappa
KIM-1 Kidney Injury Molecule-1
kDa Kilo Dalton
LDH Lactate Dehydrogenase
𝜆-LC Lambda Light Chain
LDL-R Low-Density Lipoprotein Receptor
LRP-1 Low-Density Lipoprotein like Receptor Protein-1
LB Luria Broth
MMP-9 Matrix MetalloProteinase-9
Meg-CT Megalin Cytoplasmic Tail
mRNA messenger Ribonucleic Acid
𝜇l microliter
mg milligram
ml milliliter
min minutes
MAPK Mitogen-Activated Protein Kinases
MCP-1 Monocyte Chemoattractant Protein-1
mPTEC mouse Proximal Tubular Epithelial Cells
XX
MM Multiple Myeloma
ng nanogram
NGAL Neutrophil Gelatinase-Associated Lipocalin
OK cells Opossum Kidney
OD Optical Density
PI3K Phosphoinositide 3-Kinase
PBS Phosphate Buffered Saline
PDBU Phorbol ester 12,13-dibutyrate
PKB Protein Kinase B
PKC Protein Kinase C
PTEC Proximal Tubular Epithelial Cells
ROS Reactive Oxygen Species
RT-PCR Reverse Transcription Polymerase Chain Reaction
RT-qPCR Reverse Transcription Quantitative Polymerase Chain Reaction
rpm revolutions per minute
RT Room Temperature
sec second
TSP-1 Thrombospondin-1
TGF-𝛽 Transforming Growth Factor-beta
TFF3 Trefoil Factor 3
TNF-𝛼 Tumor Necrosis Factors-alpha
TNF-R Tumor Necrosis Factors Receptor
VCAM-1 Vascular Cell Adhesion Molecule-1
V Volts
v/v Volume/Volume
w/v Weight/Volume
1
Chapter One-Introduction
2
1. Why is my urine foamy?
It is one of the questions that people often ask; normally, urine does not appear foamy.
Foamy or bubbly urine could be normal or abnormal. There are several causes for normal
foamy urine such as rapid urination, concentrated urine and dehydration. However, it could
be proteinuria (proteins in urine), which is abnormal and a sign of kidney problems (New
Health Guide, 2014).
1.1 The Epidemiology of Renal Failure:
Kidney diseases are a worldwide health problem (Levey et al., 2007) and cause significant
morbidity and mortality (Fearn & Sheerin, 2015). 8-16% of the population worldwide is
affected by chronic kidney disease (CKD) (Jha et al., 2013). In 1990 CKD was ranked 27th
in the list of causes of total number of deaths worldwide according to a Global Burden of
Disease study (2010), however, it rose to 18th in 2010. It is estimated that one in four
women and one in five men have CKD in people aged between 65 and 74 worldwide
(National Kidney Foundation, 2015).
The early diagnosis of CKD can lead to slow, stop or treat the progression of kidney
disease. However, if the patient is in the end-stage kidney disease (ESKD), that means the
patient need kidney dialysis or kidney transplantation, which is called renal replacement
therapy (RRT), but these RRT are not available for all of the patients (Coresh & Jafar,
2015). This is because the treatment of kidney disease is costly and expensive. The NHS
Kidney Care in England costs more on CKD than cancer disease like breast and lung
(National Kidney Foundation, 2015). For example, NHS in England spends ~£1.44 billion,
which is (~1.3%) of the total NHS budget on CKD treatment (Evans & Taal, 2011).
3
Worldwide, only a quarter to a half of CKD patients needing RRT received it in 2010, and
~92% of them resided in high to high-middle income countries like the USA and Japan, and
just ~7% in low to low-middle income countries such as Asia and Africa (China, Indonesia
and India), which are home to half of the world’s population (Coresh & Jafar, 2015).
To minimise the development and progression of kidney disease, and also to reduce the
high amount that countries spend on CKD treatment, focus is on the risk factors that are
associated with increasing the rate of CKD progression. In addition, the goal is to decrease
the number of annual deaths caused by CKD, in 2010 the rate was 16.3 per 100,000 (Jha et
al., 2013). Risk factors for CKD development can be divided into two groups: initiating
factors and perpetuating factors. The initiating factors lead to increasing the risk of
developing CKD, such as high normal urinary albumin, nephrotoxins and diabetes, but the
perpetuating factors increase the risk of CKD and lead to ESKD like proteinuria,
nephrotoxins, cardiovascular disease, hypertension and acute kidney injury (AKI) (Evans &
Taal, 2011). The reduction of CKD risk factors has a positive impact on slowing the
progression of the kidney damage that leads to kidney failure and death (Levey & Coresh,
2012).
1.2 Kidney Diseases:
1.2.1 Acute and Chronic Kidney Diseases:
There are two main causes of elevated urinary protein excretion in patients with kidney
damage: the primary renal diseases affect the renal function and cause kidney failure, such
as membranous nephropathy and focal glomerulosclerosis diseases. However, the
secondary renal diseases (systemic diseases) are diseases leading to develop renal damage
in several weeks or several years, so, the kidney diseases come from and following the
systemic diseases such as diabetes, HIV-associated nephropathy and
immunoglobulinpathay (Schena et al., 2001).
There are two types of kidney diseases, chronic and acute. Around 13-18% of people suffer
from AKI. It is rapid damage and loss of kidney function, which occurs as result of another
4
serious diseases such as diabetes, dehydration and infection. In addition, patients with long
time CKD can develop AKI (NHS, 2014).
The definition of CKD means disorders in kidney structure and function. The important
sign of the presence of kidney damage is proteinuria, and for the decrease of kidney
function it is the glomerular filtration rate (GFR) for 3 months. Depending on the GFR, the
CKD is classified into 5 stages (Levely & Coresh, 2012). The stages go from G1 to G5. G1
and G2 with a normal to mild decrease in GFR indicate the patient is at low risk of CKD;
G3 with a moderate to severe decrease in GFR will increase the risk of CKD; G4 with a
severe decrease in GFR indicates the patient will be at high risk of CKD and finally, G5
patients have a very high risk of CKD and kidney failure (Said et al., 2015). Standard
determination of GFR by creatinine clearance becomes unreliable as CKD progresses.
Also, albuminuria is classified into 3 stages from A1 to A3. A1 has a normal to mild
increase in albuminuria with a low risk of CKD; A2 shows a moderate increase with a
higher risk of CKD, and lastly A3 has a severe increase with a very high risk of CKD and
kidney failure (Said et al., 2015). Several experiments and clinical studies found that
proteinuria was involved in the pathogenesis of kidney disease progression. Population
epidemiology studies discovered that there was a relation between the increase in
albuminuria and mortality with kidney disease (Levely & Coresh, 2012).
1.2.2 Nephropathies of Systemic Diseases:
The nephropathies of systemic diseases, classified in six groups, have adverse renal effects
(Williams & Mallick, 1994) (Table 1.1).
5
Groups
A. Metabolic (ex. Diabetes mellitus).
B. Vasculitic (ex. Systemic lupus erthematosus (SLE)).
C. Dysproteinaemic (ex. Multiple Myeloma).
D. Haematuric (ex. IgA nephropathy).
E. Thrombomicroangiopathic (ex. Hemolitic uraemic syndrome (HUS).
F. Miscellaneous (ex. Infectious bacterial endocarditis hepatitis B).
Table (1.1): Classification of systemic diseases that have adverse renal effects.
1.2.3 Dysproteinemic:
Dysproteinemia is abnormal excessive production of immunoglobulin (Ig) molecules by
plasma B-cells. The common Ig fragment produced is a free monoclonal light chain that
might be pathogenic and associated with kidney damage development (Markowitz, 2004
and Williams & Mallick, 1994).
There are three main dysproteinemia diseases: Multiple Myeloma, Waldenstrom
macroglobulinemia and Cryoglobulinamia (Williams & Mallick, 1994) (Table 1.2).
6
Dysproteinemia Diseases Renal complication
(A) Multiple Myeloma involves
the production of any
monoclonal Ig (IgG, IgA,
IgD and IgE) or free light
chain (FLC).
(B) Waldenstrom’s
macroglobulinemia involves
the production of
monoclonal IgM.
(C) Cryoglobulinamia, has three
types: (I) Any monoclonal
Ig (IgG, IgA, IgD and IgE)
or free light chain (FLC),
(II) Essential mix polyclonal
IgG and monoclonal IgM,
(III) Polyclonal IgG or IgM.
(A) Myeloma
nephropathy, Light
chain deposition
(LCD), Amyloidosis,
or Fanconi syndrome.
(B) Glomerular hyaline
thrombi or Hyper
viscosity syndrome.
(C) Proliferative
glomerulonephritis and
Glomerular hyaline
thrombi.
Table (1.2): Main types of dysproteinemia diseases and renal complications.
1.3 Multiple Myeloma:
Multiple Myeloma (MM) is a blood cancer disease that leads to dividing plasma B cells
over and over in unregulated way. Normally, the bone marrow produces plasma B
7
lymphocyte cells, which is type of white blood cells produce normal antibody Ig to help in
fighting infection (Male, 2004). As shown in (Table 1.2) in MM, plasma B cells (myeloma
cells) produce a high concentration of monoclonal Igs or free light chains in Kappa (𝜅) or
Lambda (𝜆) forms (Williams & Mallick, 1994 and Kuby, 1997).
According to Cancer Research UK in 2012 ~ 114,000 patients were diagnosed with MM
worldwide, and 80,000 died. Kidney injury is a common complication of patients with MM
and causes an increase in mortality (Heher et al., 2013).
1.3.1 Myeloma Nephropathy:
The presence of light chains in urine is a sign of myeloma kidney as in Bence-Jones
Proteins. The myeloma kidney results from tubulointerstitial damage caused by monoclonal
of light chains (Williams & Mallick, 1994), cast nephropathy or a combination of both
(Hutchison et al., 2012).
1.3.2 Cast nephropathy:
Cast nephropathy is cast formation by precipitation of FLCs in the lumen of the distal
nephron, which leads to an increase in the pressure on PTCs and reduces the glomerular
blood flow to nephrons and causes inflammation and fibrosis (Hutchison et al., 2012). Cast
generates with excessive or very low concentrations of FLCs conditions (Kapoulas et al.,
2015). Patients with cast nephropathy have advanced light chain myeloma. The factors
leading and contributing to cast formation are many, including the type and the
concentration of light chains, dehydration and tubular flow rate (Korbet & Schwartz, 2006).
Cast nephropathy in acute kidney injury can be precipitated by dehydration and
hypercalcemia; acute tubular necrosis and tubular atrophy might also exist (Kapoulas et al.,
2015).
8
1.3.3 Fanconi syndrome proximal tubulopathies:
Tubular injury is one of the results of light chain type and dose dependent toxicity to PTCs
(Korbet & Schwartz, 2006). The direct toxic effect of monoclonal-FLC causes proximal
tubule fanconi syndrome (FS), which leads to aminoaciduria, glycosuria and bicarbonate
wasting (Williams & Mallick, 1994). FS is associated with crystalline deposits intracellular
in PTCs by the deposit of 𝜅-LC (Kapoulas et al., 2015).
1.3.4 Amyloidosis:
When proteins accumulate in organs like kidney or liver, amyloidosis occurs. It occurs in
three different types: primary, secondary, and familial forms. The type depends on the
cause of the amyloidosis and the type of the protein that accumulated in the organ. The
most common form of amyloidosis is the primary, which is related to MM. It is caused
when FLCs accumulate in the kidney. Secondary amyloidosis is associated with chronic
inflammatory diseases like rheumatoid arthritis. Treating patients with this type of
amyloidosis can stop or slow the progression of amyloidosis. The last type, hereditary or
familial amyloidosis, is rare. It occurs when the patient has a mutation of a protein, which
leads to a life-long production of this protein, and the consequence of this is the protein
accumulates in the organ (Williams & Mallick, 1994 and Schena et al., 2001).
1.3.5 Light-chain deposition disease:
Light-chain deposition disease (LCDD) is plasma cell dyscrasia. It is a monoclonal LC
deposition disease in an organ. It is a rare disease. 10% of MM patients might have LCDD
in kidney glomerular and tubular (Williams & Mallick, 1994 and Leung, 2007).
9
1.4 Monoclonal FLC and Myeloma Kidney:
Kidney failure is a consequence of MM diseases. Between 20-40% of MM patients have
kidney injury (Dimopoulos et al., 2008). However, from a clinical point of view, not all
monoclonal FLCs are nephrotoxic because a number of MM patients with high
concentration of urinary FLCs (proteinuria) do not develop kidney damage, and they
explained that the toxicity of FLC to induce kidney injury depends on FLC structure
specifically the V region and the environmental factors like pH and urea concentration
(Mussap & Merlini, 2014).
1.4.1 Immunoglobulin and Light Chain Structure:
Igs are glycoproteins with a Y-shaped structure. The basic structure of Ig consists of two
identical heavy polypeptide chains, each one (50 kDa), and two identical light chains each
one (25 kDa). The heavy chains form the Fc fragment and the light chains contribute to the
Fab fragment (Male, 2004 and Kuby, 1997). Fab is the fragment antigen-binding site in Ig,
which the antigen binds to it, and Fc is the fragment crystallizable region that is the tail
region of the antibody, which interacts with the cell surface (Male, 2004).
Each Ig antibody has a 𝜅 or 𝜆 light chains isotype: in human 40% of light chains are 𝜆 and
60% are 𝜅, and there are four types of 𝜆 light chain (𝜆1, 𝜆2, 𝜆3 and 𝜆4) depending on a
minor difference in the amino acid sequences. There are five main heavy chains (isotypes)
(𝜇, 𝛿, 𝛾, 휀 and 𝛼). Each heavy and light chain consists of a variable (V) and constant (C)
region and each region consist of 100-110 amino acids. The constant region is responsible
for the type of the antibody, such as when heavy chain is the class of antibody IgG (Kuby,
1997) (figure 1.1).
10
1.5 Kidney, anatomy and function:
The kidneys are two bean shaped organs located at the rear of the abdominal cavity. In
humans, each kidney is approximately 12 cm long, 7 cm wide, 4 cm thick and weight about
115-170g (Lote, 1994). Each kidney consists of a renal capsule, cortex and medulla. The
cortex and medulla contain millions of tiny structures called nephrons, which are the basic
units of operation of the kidney. The nephron consists of the renal corpuscle, which
consists of glomerular capillaries and bowman’s capsule, proximal tubules and distal
tubules in the cortex and the loop of henle and collecting duct in the medulla (Koeppen &
Stanton, 2012).
HC
LC
Fab
Fc
Coo- Coo-
NH3+
NH3+
NH3+
NH3+
VH VH
VL VL
CL
CL
CH
CH
CH
CH
CH
CH
𝝀 or 𝜿
𝝁, 𝜹, 𝜸, 𝜺 𝐨𝐫 𝜶
Figure (1.1): The basic structure of immunoglobulin. LC: Light chain, HC: Heavy
chain, V: Variable, C: Constant, Fab: Fragment antigen binding and Fc: Fragment
crystallizable.
11
The kidney plays essential regulatory roles such as regulation of blood pressure and
elimination of waste substances like urea. It has an important role in the reabsorption of
water, glucose and many other nutrients. In 24h ~180 L of plasma is filtered by the kidney
(Koeppen & Stanton, 2012).
The proteins and other large molecules with a molecular-weight ≥ 70 kDa cannot pass
through the glomerular filter into bowman's capsule and then to the tubular lumen, they are
filtered out of the glomerulus by an ultrafiltration process that returns molecules like
albumin (69 kDa) to the capillaries. However, all other molecules with low molecular
weight (<70 kDa) pass into the nephrons. The substances, which the body needs to retain
are filtered and reabsorbed in the proximal tubular cells and returns into the bloodstream by
the endocytosis process (Lote, 1994).
1.6 Protein uptake and Endocytosis:
The mechanisms of proteins to induce kidney damage (toxic nephropathy) are different;
kidney damage might occur due to glomerular injury, increasing the quantity of proteins in
blood and increasing the reabsorption in the kidney, low reabsorption proteins at proximal
tubule cells or toxicity of filtrated proteins. All of these reasons may affect the kidney
functioning and lead to presenting a cocktail of macromolecules that are abnormally filtered
by the glomerulus and present in the urine as proteinuria like albumin or light chain
(Abbate et al., 2006 and Caruso-Neves et al., 2005 and Toblli et al., 2012) .
1.6.1 Proteinuria:
Proteinuria is a sensitive marker for kidney progression function. It is one of the major
health care problems, as hundreds of people world wiled suffer from proteinuria (Toblli et
al., 2012). Normally, more than 0.01g/100ml proteins in urine are a hallmark of progressive
renal dysfunction (Lote, 1994).
12
In normal condition, the permeable capillaries in glomerulus are the effective barriers for
protein filtration with high molecular weight like albumin (65kDa) and the smaller proteins
such as immunoglobulin (25kDa) are reabsorbed at the proximal tubule. The
pathophysiological mechanism for proteinuria can be classified to glomerular proteinuria
and tubular proteinuria (Carroll, 2000).
Albumin is the most abundant plasma protein: it constitutes of 60% of the total. It is
synthesized in the liver. It is an anionic, flexible, heart-shaped molecule (Lote, 1994). There
are several functions that have been ascribed to this protein, including the maintenance of
the blood volume, acid/ base buffer functions, antioxidant functions and transportation of a
number of different substances like fatty acids, ions, hormones, and vitamins. Both serum
and urinary albumin levels are important prognostic indicators in renal disease (Birn &
Christensen, 2006). Approximately 3.3g of albumin are filtered daily in human kidneys.
The proximal convoluted tubule reabsorbs 71%, the loop of henle and distal tubule 23%,
and the collecting duct 3% of the glomerular filtered albumin (Tojo & Kinugasa, 2012).
The urinary albumin excretion classified as normal is (< 15mg/24h), high normal is (15-
30mg/24h), microalbuminuria is (30-300mg/24h) and macroalbuminuria is (>300mg/24h)
(de Jong & Curhan, 2006). Appearing high concentration of albumin in urine is mostly
because of glomerular abnormalities alter the permeability of the glomerular basement
membrane (Carroll, 2000).
However, the present of low molecular weight proteins in urine is commonly occurring
with tubulointerstitial disease, which prevents the proximal tubule to reabsorb the proteins.
Also, it can be because of protein overflow exceed the ability of the proximal tubules to
reabsorb filtered proteins (Carroll, 2000).
Most often, the tubular proteinuria occurs in multiple myeloma as a result of the FLC
immunoglobulin fragments (Bence Jones Proteins) overproduction.
FLC proteinuria is a sign in MM patients for kidney dysfunction. In a healthy person,
~500mg of FLC is produced daily and most of that is reabsorbed by the kidneys, with only
1 to 10mg/day appearing in the urine. However, in MM, the level of FLC raise sometimes
to 100,000 mg/l serum concentration (Basnayake et al., 2010). In MM patients with light
13
chain proteinuria 16% (<1g/day), 47% (1-10g/day) and 63% (>10g/day) appear in urine
(Korbet & Schwartz, 2006).
Increasing the level of FLC in serum leads to an increased burden of kidney reabsorption,
allowing FLC to travel to distal nephron to complete the journey and appear in urine
(proteinuria) and end up in kidney failure (figure 1.4) (Basnayake et al., 2010).
1.6.2 PTCs and Endocytosis process:
Proximal tubular cells (PTCs) are the most abundant cell type in the kidney (Hutchison et
al., 2012) . They consist of two parts, the convoluted and straight part, and brush border,
which consist of millions of microvilli to increase the availability of the luminal surface
area for absorption of the tubular fluid. Proteins are essentially reabsorbed ~30g/day of
proteins enter the kidneys and most of them are reabsorbed in the proximal tubules by
receptor mediated endocytosis (Lote, 1994). Clathrin mediated endocytosis is a process
involves ligand like (albumin or light chain) that bind to a specific binding site in a receptor
such as megalin in the apical membrane in the proximal tubules cells; this complex is
internalized by invagination of the plasma membrane caused by adaptor molecule-mediated
formation of a cytoplasmic coat. The internalization is followed by cytoplasmic coat
dissociation of the invaginations from the plasma membrane, forming vesicles, followed by
acidification of the intravesicular lumen and the dissociation of the ligand from the
receptor. Finally, the receptor is recycled back to the luminal membranes through dense
apical tubules, and the ligand is delivered to lysosomes and cleaved to amino acids (figure
1.2) (Lote, 1994 and Birn & Christensen, 2006).
14
Figure (1.2): Megalin-mediated endocytosis and recycling to the cell surface.
Ligand binds to receptor Ligand
Megalin Receptor Endocytosis
Ligand and receptor separate
Receptor in vesicle
moves
to the cell
membrane
Recycled receptor 8
5
4
3 2
1
7
6
Endocytic vesicle
Ligand goes to lysosome degradation
to amino acid and reabsorbed
Clathrin- coated pit
15
1.6.3 Megalin:
Megalin, initially described as gp330 (Christensen & Birn, 2001), is a 600kDa glycoprotein
and belongs structurally to the low-density-lipoprotein-receptor (LDL-R) family, consisting
of three major domains: a large extracellular domain, small transmembrane domain, and
intracellular domain (cytoplasmic tail) (figure 1.3) (De et al., 2014). The megalin structure
is described in chapter 6.
It scavenges filtered proteins and transports them by endocytosis process. It is expressed in
epithelial cells of the small intestine in the visceral yolk sac, and the cytotrophoblast of the
placenta and is abundantly expressed in the apical membrane of proximal tubule cells
(PTCs). In the kidney proximal tubule, megalin is localised to the brush border, coated pits
and endocytic vesicles. The complete cDNA sequence was characterised for human
megalin and the gene located to chromosome 2q24-q31 (Christensen & Birn, 2001 and
Verroust & Christensen, 2002).
It is a multiligand endocytic receptor that mediates uptake of extracellular ligands like
vitamins-binding protein (Vitamin D-binding protein), Apolipoproteins (Apolipoproteins
B), low-molecular-weight peptides and hormones (Insulin, β 2M and EGF), drugs
(Aminoglycosides), enzymes and enzyme inhibitors (Lipoprotein Lipase) and proteins such
as Ig light chain and albumin (Christensen & Birn, 2001 and Verroust & Christensen,
2002).
1.6.3.1 Megalin Signalling Functions:
The megalin cytoplasmic domain contains several regions, including many Src homology 3
and one Src homology 2 recognition sites and also NPXY motifs. These regions suggest
possible signalling function and are involved in the endocytosis process (Christensen &
Birn, 2001).
16
1.6.3.2 Megalin mutation and human diseases:
There are two rare diseases that are associated with megalin mutation, Donnai-Barrow
syndrome (DBS) and facio-oculo-acoustico-renal syndrome (FOAR). They are inherited
disorders affect in several organs in the body. Patients with either of these two diseases will
suffer from developmental delay, proteinuria, hearing loss and ocular abnormalities. This
reflects the important role of megalin in organs development like brain, eye, ear and kidney
(Marzolo & Farfán, 2011 and Pober et al., 2009).
1.6.3.3 Description of megalin transgenic mouse:
The functions of megalin are deduced from the study of megalin-deficient mice. Megalin-
deficient mice generated by gene targeting exhibit severe forebrain abnormalities and lung
defects. Most of them die perinatally, and only 1 out of 50 survives to adulthood. In
general, they had normal kidneys; however, ultra-structurally the proximal tubule cells are
characterized by a loss of apical endosomes, coated pits, and recycling dense apical tubules.
This supports the understanding that megalin is essential for these processes.
In addition, the megalin-deficient mice excrete an increased amount of low-molecular-
weight plasma proteins, such as light chain in urine; this is a result of defective tubular
reabsorption, due to the absence of immune detectable protein in the proximal tubule cells
of deficient mice. No changes in water, glucose and amino acids transport have been found
in these mice (Christensen & Birn, 2001).
1.6.4 Megalin-Associated Molecules:
1.6.4.1 Cubilin:
Cubilin multiligands glycoprotein receptor, also named gp280. It is a 460 kDa and consist
of ~3,600-amino acid protein consisting of a 110 amino acid N‐ terminal stretch, followed
by 8 EGF and 27 CUB (Complement C1r/C1s, Uegf and Bone morphogenic protein‐ 1)
17
domains, with no apparent cytoplasmic domain (figure 1.3) (Verroust & Christensen,
2002). It is highly expressed in the visceral yolk sac, the epithelium of the small intestine
and in the PTCs for normal reabsorption of proteins. Albumin and light chain are ligands to
cubilin and made cubilin–ligand complexe to be reabsorbed in PTCs but this complex
needs megalin (megalin-cubilin complex) to be internalised and also to recycle cubilin
because cubilin does not have a transmembrane domain to engage in endocytosis
(Christensen & Birn, 2001). Immunomorphological and biochemical data suggest that the
internalisation of cubilin is, at least in part, carried out by megalin (Verroust & Christensen,
2002).
Although it has been identified that fewer ligands bind to cubilin compared with megalin,
still it was identified as an important receptor in tubular protein reabsorption. This is due to
some cases with intense proteinuria that were the result of mutations in the cubilin gene.
For example, in human mutations of cubilin lead to Imerslund-Gräsbeck syndrome, which
is characterised by vitamin B12 deficiency and significant proteinuria. Also, in animal
studies with a lack of cubilin expression on apical in PTC, appreciable proteinuria (Baines,
2010).
18
1.6.5 Non Megalin/Cubilin mediated up take of protein in PTCs:
1.6.5.1 Cluster of differentiation 36 (CD36):
Another receptor, CD36, exists for protein handling in PTCs and different in vivo, in vitro
and clinical samples were examined to investigate if CD36 binding protein and
reabsorption in PTCs.
CD36 is an (88kDa) glycoprotein. It is a class B scavenger receptor, present in glomerular
cells, endothelial cells and PTCs (Yang et al., 2007 and Baines et al., 2012).
Renal biopsy tissue obtained from adult patients with membranous nephropathy or focal
segmental glomerulosclerosis with heavy proteinuria showed a significant increase in
CD36 expression in PTCs. In vitro, exposure of PTCs to several albumin concentrations
Figure (1.3): Schematic structures of megalin and cubilin receptors in relation to
the plasma membrane
Luminal
Plasmamembrane
COOH
Megalin
Transmembrane
domain
NH2
Cubilin
CUB
domain
EGF-type
repeat
Cytoplasmic tail
NH2
Extra
cellular
Domain
19
showed an increase in CD36 expression. Also, CD36-transfected PTCs showed enhanced
the binding and uptake of albumin, and using a CD36 inhibitor abrogated this effect.
However, blocking megalin did not. In vivo, CD36 null mice showed significant increase
in urinary protein-to-creatinine ratio and albumin-to-creatinine ratio. Although, mouse
PTCs from WT and CD36 null mouse showed comparable megalin expression, and CD36
expression from WT and, as expected, absence in CD36 null mice (Baines et al., 2012).
Thus, CD36 is involved in albumin uptake in PTCs and might have a potential role in
proteinuric nephropathy.
20
Figure (1.4): Mechanism of multiple myeloma and kidney failure. FLC: Free light chain and PTCs: Proximal tubular cells.
Multiple Myeloma
Patient
Bone marrow
Abnormal Plasma cells
(myeloma cells)
Increase the endocytosis via Megalin
receptor
Damage PTCs
Cells
PTCs
Over filtration in Kidney
Glomerular
Proteinuria and Kidney failure
FLC
Megalin
Bruch Border
21
1.7 Signalling role of megalin in PTCs toxicity:
1.7.1 Signalling pathway regulates protein endocytosis in PTCs:
Different glomerular filtrated proteins are reabsorbed in PTCs by endocytosis process, with
receptor-mediated mechanism involves clathrin. Receptors mediated endocytosis like
megalin and cubilin. Many components are involved in endocytosis to regulate the process
such as G-proteins that are abundantly expressed in PTCs (Caruso-Neves et al., 2005 and
Baines, 2010).
There are two classes of G proteins depending on the function: the monomeric small
GTPases and heterotrimeric G protein complex. The heterotrimeric G protein complex is
activated by G protein-coupled receptors. Heterotrimeric G protein complex consists of two
protein subunits 𝛼 and 𝛽𝛾 complex. G𝛼 has been grouped into four classes Gs, Gi, Gq, and
G12. They are grouped depending on their sequence and gene structure (Hurowitz et al.,
2000). PTCs have a large amount of G𝛼i3 in their apical membranes when the endocytosis
process occurs, which could play a role in the regulation of endocytosis of macromolecules
like albumin. For example, albumin uptake was increased with over-expression of G𝛼i3,
however, inhibiting G𝛼i3 showed a decrease in the process in OK cells (Brunskill et al.,
1996).
Endocytosis activates the signalling pathway that is controlled by different kinases
(Caruso-Neves et al., 2005). Phosphoinositide 3-kinase (PI3K) is a lipid kinase that plays a
role in many signalling pathways including regulating cell survival, intracellular trafficking
and cell growth. It is involved in the endocytosis process in generating vesicles from
plasma membrane (Sauvonnet, 2013) PI3K has an important role in receptor-mediated
endocytosis process. PI3K is composed of a catalytic p110 subunit and a regulatory p85.
The activation of PI3K occurs via many receptors tyrosine kinases like EGFR, which
augments macromolecules endocytosis. Inhibiting PI3K by wortmannin and LY294002
inhibited the receptor-mediated endocytosis of albumin in PTCs, which means PI3K has a
regulation role (Brunskill et al., 1998). Activation of PI3K leads to Akt/PKB (Sauvonnet,
2013).
22
Protein kinase B (PKB)/Akt belongs to the ACG family that is a serine/threonine specific
protein kinase (Caruso-Neves et al., 2005). PKB/Akt has a role in several processes such
as cell proliferation, apoptosis and cell survival (Sauvonnet, 2013). Both serine and
threonine phosphorylation are required for PKB/Akt activation Both PI3K and PKB/Akt
are regulators for endocytosis (Caruso-Neves et al., 2005). PKB/Akt activates MAPKs
(Baines, 2010).
Mitogen-activated protein kinases (MAPKs) are components that have a role in cell growth,
proliferation and transformation. This kinase cascade consists of three-kinases, which are
MEK kinase that is phosphorylated MAPK and leads to extracellular-signal-regulated
protein kinases (ERKs) activation. Albumin activated ERKs, for example, stimulating
PTCs with different concentration of albumin (1-10mg/ml) showed dose dependence in
EKR activation. This finding suggests a correlation between albuminuria and cell growth
due to at the same time the ERK activation leads to inhibit c-Jun N-terminal kinases (JNK),
which inhibits cell apoptosis (Dixon & Brunskill, 2000 and Baines, 2010). MAPK
activation leads to inhibit glycogen synthase kinase 3 (GSK-3).
Other proteins kinases regulating the endocytosis process are protein kinase A (PKA) and
protein kinase C (PKC). However, they have opposite role by inhibiting endocytosis
(Caruso-Neves et al., 2005). They are serine/threonine kinases (Baines, 2010). Stimulating
PTCs with albumin stimulated PKC activity and inflammatory cytokines; so, inhibiting
PKC by activated MAPK shows the opposite effect (Morigi et al., 2002) and Cabezas et
al., 2011).
Glycogen synthase kinase 3 (GSK-3) is a serine/threonine protein kinase. It has a role in
several signalling pathways such as gene cell cycle progression, cell differentiation and
epithelial cell function and survival. GSK-3 exists in two isoforms: GSK-3α and GSK-3β.
Previous studies have found that GSK-3 inhibition has a protective role in acute kidney
injury. GSK-3 is inhibited by phosphorylation of serine 9 of GSK-3β and serine 21 of
GSK-3α (Rao, 2012). GSK-3 inhibitor have been successfully trialled in renal diseases
(Soos et al., 2006) and shown to improve a range of renal conditions, which have a
component of proteinuria (Obligado et al., 2008).
23
1.7.2 Megalin phosphorylation and PTCs toxicity:
Megalin receptor is a mediator of the endocytosis process and has a signalling function that
might be involved in tubular toxicity in proteinuric condition. The megalin cytoplasmic tail
(Meg-CT) is longer than other LDL-R receptors. Megalin is involved in signalling and is
phosphorylated by different kinases like PKC. The phosphorylation occurs in serine, and
this phosphorylation has an effect on regulation megalin receptor recycling to the cell
surface. For example, high albumin concentration decreased megalin expression in PTECs,
PKC levels were reduced and cells were apoptotic (Baines & Brunskill, 2008).
Previous studies showed that Meg-CT is phosphorylated in PPPSP motif by GSK-3; the
function of this motif is related to control megalin recycling from the endocytosis. The
phosphorylation occurs independent of the type of ligand binding to megalin (Yuseff et al.,
2007).
Dab2 is cytosolic adaptor protein that binds to Meg-CT. It has an important role in megalin
expression and function (Marzolo & Farfán, 2011). Losing Dab2 leads to loss of the cell
surface polarity of megalin (Yang et al., 2007). For example, in vivo study Dab2 knockout
mice showed the expression of protein in urine, and reduction in megalin expression to the
apical surface of PTCs (Morris et al., 2002).
In summary, PTCs toxicity in proteinuric conditions might come from the phosphorylation
of Meg-CT and reduction of megalin recycling to the cell surface.
1.8 Proteinuria and Proximal Tubular cells Toxicity:
Dysfunction in filtration or reabsorbed processes in kidneys for many different reasons are
leading to proteinuria by three mechanisms contributing to tubular damage and initiating
interstitial pathological changes due to PTCs being the main cell type in kidneys, also, their
unique position between the tubular lumen and surrounding interstitium (Wang et al.,
1997): (i) Excess endocytosis of filtered protein could stimulate cytokine and chemokine
24
secretion by PTC, and that initiates inflammation and fibrosis, (ii) The toxic effect on PTC
might present in the proximal tubular filtrate proteins like complement components, (iii)
The excessive reabsorption of filtered proteins by PTC as a result of glomerular damage
may result in cell stress and generate reactive oxygen species (Baines, 2010 and Hutchison
et al., 2012).
1.8.1 The effect of proteinuria on PTCs viability:
Previous studies investigated the effect of protein overload on PTCs growth and viability
like albumin because it is the main filtered protein in urine of proteinuric patients. For
example, PTCs stimulated with albumin concentration between 10-100 mg/ml showed a
decrease in cells viability and induced apoptosis (Caruso-Neves et al., 2005) . In another
example, exposure of OK cells to high concentration of protein has a direct toxic effect on
PTCs viability (Baines, 2010).
1.8.2 Inflammatory cytokines/chemokines and fibrogenic mediators:
The toxicity of protein overload on PTCs seems to be occurring after endocytosis process
through the endocytic receptor megalin leading to inflammatory cytokines and chemokines
production from PTC. Increase the cytokines such as interleukin-6 (IL-6) and chemokines
like interleukin-8 (IL-8) and monocyte chemo attractant protein (MCP-1) production in
PTCs in patients with proteinuria has been proposed as one of the major mechanisms
contributing to tubular injury and progressive kidney disease (Sengul et al., 2002).
1.8.2.1 Interlukin-6 (IL6):
IL-6 is glycoprotein (gp130) is one of the main pro-inflammatory cytokines (Scheller et al.,
2011). It is a (26kDa) protein, produced in many kidney cells including glomerular,
mesangial and PTCs (Sengul et al., 2002). IL-6 appears to have as its main function that
25
inducing of acute inflammatory responses (Mäkelä et al., 2004) contributes to proximal
tubular injury after excessive protein endocytosis such as FLCs in MM (Hutchison et al.,
2012) . High IL-6 was detected in plasma and urine in patients with MM disease and renal
transplant rejection (Sengul et al., 2002). Another study was conducted in hospitalised
patients with nephropathia epidemica (NE), one of the most common causes of acute renal
failure and proteinuria with loss of low-molecular-weight proteins like 𝛽2-microglobulin,
indicating tubular injury. The data showed that an increase in urinary and plasma IL-6
excretion, and urinary IL-6 excretion correlated with albumin, IgG, and protein excretion.
The urinary IL-6 excretion level did not correlate with plasma IL-6 levels, which means the
increases in urinary IL-6 excretion, is not caused by the filtration of plasma IL-6 but reflect
the production of IL-6 in dysfunction tubules in kidneys (Mäkelä et al., 2004). Also, the
urinary IL-6 level was measured in patients with IgA nephropathy disease and it was
concluded that the level of urinary IL-6 excretion could reflect the inflammation and
tubular dysfunction (Nakamura, et al., 1995).
In vivo study, transgenic mice with membrane proliferative glomerulonephritis and massive
bone marrow infiltration, they showed many similarities to MM, the IL6 expression level
was increased highly in these mice (Sengul et al., 2002).
The increase proximal tubular production of IL-6 might contribute to the pathogenesis of
tubulointerstitial disease.
1.8.2.2 Interlukin-8 (IL-8):
IL-8 is a pro-inflammatory chemokine responsible for activating T cells and monocytes in
the inflammation site (Tang et al., 2003). The massive reabsorption of proteins like FLCs
and albumin in PTCs induces the release of IL-8 in renal tubular inflammation (Hutchison
et al., 2012). The relation between IL-8 and renal tubular inflammation comes from these
observations: (i) IL-8 made by PTCs (Stadnyk, 1994), (ii) The production of IL-8 in PTCs
can be regulated by several pro-inflammatory cytokines such as TNF-𝛼, (iii) IL-8 urinary
level increase in patients with kidney diseases like IgA nephropathy (Tang et al., 2003).
26
In vivo, the repeated injection of rabbits with bovine serum albumin (BSA) caused
deposition of immune complexes consisting of BSA and rabbit IgG in glomeruli, and the
urinary levels of protein and albumin increased markedly compared with untreated animals.
Injecting rabbits with anti-IL-8 antibody led to normalised urinary levels of protein and
albumin that means IL-8 has a role in progression of proteinuria and kidney nephropathy
(Wada et al., 1994).
Also, immunohistochemistry of IL-8 on renal biopsy derived from human nephrotic
patients with minimal change nephrotic syndrome and hypertensive nephrosclerosis with
proteinuria showed strong IL-8 staining compared with minimal proteinuric control (Tang
et al., 2003 and Abbate et al., 2006) ). Thus, IL-8 has a role in proteinuria and tubular
inflammation.
1.8.2.3 Monocyte Chemoattractant Protein-1 (MCP-1):
MCP-1 is a prototype of the 𝜷 chemokine family. It is chemoattractant for macrophages
and T lymphocytes, which are the predominant inflammatory cells (Wang et al., 1999).
Many evidences suggest that MCP-1 has a role in tubulointestinal inflammation. The
expression of MCP-1 was elevated in renal tubular cells, such as in ischemia, and might
perform as a mediator for inflammation (Wang et al., 1997).
More evidence shows the correlation between proteinuria and the overexpression of
chemokines is available. In vivo, rats with protein-overload proteinuria models with
interstitial inflammation and tubular up-regulated MCP-1. To support the possibility that
MCP-1 is important and has a role in tubularinterstitial inflammation, anti-MCP-1 antibody
therapy to rats with tubulointerstitial nephritis led to reduced macrophage infiltration
significantly and interstitial inflammation and fibrosis and tubular damage (Zoja et al.,
2003 and Abbate et al., 2006) .
Albuminuria, urinary MCP-1 and interstitial macrophage infiltration were measured in
patients with CKD such as light chain nephropathy, IgA nephropathy,
27
ischaemic/hypertensive nephropathy and diabetic nephropathy, the data showed a
correlation between albuminuria, urinary MCP-1, interstitial macrophage infiltration. The
findings support the hypothesis that albuminuria triggers tubular MCP-1 expression and is
one of the important disease progressions in human chronic kidney disease (Eardley et al.,
2006).
From several studies it can be concluded that there was a concomitant up-regulation of pro-
inflammatory MCP-1in tubular epithelial cells with a progressive kidney disease.
1.8.3 Complement components as pathogenic mediators of tubular
toxicity in proteinuria:
Complement system is part of innate immunity. The main functions for the complement
system include protection from foreign pathogens; it also plays immune regulatory roles
like enhancing humoral immunity and modifying T cell immunity. Several studies showed
that the complement system has a pathogenic role in different diseases such as kidney,
inflammatory and autoimmune diseases (Thurman & Holers, 2006). The activation of the
complement system contributes to kidney tubular and interstitial injury through cytotoxic,
pro-inflammatory, and fibrogenic effects.
There are three pathways responsible for complement activation: classical, lectin and
alternative pathways. Several studies of kidney suggested a strong association between
proteinuria and alternative pathway as a mediator of progressive dysfunction, interstitial
fibrosis and tubular damage. In patients with kidney disease and proteinuria, the
complement components can be found in their urine such as diabetic nephropathy, IgA
nephropathy and focal segmental glomerulosclerosis (FSGS) (Fearn & Sheerin, 2015).
This might be because the complement proteins filter in glomerular and enter the tubule, or
it could be due to spill over of complement activated in the glomerulus (Fearn & Sheerin,
2015). Tubular cells produce the major components of alternative pathway, which are
complement component C3, Factor B (FB), Factor H (FH) and Properdin or Factor P (FP)
28
(Peake et al., 1999). Complement activation via alternative pathway has an additional
mechanism, which might contribute to the progression of renal disease. Activating the
alternative pathway on renal tubular epithelial cells led to stimulate pro-inflammatory
cytokines like tumor necrosis factor (TNF-𝛼) and IL-6, and reactive oxygen species, which
led to inflammation (Fearn & Sheerin, 2015). In addition, the local production of C3 by
renal tubule themselves may contribute to tubule injury (Zhou et al., 2001). Uncontrolled
complement activation might contribute to tissue injury (Lenderink et al., 2007).
1.8.3.1 Mechanism of alternative pathway activation and regulation:
The alternative pathway initiates when C3 binds to FB, which is activated by factor D (FD),
forming C3 convertase and generate C3a and C3b. FB cleaves and generates Ba and Bb.
C3b and Bb bind to generating unstable C3bBb.
Properdin of FP has the role to stabilizing C3bBb during the process and generates C3bBb-
P (C3 convertase). The C3bBb-p binds to C3b and generates C3bC3bBb-P (C5 convertase),
then binds to C5b and generates C5b-9 membrane attach complex (MAC), which generate
pores on cell surface and lysis the cell (Thurman & Holers, 2006). The activation of
alternative pathway controls by FH inhibits the alternative pathway C3 convertase. Also,
FH is a cofactor for Factor I (FI), which inactivating cleavage of C3b by decay acceleration
of the C3 convertase (Thurman & Renner, 2011) (figure 1.5).
1.8.3.2 Evidence of complement pathway contributes to induce renal injury:
The complement system plays a role as a pathophysiologic mediator of multiple kidney
diseases in humans (Mathern & Heeger, 2015).
Membranous nephropathy (MN) is a disease causing nephrotic syndrome in adults, and
characterized by a fine granular deposit of IgG with C3 in the peripheral capillary loops. In
MN the data showed complement activation via lectin pathway and MACs were detected in
MN patient’s urine and considered as marker of ongoing injury (Mathern & Heeger, 2015).
29
Another glomerular disease is IgA nephropathy, characterised by IgA deposition. It is
likely mediated by alternative pathway-dependent, antibody initiated complement
activation. Deposits of C3 and C5b-9 were detected in the glomeruli and correlate with
kidney disease severity and prognosis (Mathern & Heeger, 2015).
Monoclonal gammopathy has been associated with the activation of the alternative
pathway. Circulating light chain binds to FH that is responsible for alternative pathway
inhibition, thus over activation of the alternative pathway leads to cells inflammation
(Mathern & Heeger, 2015).
Ischemia-reperfusion injury results from mitochondrial damage or tissue hypoxia leading to
the generation of free oxygen radicals on reperfusion that initiates damage. Ischemia-
reperfusion injury up-regulated the production of complement components in tubular cells;
the local activation via alternative pathway led to inflammation (Mathern & Heeger, 2015).
30
1.8.4 Reactive oxygen species (ROS) and renal tubular injury:
ROS are chemical molecules formed as a natural product of the normal metabolism of
oxygen (Devasagayam et al., 2004). ROS has a role in many physiologic and
pathophysiologic processes. ROS is produced by nicotinamide adenine dinucleotide
phosphate (NADPH) oxidases by catalyzing the transfer of electrons from NADPH to
molecular oxygen via Nox subunit to produce ROS (figure 1.6). ROS has functions in
normal cellular physiology, regulating different biologic processes like cell defense, cell
signalling as second messengers, hormone synthesis, gene expression, cell growth and
apoptosis (Sedeek et al., 2013).
Figure (1.5): Mechanism of activation and regulation of complement alternative
pathway. C3: Complement component C3, FB: Factor B, FD: Factor D, FH:
Factor H, FI: Factor I and MAC: Membrane Attach Complex.
C3
FB FD
C3bB
C3a
C3b-FI
Ba
FP FH
C3bBb-P (C3 Convertase)
C3bC3bBb-P (C5 Convertase)
C3
C3a
C5b-9 (MAC)
C5a
FI
31
ROS plays a role in the pathophysiology of many systemic diseases including hypertension,
diabetes mellitus, infection, environmental toxins; smoking and alcohol consumption
induce oxidative stress in kidney (Ozbek, 2012). In addition, ROS-mediated stresses in a
number of diseases like cardiovascular pathology and immunodeficiency and kidney
diseases. Also, it is an inflammatory mediator (Panday et al., 2014).
In normal conditions ROS produce inactivate. Normally, there is a balance between oxidant
(ROS) and antioxidant defence systems. The antioxidant can be divided into enzymatic
types like glutathione peroxidase and nonenzymatic such as vitamin A, C and E. However,
in pathological conditions, increased the generation of ROS and/or reduction of the
antioxidant defence system leads to tissue damage (Birben et al., 2012).
ROS plays several roles in kidney physiologic processes such as glucose transport;
tubuloglomerular feedback that is a kidney mechanism regulating the glomerular filtration
rate (GFR) and electrolyte transport (Sedeek et al., 2013). However, ROS mediates
complications in kidney diseases by oxidative stress, oxidative stress-related mediators and
inflammation (Ozbek, 2012).
Many evidences demonstrated that renal tubular epithelial cells are capable to produce ROS
and particularly hydrogen peroxide (H2O2) under toxic conditions; hypoxia and protein
overload (Morigi et al., 2002). In protein overload conditions NADPH oxidase is
responsible and required for intracellular H2O2 generation in PTCs because inhibiting
NADPH in PTCs protein overload model by (albumin or IgG) showed reduction in H2O2
generation (Morigi et al., 2002).
In vitro, opossum kidney PTCs exposed to bovine serum albumin led to increased ROS
generation and they concluded that increased formation of ROS as a response to
albuminuria might consequently cause tubulointerstitial damage (Hodgkins & Schnaper,
2012).
32
1.8.5 Autophagy in renal tubular injury:
Autophagy is a Greek word ‘auto’ means self and ‘phagos’ means eat (Takabatake et al.,
2014). Autophagy is a catabolic process. Three types of autophagy have been identified:
macroautophagy, microautophagy and chaperone-mediated autophagy. Macroautophagy is
the major type of autophagy. It induces in response to stress conditions such as cell
starvation, hypoxia, and oxidant injury as an adaptive and protective mechanism for cell
survival (Kaushal, 2012 and Takabatake et al., 2014), but autophagy is able to contribute to
cell death when deregulated such as in cancer diseases (Jiang et al., 2012).
Autophagy formation is divided into four steps. First one is the initiation step that is
initiated by different autophagic protein complexes such as kinase 1 or 2 (ULK1 or ULK2)
complex, the class III phosphatidylinositol 3-kinase complex, Atg12–Atg5–Atg16
conjugation, and lipidation of microtubule-associated protein 1 light chain 3 (LC3). After
that is the nucleation step, which is the formation of the phagophore membrane for
phagophor expansion. Then, the maturation step (elongation and closure) that completes the
NADPH NADP+
O2
H2O2
O2
-
Figure (1.6): H2O2 generation by NADPH.
33
formation of autophagosomes (autophagic vesicles or vacuoles) with the double membrane
being generated. Finally, the autophagosome fuses with lysosome and forms an
autophagolysosome and free amino acid and fatty acid generates. The generated free amino
acids and fatty acids are recycled to synthesize new proteins and bio-energetic supplies of
the cell (figure 1.7) (Benbrook & Long, 2012).
Interestingly, accumulation of evidences from in vivo and in vitro studies demonstrated that
macroautophagy is one of the stress responses of renal tubular cells to acute injury.
Whether autophagy plays a pro-survival or a pro-death role remains very controversial (Liu
et al., 2014).
Autophagy activation has an important role in PTCs, possibly because these tubules contain
an enormous number of mitochondria that provide the energy for the reabsorption
processes that occur in these cells, and lysosomal machinery has an essential role in the
reabsorption and degradation of glomerular filtrate plasma proteins (Takabatake et al.,
2014).
1.8.5.1 Evidence of autophagy induces protection/injury in PTCs in kidney diseases:
To examine the role of autophagy in kidney disease, investigators usually use autophagy-
deficient mice by knocking out a specific Atg that is responsible for initiating the
autophagy, which leads to inhibiting the autophagy event, or by using inhibitors for
autophagy process (Liu et al., 2014). The role of autophagy was investigated in renal
tubular cells in different in vivo and in vitro models.
In vitro study, the role of autophagy in human PTECs was investigated under hypoxia
condition, as one of the ischemia injury causes. The results showed increased in autophagic
vacuoles and lysosomes in 1% O2 and 24h hypoxic cells compared to normoxic control and
by using anti-LC3 and anti-LAMP antibodies, which are markers of autophagosomes and
lysosomes, respectively. By using lysosome inhibitor the autophagosomal vacuoles sill
increased after 6 and 24h of hypoxia. They concluded that a high turnover of autophagy
might lead to autophagic cell death (Suzuki et al., 2008).
34
In vivo study, the role of autophagy was investigated in mice with severe proteinuria
induced by intraperitoneal albumin (free fatty acid) overload that led to tubular proximal
tubular cell damage, apoptosis, and activated autophagy, and in proximal tubule specific
autophagy-deficient mice, resulting from an Atg5 gene deletion. The mice, also developed
severe proteinuria, induced proximal tubular cell damage autophagy was activated after
intraperitoneal albumin (free fatty acid) overload. From these results they suggest that
proteinuria-induced autophagy has a renoprotective role (Yamahara et al., 2013).
35
Figure (1.7): Diagram of the steps of autophagy.
Induction/Initiation
Nucleation/ Elongation
Phagophore membrane
Autophagosome
Lysosome
Fusion
Autophagolysosome
5
3
4
2
1
Autophagic
protein
complexes
36
1.8.6 Apoptosis in proximal tubular injury:
Apoptosis or programmed cell death is a way of cell death. During apoptosis the
morphological and biochemical characteristics of cells changes: for example, the size of
cells decrease due to the reduction in cytosolic volume and condensation of nuclear
chromatin, round up, internucleosomal DNA fragmentation and the cell breaks into many
parts called apoptotic bodies, which contain fragments like mitochondria. Also, cell
detachment is one of the characteristics of apoptotic cells (Lieberthal & Levine, 1996 and
Erkan et al., 2001).
The morphological and biochemical changes in apoptotic cells correlate with caspase
activation. Caspases are complex cascades of protein that cleave enzymes. In mammals, 14
caspases were identified, which lead to apoptotic cell death (Kwak, 2013). These caspases
are present as in inactive forms in all animal cells (Reed, 2000). Apoptosis signalling
induces through three pathways, including cytokines pathway like TNF-𝛼, mitochondrial
pathway, and endoplasmic reticulum (ER) pathway (Kwak, 2013).
Cytokines pathway activates caspase8; ER activates capase12 and mitochondrial pathway
activates caspase-9; all three pathways subsequently activate caspase3, resulting in
apoptosis through DNA fragmentation (Kwak, 2013).
Apoptosis plays a role in pathogenesis of acute and chronic renal disease, specifically in
renal tubular epithelial cells injury. There are several triggers for apoptosis in renal tubular
cells include physiological activators such as TNF-𝛼 and TGF-𝛽 and cytotoxic stimuli like
ischemia and nephrotoxins (Lieberthal & Levine, 1996).
Several in vitro and in vivo studies have examined the apoptosis in many kidney diseases
that showed injury in renal tubular cells. For example, in vivo apoptotic bodies were
detected in tubular cells in kidney of ischemia/reperfusion (for 12-48h) rat model
(Lieberthal & Levine, 1996).
37
1.8.6.1 Proteinuria and renal tubular apoptosis:
Previous study reported that excess endocytosis in PTCs trigger the apoptotic pathway and
many evidences suggested that proteinuria causes tubule cells apoptosis (Hutchison et al.,
2012).
The references listed here after deal with the interaction of high protein and kidney cell
response in different setting, there by supporting a fundamental relationship between
proteinuria and tubular apoptosis.
The settings are: stimulation of HK2 cells and primary PTECs with albumin and
immunoglobulin light chain in vitro and in vivo rat model of protein overload and a clinical
histopathological study.
Here are the details:
In vitro, exposure of cultured PTCs to bovine serum albumin (BSA) with or without fatty
acid (0, 5, 10, or 20mg/ml) for 24, 48 and 72h induced apoptosis in a dose-and duration-
dependent manner. Cells stained with annexin, which is an early marker for apoptosis
and showed positive staining compared to negative staining in control cells (Erkan et
al., 2001).
Another in vitro study detects apoptotic cells after exposure of human proximal tubular
cells (SV40) to immunoglobulin light chain (200 𝜇mol/L) for 24h using TUNEL assay
using the ApopTag kit (Pote et al., 2000).
In vivo study also showed evidence that proteinuria induced apoptosis in kidney or
proteinuria rat model; they injected them with 0.5g of BSA /100g body weight. The number
of apoptotic cells was in tubular cells compared with the control. Apoptosis was detected
by detecting DNA fragmentation using (TUNEL) assay commercial kit (Tejera et al.,
2004).
Previous study detected apoptotic cells in PTECs in biopsy specimens of 30 patients with
focal glomerulosclerosis (FSGS) and proteinuria. Apoptosis was detected by morphology
38
and DNA fragmentation was detected using (TUNEL) assay commercial kit. However, the
normal kidney tissues were devoid of tubular cell apoptosis (Erkan et al., 2005).
Thus, previous studies provided evidence for a strong correlation between proteinuria and
renal tubule cells apoptosis. Apoptotic cell death initiated by proteinuria induced proximal
tubular cells injury may be an important mechanism of renal disease.
1.8.7 Evidence for toxicity of excess proteins to PTCs:
1.8.7.1 Novel biomarkers/mediators of PTCs toxicity:
AKI is one of the high-risk conditions lead to death; early kidney injury diagnosis might
help to prevent or delay more kidney damage. Several specific, sensitive and reliable
clinical biomarkers were established and used as evidences for renal damage induced by
proteinuria (protein overload). Several of these biomarkers have been used in vitro and in
vivo studies as early markers for renal injury.
These markers can be measured in different patient samples like serum, urine or biopsy, but
urine is the sample that provides the most promising markers for early detection (Vaidya et
al., 2008). There are traditional ways for AKI diagnosis including measuring serum
creatinine, GFR, urea, fractional excretion of sodium and proteinuria. However, traditional
ways of measuring have many disadvantages. For example, the serum creatinine’s
concentrations changes depending on gender, age, body weight and muscle metabolism,
and the serum creatinine concentrations change when advanced kidney injury already
occurred and 30% of GFR is reduced, so, kidney injury in the short term cannot be
diagnosed by these traditional ways (Peres et al., 2013).
39
A single biomarker may not be accurate to diagnose kidney injury occurs. Several methods
use to quantify these markers such as ELISA, which detects the antigen using two
antibodies. With nanotechnology it is possible to detect antigens using one capture antibody
with a read-out that is based on the principle of a change in conductance owing to an
antigen binding to the antibody (Vaidya et al., 2008).
More than 20 biomarkers were established and studied to diagnose kidney injury
(Table 1.3). These markers appeared to be stable in collected samples to be measured
(Pacific Biomarkers, 2012).
Some of these protein markers are up-regulated when kidney is damaged and appear in
plasma and urine (de Geus et al., 2012). The effect of proteinuria over load (like albumin
and light chain in MM) on PTCs and several biomarkers were investigated and discussed in
chapter 7.
Glomerular
Total protein, Cystatin C (urinary), 𝛽 2
microglobulin, 𝛼1 microglobulin and Albumin.
Proximal Tubules
Clusterin, NGAL, Cystatin C, IL-18, Cyr61,
Kim-1, fetuin-A, 𝛽 2 microglobulin and
Albumin.
Table (1.3): Biomarkers of kidney injury.
1.8.7.2 Kidney injury molecule-1 (KIM-1):
Recently, KIM-1 was discovered as one of the best urinary biomarkers for human and
animal kidney diseases because the ectodomain of KIM-1 is stable at RT and can be
measured in a 24h urine sample in a very small volume of sample (30𝜇 l). KIM-1 is
implicated in damage/repair processes (van Timmeren et al., 2006). It plays different
functions such as phosphatidylserine receptor to recognize apoptotic cells, scavenger
receptor and mediate uptake of necrotic-cell debris (Ichimura et al., 2012).
40
Normally, it is undetectable in kidney but the expression increases significantly in renal
injury (Lock, 2010 and van Timmeren et al., 2006). For example, it was induced in
proximal tubular injury after ischaemia-reperfusion and nephrotoxic injury (Baines, 2010).
KIM-1 can be assessed in renal biopsy specimens by immunohistochemistry or by
measuring KIM-1 excretion in the urine. Urinary Kim-1 detection could be used as an early
marker for renal damage (Vaidya et al., 2008).
Detection of the expression of urinary KIM-1 is more sensitive than histology for early
tubular injury. For example, urinary KIM-1 in 201 patients with acute kidney injury was
detected, but patients with the highest KIM-1 had a 3.2-fold odds ratio for hospital death
compared to patients with a lower amount (Lock, 2010).
High KIM-1 was detected after proteinuria-induced renal damage. A rat proteinuria model
to induce tubular damage by injecting with 2g of BSA for 3 weeks showed KIM-1 protein
expression was significantly increased in rats with proteinuria compared to the control rats
that were injected with saline instead of albumin. Also, the urinary excretion of KIM-1 was
markedly elevated in rat-proteinuria. The urinary KIM-1 levels elevation in proteinuria
correlated with KIM-1 tissue expression (van Timmeren et al., 2006). Thus, there are many
evidences showing the relation between KIM-1 expression (promising biomarker) and
tubular pathology/damage in kidney diseases.
1.8.7.3 Transforming growth factor beta (TGF-𝜷):
TGF-𝛽 is (25kDa) protein, and a member of the polypeptide growth factor family. All body
cells produce TGF-𝛽 like epithelial, endothelial and connective tissue cells. There are three
isoforms of TGF-𝛽: TGF-𝛽1, TGF-𝛽2 and TGF-𝛽3; each one produces in a different
tissue. TGF-𝛽1 is the most important one in humans. It plays many functions including
regulating the proliferation and differentiation of cells, embryonic development and wound
healing; also, it has an important role in signalling pathway in these processes (Blobe et al.,
2000 and Goumenos et al., 2002).
41
Elevation or reduction in TGF-𝛽 production is linked to several diseases specifically
fibrotic diseases in kidney, liver or lung, and can be used as a diagnostic marker for human
disease. For example, TGF-𝛽 protein and mRNA levels were elevated in patients with
fibrotic kidney diseases like IgA nephropathy, focal glomerulonephritis, lupus nephritis,
and diabetic nephropathy (Blobe et al., 2000). TGF-𝛽1 is one of the most fibrogenic
growth factors linked with renal fibrosis (Goumenos et al., 2002).
Previous studies showed a correlation between TGF-𝛽1 renal expression and progression of
human kidney diseases in patients with proteinuria. One study examined the TGF-𝛽1
production and urinary excretions in 25 patients with glomerular diseases and heavy
proteinuria. The data showed strong TGF-𝛽1 immunostaining in the tubule area in the renal
sections, and the TGF-𝛽1 urinary excretion was increased in patients with proteinuria
compared to healthy and glomerular disease without proteinuria patients. From these results
they concluded that the severity of TGF-𝛽1 production and urinary excretion in patients
with glomerular diseases and heavy proteinuria is correlated to the degree of tubular
epithelial cells injury by filtered protein (Goumenos et al., 2002).
In vitro study, exposure cultured PTECs to several concentrations of HSA for 8h showed a
significant increase in TGF- 𝛽 1 protein secretion (albumin concentration-dependent)
(Diwakar et al., 2007). From different studies it can be confirmed that TGF-𝛽1 plays a role
in developing fibrotic disease in kidney.
1.8.7.4 Tumor necrosis factor alpha (TNF-𝜶):
TNF-𝛼 cytokine is a (26kDa) trans-membrane protein. It has properties that play a role as a
pro-inflammatory cytokine that leads to activating inflammatory cells at the site of injury,
or an immunoregulatory role. Also, it can stimulate the release of other cytokines and
chemokines such as MCP-1, IL-6 and IL-8 (Ernandez & Mayadas, 2009).
42
Commonly, inflammatory diseases affect kidney, and TNF-𝛼 is mainly associated with an
inflammatory cascade that ends up with renal injury. On the one hand, TNF-𝛼 is not
detectable in normal kidney; on the other hand, most renal cells produce TNF-𝛼 but in
diseases and different inflammatory conditions (Ernandez & Mayadas, 2009).
For example, in vivo rat model of ischemia-reperfusion injury showed an increase in TNF-
𝛼 production localized in tubular cells in sections of renal samples stained for TNF-𝛼 by
immunohistochemical techniques (Donnahoo et al., 2001).
In vitro study, stimulating human PTCs with κ-LC (50μM) for 72h (proteinuria model)
showed a significant increase in TNF-𝛼 production (Arimura et al., 2006).
The upregulation of renal TNF- 𝛼 expression is correlated with urinary excretion in
glomerulonephritis diseases and proteinuria. Thus, TNF-𝛼 might implicate in glomerular
inflammation (Ernandez & Mayadas, 2009).
TNF-𝛼 is cytotoxic to renal epithelial cells, resulting in significant glomerular injury. In 24
diabetic patients with renal failure, the TNF- 𝛼 plasma concentrations were markedly
increased and correlated with urinary TNF- 𝛼 excretion. From these results it can be
suggested that this TNF-𝛼 plays a role in the pathogenesis of proteinuria and tubular renal
damage (Navarro et al., 1999).
TNF-𝛼 pro-inflammatory might be involved in renal injury because TNF-𝛼 deficient mice
were partially protected from glomerular injury (proteinuria) and using TNF-𝛼 blockade
treatment clearly offers protection against glomerular injury (Ernandez & Mayadas, 2009).
In conclusion, TNF-𝛼 has a strong correlation with the progression kidney injury.
43
1.9 Model for Proximal Tubular Epithelial Cells (PTECs):
In kidney, the PTECs are responsible for reabsorption of filtered solutes and excretion of
waste products. Some solutes, like phosphate and amino acids, are filtered in the
glomerulus and reabsorbed in the PTECs by active sodium-coupled transport. However,
other filtrates such as albumin and low-molecular-weight proteins like FLC are reabsorbed
by receptor-mediated endocytosis as described previously (See1.6.2). Currently, a variety
of primary and commercially cell line of human and animal PTECs sources are available
for researching purposes (Wilmer et al., 2010) such as investigating the role of PTECs in
different kidney failure diseases. Primary PTECs were isolated from either human or
animal kidney material like mouse and rabbit. However, the primary human renal proximal
tubule epithelial cells are limited use in clinical and basic research because of their limited
lifespan in culture (Kowolik et al., 2004). Many other reasons are limited the use of
primary PTECs in researches and applications will be discussed in chapter 4.
Cell lines, due to the immortalization process that generated them can be grown for
prolonged periods in vitro. For example, TH1 cells are derived from primary human renal
proximal tubule epithelial cells immortalized by two lentiviral vectors carrying the human
telomerase (hTERT) and the SV40 T antigen (Tag) to increase the number of cell divisions
and they were characterised and showed similar features to human primary PTECs, so they
potentially can be used in basic research, applications like drug toxicity screening and
tissue regeneration (Kowolik et al., 2004).
Also, SV40 immortalized human proximal tubule cell was used to study the effect of FLC
on the endocytosis process and the production of cytokines in proteinuric state (Sengul et
al., 2002). Another example, Opossum Kidney (OK) cells are human cortex proximal
tubule epithelial cell line dived from normal adult female, they were used in albumin
uptake (endocytosis process) in proteinuric nephropathies (Baines et al., 2012).
44
Human Kidney 2 (HK2) cell line also is one of the commercial PTECs that obtained from
normal adult renal cortex and transfected with recombinant HPV16 E6/E7 genes (figure
1.8). These commercial cell lines have been characterised in detail. However, few of them
were characterized in terms of transporter expression like HK2 cells, for example, in this
study they concluded that HK2 cells are of limited value as an in vitro model of drug
transporter expression (Jenkinson et al., 2012). Although, HK2 cell has been extensively
used in nephrotoxic studies as renal pathophysiological modal in vitro (Jenkinson et al.,
2012). Also, these cells were widely utilised in proteinuria studies in vitro. For example,
HK2 cells were used as a proteinuria vitro model system by stimulated with albumin to
evaluate the potential significance of different markers of tubular damage (Newman et al.,
2000). Also, they used as protein overload model by treated with albumin and IgG to
measure the cells H2O2 production (Morigi et al., 2002). In addition, previously HK2 cells
were used in megalin cytoplasmic tail phosphorylation by albumin as a source of human
PTECs, which is the main point that will be investigated in this project with FLC and
albumin (as positive control) proteins in proteinuria conditions. The advantages for using
HK2 cells as a source of human PTECs in the project will be discussed in chapter 4.
Figure (1.8): Light microscopic appearance of Human Kidney (HK2) cells.
10 X
45
1.9.1 Human Embryonic Kidney Cells 293 (HEK293):
The HEK293 cell line is one of the most cell lines that frequently use in cell biology. It
derived by transformation of primary cultures of human embryonic kidney cells with
sheared adenovirus 5 DNA (Kavsan et al., 2011). They are easy to grow in culture,
transfect, and they widely used as hosts for gene expression. HEK 293 cells have a very
complex karyotype, with two or more copies of each chromosome, including three copies
of the X chromosome (Lin et al., 2014).
For many years it was assumed that HEK 293 cells were generated by transformation of
either a fibroblastic, endothelial or epithelial cell that are all abundant in kidneys. HEK 293
cells were compared with human kidney, adrenal and central nervous tissue. The results
showed that HEK 293 closely resembled adrenal cells. So, likely embryonic adrenal cell
seems to be the most cell of origin of HEK 293 line. As a consequence, HEK 293 cells
should not be used as an in vitro model of typical kidney cells or kidney function (Shaw et
al., 2002). In addition, due to it is a transformed cell line; they cannot be used as model for
normal cells in an in vitro. For all of these reasons the HEK293 (embryonic origin) were
used in this project as appositive control in some of the experiments.
46
1.10 Hypothesis:
The hypothesis of this thesis is that in kidney failure, monoclonal FLC (MM) is able to
phosphorylate Meg-CT and exert pro-inflammatory effects on PTCs damage.
1.11 Aims:
Proteinuria is a hallmark of nephropathy in many diseases such as diabetes, multiple
myeloma and nephrotoxins. The treatment for renal dysfunction depends on the cause and
the severity of the kidney’s condition. Untreated patients with acute or chronic kidney
failure might need kidney dialysis or in some cases they need renal replacement
transplantation (RRT).
To decrease the number of morbidity and mortality caused by renal failure, to give more
patients the chance to save their lives and to develop treatment strategies, we need to
understand the mechanisms of progressive renal damage.
Glomerular filtered proteins including albumin and free light chain in multiple myeloma
patients that are reabsorbed in PTECs via receptor-mediated endocytosis process like
megalin might have (a) direct toxic effect on cells by exceeded the capacity on PTCs to
reabsorb, (b) megalin could be more than an endocytic receptor for filtered protein,
stimulating signalling pathway and ending up with Meg-CT phosphorylation (c) production
of inflammatory cytokines, generating reactive oxidase species and activating the
complement system. All of these reasons might lead to or contribute to PTECs damage and
loss of renal function. Early diagnosis of renal dysfunction could help to save patients’
kidneys from additional damage.
47
The aims of this project:
To analyse a proximal tubular cell line for relevant characteristics.
To establish an in vitro model of protein overload using HK2 cells to study the
effect of protein overload.
To determine Meg-CT phosphorylation in stimulated HK2 (+/-GF) cells with FLC
in PPPSP motif.
To determine the response of HK2 (+/-GF) cells stimulated with FLC.
The focus of the thesis is mainly on the role of monoclonal light chains isolated from a
patient with multiple myeloma, and FAF-HSA is used as a positive control.
48
Chapter Two-Materials and Methods
49
2. General Methods
This chapter presents the materials and methods that were utilised for the experiments in
this project.
2.1 Tissue culture:
Two different types of kidney cells were used. The HK2 cell line (human kidney 2)
representing proximal tubular epithelial cells (PTECs) is derived from the normal
kidney of an adult male, and is human papillomavirus 16 (HPV- 16) transformed. It was
obtained from the American Type Culture Collection (CRL-190, Manassas, VA).
Human Embryonic Kidney 293 (HEK 293) cell line (figure 2.1) is often used for
transfection and was supplied by Dr C. Erridge (Cardiovascular Department, University
of Leicester). The cells were grown in areas approved for biohazardous work.
The standard culture medium utilised to grow (HK2 and HEK293 cells) was 500ml of
Dulbecco's Modified Eagle Medium: Nutrient Mixture F-12 (Ham's) (1:1) (DMEM:
F12), L-Glutamine and 15mM HEPES (4-(2-hydroxyethyl)-1-piperazineethanesulfonic
acid) (GIBCO, 31330) supplemented with 5ml penicillin (100 IU/ ml)/streptomycin
(100 μg/ ml) (Sigma, P4333) and 10% foetal calf serum (FCS).
However, the standard culture medium used to grow (HK2-GF) was 500ml of
Dulbecco's Modified Eagle Medium: Nutrient Mixture F-12 (Ham's) (1:1) (DMEM:
F12), L-Glutamine and 15mM HEPES (4-(2-hydroxyethyl)-1-piperazineethanesulfonic
acid)(GIBCO, 31330) supplemented with 5ml penicillin (100 IU/ ml)/streptomycin (100
μg/ ml) (Sigma, P4333), 10% foetal calf serum (FCS), 25 𝜇𝑙 recombinant human
epidermal growth factor (EGF) of (200μg/ml (Sigma E 9644)), 500 𝜇𝑙 of (Insulin-
Transferrin-Sodium selenite) (ITS) (Sigma I1884), 1𝜇𝑙 Triidothyronine (4pg/ml) (Sigma
T5516) and 180 𝜇𝑙 Hydrocortisone of (100μg/ml) (Sigma H 0135)).
Cells were grown to confluence in a humidified atmosphere with 5% carbon dioxide
(CO2), at 37C˚, and passaged using trypsin/EDTA (Sigma T4174). After between 6 and
10 days, spent medium was discarded from a 75cm2 flask (Nunclon), followed by
rinsing 5ml of 1x trypsin/EDTA (Sigma) diluted in phosphate buffer saline (PBS) for
50
5min in 37C˚, then the cells were transferred to a 50ml reaction tube with 10ml medium
and centrifuged for 5min at 200 x g. The supernatant was then discarded and fresh
medium was added to the cells, transferred to a vented cell culture flask and left to grow
in the incubator.
After culturing the cells (HK2, HEK293 and HK2-GF) for experiments for 24h to be
adherent, in the next day the supplemented standard medium was change to DMEM:F12
serum free media for 24h before experiments carried out to reduce the possibility of
carry offer the effects of FCS on cultured cells.
10 X
Figure (2.1): Light microscopic appearance of human embryonic kidney 293
(HEK 293) cells. They are polygonal and appear as flat, pavement-like epithelial
cells.
51
2.2 Scanning Electron Microscopy (SEM):
SEM was employed to visualise evidence of brush border characteristics of the cell
surface (villous protrusions). Two samples were inspected, namely HK2 and HK2-GF
cells, and were cultured to confluence on 12 well plates that had glass cover slips
(diameter 13mm).
The samples were rinsed twice in a fixation buffer for SEM (Hayat mammalian ringer,
Table 2.1) at 37C˚ to remove medium and then fixed in 3% glutaraldehyde in 0.1M
Sørensen's phosphate buffer (pH 7.2) for 2h in the fume hood at RT. The subsequent
procedure was carried out by Natalie Allcock of the Electron Microscopy Laboratory,
University of Leicester.
Cells were washed 3x in 0.1M Sørensen's phosphate buffer for 10min each. Then, they
were fixed in 1% osmium tetroxide/0.1M Sörensens phosphate buffer for 45min,
followed by washing 3x for 10min in double distilled water (DDW). Next, the
coverslips were transferred into the Critical Point Drier (CPD) holder in DDW and
placed in 30, 50 and 70% ethanol for 15min each and stored in fresh 70% ethanol at RT.
After that, they were placed in 90% ethanol for 30min and in 100% Analytical grade
ethanol 3x for 30min each. Then, they were transferred again into the CPD. Finally;
they were mounted onto aluminium stubs using carbon sticky tabs and sputter coated for
90sec 2.2 kilo Volts (kV) with Au (gold). Samples were viewed in the Hitachi S3000H
Scanning Electron Microscope with an accelerating voltage of 10kV.
52
2.3 Histology:
2.3.1 Immunohistochemistry staining protocol for endogenous Alkaline
Phosphatase:
Alkaline phosphatase is a hydrolase produced by the PTECs brush-border membrane (in
the cortex part of the kidney) (Terryn et al., 2007). In the following methodology
developed and done by Dr. Simon Byrne, kidney sections (5micron) from C57BC/6
mice were fixed in 10% of Neutral-buffered formalin (3.7% formaldehyde in PBS) for
5min. Then, the slides were washed 3x in tap water and placed briefly in 200mM
Tris/HCL buffer (pH 9-9.5) to raise the pH within the tissue. After that, the slides were
incubated with the substrate BCIP/NBT (5-Bromo-4-Chloro-3-indolyl phosphate/Nitro
blue tetrazolium) for 2min to detect the alkaline phosphatase in the cortex part. Next,
the substrate was washed off by tap water and the nuclear counterstain 1% Neutral red
was applied for 2min. Finally, the slides were washed in tap water, rinsed in dH2O,
dehydrated in 100% IMS, cleared in Xylene and cover slipped in DPX mountant.
Table (2.1): Mammalian Ringer Fixation for SEM solution (Provided
from Natalie Allcock of the Electron Microscopy Laboratory,
University of Leicester).
Solutions 1L dH2O
NaCl 10g
KCL 4.67g
CaCl * 6H2O 2.67g
NaHCO3 0.55g
Glucose 0.55g
MgCl2 * 6H2O 0.27g
53
2.3.2 Immunocytochemistry:
Immunocytochemistry (ICC) is a common technique that is used to detect the presence
of specific proteins in cells. The Alkaline Phosphatase Magenta Immunohistochemical
Substrate Solution Kit (Sigma AM0100-1KT) was chosen due to this substrate being
usable for histochemical and membrane-type to detect the alkaline phosphatase activity
in the HK2 cells and mouse PTECs (mPTECs preparation, see 2.3.3). The resulting
magenta precipitate at the site of alkaline phosphatase activity comes from the
combination of Gormori’s Tris AzoCoupling (TAC) buffer with naphthol after
hydrolysis by the alkaline phosphatase. The cells were sub cultured in 6 well plates to
confluence, and then the kit was used according to manufacturer’s instructions. Methyl
green was used as nuclear counter stain (Methyl green stain was prepared by Dr. Simon
Byrne).
2.3.3 Mouse PTECs preparation:
The C57BC/6 mouse was culled by cervical dislocation by experienced animal
technicians. The dead mouse was placed on its back on a clean surface in the tissue
culture cabinet. The mouse was sprayed with alcohol (70% IMS), then cut and opened
by sterile scissors and forceps. The first kidney was located by gently pushing the
stomach to the animal's right side by using the sterile forceps. The kidney appeared as a
dark red. It was held with the sterile forceps and cut free by the sterile scissors. They
were placed in a sterile glass petri dish containing HBSS.
The capsule was removed from the kidneys with a sterile scalpel blade and forceps. The
kidneys were moved to a new petri dish containing fresh HBSS, and small pieces of
cortex were sliced away from the medulla. Next, the pieces were collected in a tube
containing 20ml of HBSS; this step was repeated 3x for washing. Then, the pieces were
poured into 40µm sterile plastic sieves, and pushed and mashed with the plunger of a
1ml syringe with occasional HBSS washing. The tissues that were passed through were
the PTECs. The cells centrifuged for 5min at 200 x g, the supernatant was removed and
then a fresh 20ml of HBSS were added; this step was repeated 3x for washing. After
that the pellets were re-suspended with 9.5ml fresh HBSS and 0.5ml of prepared
54
collagenase type II solution (Enzyme) diluted in acetic acid (0.1M) (final concentration
is 0.05mg/ml). The tube was incubated for 2min at 37C˚. Then, 10ml of DMEM: F12
medium were added to the tube and centrifuged for 5min at 200 x g. Finally, the
supernatants were removed and 3ml from DMEM: F12 medium (the same medium was
used to culture HK2-GF cells) were added, re-suspended and placed in 25cm² flasks or
6 well plates depending on the experiment they were to be used for; they were incubated
in a 37C˚ incubator for four days or to be confluent (Terryn et al., 2007).
2.4 MTT assay:
Thiazolyl Blue Tetrazolium Bromide or Methylthiazolyldiphenyl-tetrazolium bromide
(MTT) is a colorimetric assay measuring the cellular metabolic activity of cells; the
yellow substance is reduced to an insoluble and coloured (purple) formazan product by
mitochondria (Zhu et al., 2012). The cells are then solubilised with an organic solvent
Dimethyl Sulfoxide (DMSO) (Fisher Chemicals) and the released solubilised formazan
reagent is measured spectrophotometrically.
The cells were sub cultured in 96 well plates, the density depending on the experiment,
and treated with proteins or controls (un-treated cells) for different time points in
triplicate. After each time point 20μl of (5mg/ml) MTT solution (Sigma M5655)
dissolved in PBS (w/v) was added to each well and incubated in 5% CO2, 37C˚. The
MTT solution was discarded after 4h incubation and 200μl of DMSO were added for
10min to let the precipitate dissolve. The absorbance of the violet solution was
measured at 550nm by spectrophotometer (Thermo Scientific, MULTISKAN FC), (Zhu
et al., 2012).
2.5 LDH assay:
Lactate dehydrogenase (LDH) is a photometrical assay that detects the release of
cytoplasmic LDH that occurs when cells are injured and the membrane integrity is
compromised (Kendig & Tarloff, 2007). The LDH release is frequently used as an end-
point for cytotoxicity and a marker for cell death or damage (Kendig & Tarloff, 2007).
LDH activity was measured using a commercial assay (CytoTox-ONE Non Radio,
55
Cytotoxicity Assay, Promega G1781 and G1782). First, the LDH released in
supernatant could be measured by the two steps of enzymatic reaction. The LDH
catalysed the transformation of lactate to pyruvate by reduction of NAD+ to NADH.
Then, diaphorase used NADH to reduce a tetrazolium salt (INT) to a red formazan
product (figure 2.2). Thus, the formazan amount directly reflects the released LDH
amount in the supernatant. After sub culturing and incubating cells containing protein or
controls for different time points, 50μl of supernatant from each sample was transferred
in triplicate to a new 96 well plates. Fresh media was also loaded into the plate as a
control for background absorbance. The substrate mix was prepared and 50μl added to
each well; the plate was then covered with foil to protect it from light and incubated for
30min at RT according to manufacturer instructions. Stop solution was added, and
absorbance measured at 490nm using a plate reader (Thermo Scientific, MULTISKAN
FC).
Figure (2.2): Lactate Dehydrogenase (LDH) detection mechanism (Chemical
reaction).
Damaged
Cell
Lactate
Dehydrogenase
(LDH)
Lactate Pyruvate
NAD+ NADH
Tetrazolium salt
(INT)
Formazan
56
2.6 Crystal Violet assay:
Crystal violet (CV) or Gentian violet is a triphenylmethane dye also known as
hexamethyl pararosaniline chloride. CV is a simple assay originally used to quantify
cell viability by measuring the absorbance of the dye that is taken up by live cells. This
dye stains the cell’s DNA (Vega-Avila & Pugsley, 2011)
The cells were seeded in a 96 well plates and incubated for different time periods (24,
48, 72 and 96h); the supernatants were discarded and the cells were stained with 0.5%
filtered crystal violet 50μl/well, which dissolved in 20% (v/v) methanol in H2O, for 3-
4min at RT. Then, the dye was removed and the plate was washed 3x under the tap and
dried by inverting the plat to remove excess water and blotted on a paper towel. Finally,
100μl of 20% (v/v) acetic acid in H2O was added in each well to solubilize the
accumulated dye in the cell’s nucleus and absorbance measured at 540nm using a plate
reader (Thermo Scientific, MULTISKAN FC), (Protocol from Lab 211B).
2.7 Reverse Transcriptase Polymerase Chain Reaction (RT-
PCR):
2.7.1 Preparation of Ribonucleic Acid (RNA):
Total RNA was extracted by Trizol Reagent (Ambion) following the manufacturer’s
instruction. 1ml of Tri-reagent was added for each sample to lyse the cells. The lysed
cells were transferred to 1.5ml fresh reaction tubes to prepare the total RNA. The
samples were incubated for 5-15min at RT after adding 100μL of chloroform to each
sample and centrifuged at 12,000 x g for 15min. Three layers were formed in the tubes,
however, just the aqueous phase, which is the top layer, was collected in a new reaction
tube. Then, 500μL of Isopropanol was added to each sample and shaken for 5sec
followed by incubating for 5-10min at RT to precipitate the total RNA, and then
centrifuged at 12,000 x g for 8min; the supernatants were then discarded. Then, 1ml of
75% (v/v) ethanol in H2O was added as a washing step and centrifuged at 7,500 x g for
5min. Finally, the ethanol was removed and the RNA pellets left to dry. The RNA
pellets were re-suspended in 10-20μL of 0.02% (v/v) Diethylpyrocarbonate (DEPC)
57
(Sigma D-5758) treated water. The Nanodrop machine (Thermo Scientific) was used to
measure the amount of the total RNA in ng/μl in each sample. 2μg of the total RNA was
used for cDNA synthesis.
2.7.2 Preparation of Complementary Deoxyribonucleic Acid (cDNA):
From the total RNA, first strand cDNA was synthesised by using the Thermo Scientific
RevertAid H Minus First Strand cDNA Synthesis Kit (K1639) following the
manufacturer’s instructions. 2μg of the total RNA with 2μL of random hexamer primer
and water (nuclease-free) were added up to a final volume of 12μl per one reaction tube
(must be in ice). The samples were incubated for 5min at 65 C˚ to denature the total
RNA, after which they were chilled on ice. Then, 4μl of 5xReaction buffer, 1μl of
RiboLock RNase inhibitor (20U/μl), 2μl of dNTP Mix (10mM) and 1μL of RevertAid
H Minus M-MuL Revers Transcripase (200U/μL) was added for a final volume of 20μl
for each reaction. Afterward, the sample tubes were incubated at 25C˚ for 5min
followed by 60min at 42C˚, and the reaction was stopped by heating at 70C˚ for 5min in
the PCR machine (TECHNE, TC-3000).
2.7.3 PCR Protocol:
PCR was used for amplification of many target genes. The reaction was performed by
mixing 10x Reaction Buffer (2.5μl) (Thermo), MgCl2 (25mM) (1.5μl), dNTPs
(1.25mM) (4μl), Thermoprime Enzyme (5U/μl) (0.2μl), PCR water (10.8μl), forward
primer (5μM) (2μl), reverse Primer (5μM) (2μl) and from cDNA template (2μl) in 0.2μl
Eppendorf tubes. Cyclic amplification was performed in the (TECHNE, TC-512) PCR
machine. The program started with 95C˚ for 2min. Next, the reaction was cycled up to
30 times including denaturation (94C˚ for 1min), annealing (53-60C˚, depending on the
primer sequences, for 1min), and elongation (72C˚ for 1min, depending on the expected
product size) steps. Finally, the temperature was kept at 72C˚ for 10min for final
extension and then the reaction stopped and stabilized at 4C˚.
58
An Example for Program of the Amplification in (TECHNE, TC-512) PCR machine:
94C˚ 2min x1 cycle Initial denaturation
94C˚ 1min Denaturation
55C˚ 1min x30 cycles Annealing
68C˚ 1min Extension /Elongation
68C˚ 10min x1 cycle Final Elongation
4C˚ Hold
To analyse the RT-PCR samples, 2μl of loading dye was added (10x DNA gel loading
dye, 15% (w/v) BP blue, 50% (v/v) glycerol and 0.5mM EDTA) to the product and 10μl
loaded in each well of a 1% (w/v) agarose/1x TBE buffer gel (the electrophoresis step
for 60min at 90V in 1X TBE buffer) (Table 2.2). 1% (w/v) agarose was prepared by
mixing 1g of agarose and 100ml of 1xTBE (Tris base, boric acid, EDTA), heating in a
microwave for 3min, and letting the mixture cool to 60C˚. 20μl of Ethidiume Bromide
(0.5mg/ml) (Sigma) was added to make the samples visible under the Ultra Violet light.
Finally, the molten agarose was poured in the gel-assembled tray with comb.
5X TBE
54g Tris Base (Sigma)
27.5g Boric Acid (FISONS)
20ml Ethylenediaminetetraacetic acid
(EDTA) (0.5M), pH8.0
Table (2.2): Preparation of 5 x Tris/Borate/EDTA solution for electrophoresis.
59
In addition, 2μl of the DNA Ladder was run with the samples (Invitrogen by life
technologiesTM, TrackIt™ 1 Kb Plus DNA Ladder, 10488-085) (figure 2.3). Finally, the
gel was visualised using Imagequant 100 (UV trans-illuminator) and the picture of the
gel was taken by the DC120 digital camera.
2.7.4 Human Primers
Gene Primer sequence/
References
Annealing
(Tm)
Size (NCBI)
β-actin
5`CACCAACTGGGACGACAT-3`
5`ACAGCCTGGATAGCAACG-3`
(Izaguirre-Carbonell et al., 2015)
55C˚
~160bp
X00351.1
C3
5`GCTGAAGCACCTCATTGTGA-3`
5`CTGGGTGTACCCCTTCTTGA-3`
(Wan et al., 2007)
58C˚
~168bp
NM_000064
2000
1650
1000
850
650
500
400
300
200
100
bp
Figure (2.3): 1 Kb Plus DNA Ladder in 1% agarose gel electrophoresis. Semi-
quantitative RT-PCR for mRNA 𝛽-actin gene expression from HK2 cells. 𝛽-actin
(~ 200 bp).
60
FH
5`GGAACCACCTCAATGCAAAG-3`
5`AAGCTTCTGTTTGGCTGTCC-3`
(Mandal & Ayyagari, 2006)
55C˚
~276bp
Y00716.1
FB
5`GTTGAAGTCAGGGACTAACACC-3`
5`CCACAGTGAAACAATGTGC-3`
(Peake et al., 1999)
60C˚
~548bp
AF349679.1
IL-6
5`TCCTGCAGAAAAAGGCAAAG-3`
5`GCCCAGTGGACAGGTTTCT-3`
(Villeneuve et al., 2008)
60C˚
~250bp
NM_000600
IL-8
5`ACTGAGAGTGATTGAGAGTGGAC-3`
5`AACCCTCTGCACCCAGTTTTC-3`
(Mehdad et al., 2016)
58C˚
~111bp
BC013615.1
MCP-1
5`TGCGCAGAATGAGATGAGTTG-3`
5`GTGAGGAACAAGCCAGAGCTG-3`
(Villeneuve et al., 2008)
55C˚
~177bp
S71513
TGF-β
5`CCCAGCATCTGCAAAGCTC-3`
5`GTCAATGTACAGCTGCCGCA-3`
(Kwon et al., 2012)
60C˚
~157bp
NM_000660
TNF-α
5`CTTCTCCTTCCTGATCGTGG-3`
5`GCTGGTTATCTCTCAGCTCCA-3`
(Lab 211B)
55C˚
~78bp
NM_000594.
2
KIM-1
5`CTGCAGGGAGCAATAAGGAG-3`
5`ACCCAAAAGAGCAAGAAGCA-3`
(Lab 211B)
54C˚
~210bp
NM_001302
1J6
61
2.8 Real-Time Quantitative polymerase chain reaction (RT-
qPCR):
To quantify many gene expressions in different samples, the RT-qPCR technique using
SYBR Green I dye (SensiMixTM SYBR Kit, Cat.QT605) was used, which is a high-
performance reagent designed for superior sensitivity and specificity on various real-
time instruments. The master mix provided contains all the components for real-time
PCR including the SYBR Green I dye. The cDNA samples synthesised from extracted
total RNA from each sample was used as templates in RT-qPCR. The RT-qPCR
reactions started with diluting each cDNA sample 1:4 in autoclaved nanopure H2O.
Then, the RT-qPCR samples were prepared as shown in (Table 2.3). Additionally,
negative control (non-template control) prepared for each gene by utilising autoclaved
nanopure H2Oinstead of the cDNA template. Afterward, the qPCR samples were run on
the Corbett: Rotor-GeneTM 6000 machines and software (Table 2.4). Each sample was
prepared in duplicate and strip tubes and (0.1 ml caps) were used (QIAGEN, 981103).
Caspase-3
5`GCTTGTCGGCATACTGTTTCAG-3`
5`AGAACTGGACTGTGGCATTGAG-3`
(Ye et al., 2012)
60C˚
~190bp
NM_004346
Megalin
5`TAAGTCAGTGCCCAACCTTT-3`
5`GCGGTTGTTCCTGGAG-3`
(Tsaroucha et al., 2008)
53-58C˚
~300bp
NM_004525
Properdin
5`GGCACGGGTAGGATTAGGTCCACA-3`
5`GCATCCAGCACTGCCCCTTGAAA-3`
(Nagamachi et al., 2014)
55C˚
___
NM_002621
CD36
5`GTCGCAGTGACTTTCCCAAT-3`
5`ATGTAAACCCAGGACGCTGAG-3`
(Lab 211B)
55C˚
___
L06850
62
Reagent Volume
2x SensiMixTM SYBR 10μl
5μM Forward primer 2μl
5μM Reverse primer 2μl
Autoclaved Nanopure H2O 3μl
cDNA template 3μl
Total volume 20μl/ Reaction
Table (2.3): Preparation of RT-qPCR reaction.
Cycles Temperature Time
1
95 C˚
10 min
40
95 C˚
55-60 C˚
72 C˚
15 sec
15 sec
15 sec
Table (2.4): The temperature cycling conditions of qRT-PCR.
63
The amplification of each sample is tracked in real time and the machine calculates the
cycle threshold (CT) value for each sample. In RT-qPCR, a positive reaction is detected
by accumulation of a fluorescent signal. The CT is defined as the number of cycles
required for the fluorescent signal to cross the threshold. The relative position of the
crossing of this CT line with the threshold against the cycle numbers (on the x-axis)
gives an indication of the abundance of gene expression. So, when CT < 29, that means
abundant amount of the target gene; CT between 30-37 means indicative of moderate
amounts of target, however, if CT is 38-40 are likely to be negligible amounts of target
and that the amplification may have occurred because of some environmental
contamination. The threshold of each target gene product was set manually and CT
under the threshold through all 40 cycles means a negative result, or the expression of
the target gene is very low or an undetectable (figure 2.4 A).
The melting curve program consisted of temperatures between 55C˚ to 99C˚. The
melting curve results were used as evidence that only one product was amplified and
there were no contaminants or primer dimer products. The light cycler software plotted
the single peak (Tm) at around an 80-90C˚ (figure 2.4 C).
2.8.1 RT-qPCR analysis and calculation:
The RT-qPCR was chosen as the best approach of RT-qPCR for gene expression studies
to compare changes in gene expression. In relative RT-qPCR, the quantification of the
target gene normalised against a reference gene.
The ∆CT method was used to calculate the relative expression target gene in each
sample (Livak & Schmittgen, 2001):
2^-∆∆CT
∆∆CT =∆CT (test)-∆CT (calibrator)
∆CT (test) = CT (target gene) - CT (ref gene)
∆CT (calibrator) = CT (target gene) - CT (ref gene)
CT: Cycle number at which detectable signal is achieved.
64
Calibrator: The control sample, meaning an un-treated sample.
Test: Test sample means treated.
Reference (ref): The reference gene is one that expressed at a constant level in all test
and control samples without being affected by the experiment treatment in the study.
2.8.2 Primer Efficiency:
This experiment was done to determine the efficiency of the primer that was used in
RT-qPCR experiments by running a standard curve. The slope of the standard curve (Ct
vs. cDNA Concentration) is related to the efficiency, and should be close to 0.99.
The standard curve is formed by using a serial dilution of cDNA (template) prepared
from cells that are going to be examined or are known to express the examined gene.
Ideally, the efficiency curve should be determined for samples that are going to be
examined. Due to the cDNA concentration being unknown, a 1:10 dilution was used to
create 1, 0.1, 0.001, 0.0001, and 0.00001 cDNA concentrations in dH2O. Then each
concentration was used as a sample and different genes were tested by RT-qPCR as
described in (2.8) (figure 2.2 B). (Most of the primer efficiencies were tested by Lab
211b and available for this project).
Threshold Line
CT
Amplification
NTC
65
Figure (2.4): Quantitative Real Time-Polymerase Chain Reaction (RT-qPCR) for
β-actin (Housekeeping gene) expression in HK2 cells. (A) Shows the
amplification plot of β-actin serial dilution of cDNA (1:10). (B) The standard
curve of β-actin (efficiency = 0.96). (C) Shows the melting curves analysis for β-
actin to determine specificity of the products. (NTC: Non-template control or
negative control) (Tm: Melting temperature).
cDNA
Slope
Tm
66
2.9 Protein Immunoblot (Western blot):
This technique is used to detect specific protein expression from samples. After sub
culturing cells in 6 well plates to 80% confluence, they were stimulated with protein for
the experiment. The supernatants were discarded and the cells washed 2x with PBS to
remove any remaining exogenously added protein.
2.9.1 Preparation of cell lysate:
200-500μl of lysis buffer (Table 2.5) was added in each well; the cells were then
scraped and transferred to fresh eppendorf tubes and the samples were incubated for
30min on ice. They were centrifuged at 14,000 x g for 5min and the supernatants were
transferred into new fresh reaction tubes.
2.9.2 Protein Assay:
The protein concentration of the lysates was determined by Pierce 660nm Protein assay
(Thermo Scientific prod (22660)) according to the manufacturer’s protocol.
First, a range of bovine serum albumin (BSA) (PAA, K45-001) concentrations (as a
source of protein) were prepared for the standard curve (2000, 1500, 1000, 750, 500,
250, 125, 50, 25 and 0 μg/ml) by dissolving in PBS. 10μl from each concentration were
added in each well of a 96 well plate in triplicate, and then 150μl of the protein assay
reagent were added for each well and incubated at the RT for 5min (the colour changed
from yellow to blue proportional to the concentration of the protein). After the
incubation time the plate was read spectrophotometrically (Thermo Scientific,
MULTISKAN FC) at 650nm (figure 2.5).
67
2.9.3 Western Blot Protocol:
With this information, the protein samples were prepared for SDS-PAGE analysis by
mixing 20μg from each sample with 2xloading buffer (Table 2.6) 1:2 dilution into new
reaction tubes and heated at 95C˚ for 5min to denature the protein to the primary
structure for protein, by breaking down the disulphide bonds. Then the samples were
centrifuged in 16,000 x g for 5sec to remove insoluble debris and the supernatants were
used. After that the protein samples were run in 12% SDS-PAGE gel with a 5μl protein
marker (figure 2.6) in 1X running buffer 60mA for 1-1.5h (Table 2.6).
The separated proteins on the gel were electrophoretically transferred to a methanol-
activated (submerge for 30sec) PVDF membrane (GF Heath care Life Science,
AmershamTmHybondTm 0.2μmPVDF, 1060006), using 1xblotting buffer (transfer
buffer). After blotting at 250mA for 1h, the membrane was washed quickly in PBS and
blocked with 20ml of 5% dried skimmed milk in PBS (w/v) for 2h on the shaker at RT
or overnight at 4C˚. Then the membrane was washed in PBS-0.05% Tween (v/v) 3x for
10min each with shaking. After that, the membrane was probed with the primary
antibody (Table 2.7) diluted in 5% skimmed milk in PBS (w/v) overnight at 4C˚,
washed as above and probed with a second antibody (Table 2.8) diluted in 5% skimmed
milk in PBS (w/v) for 2h maximum at RT with shaking. Finally, the membrane was
washed as described and the face of the membrane exposed to Enhanced-chemi
luminescence (ECL) (Pierce™ ECL Western Blotting Substrate, 32106) reagents
consisting of 1ml reagent A and 1ml reagent B, wrapped in cling film, and exposed to
film (Bio-Max Light, Sigma) in a light-tight cassette. Then the film was submerged in
Figure (2.5): Example for the standard curve showing the absorbance of different
concentrations of BSA by Pierce 660nm Protein assay.
68
developing solution for 2min until antibody-reactive bands appeared, then were washed
in water, then submerged in a Fixer solution, washed in water again and then the film
was left to dry.
Solutions μl
1M pH7.5 β-glycerophosphate (w/v) in H2O
(Sigma G-5422)
100
0.5m pH 8.0 Ethylenedi-aminetetra-acetic acid
(EDTA) (w/v) in H2O (ALDRICH)
20
40mM pH 7.5 Ethylene glycol tetra acetic acid
(EGTA) (w/v) in H2O
250
1M pH7.5 Tris-HCL (w/v) in H2O
500
100mM Na Orthovanadate (ALDRICH, 450243)
100
1M Benzamidine (w/v) in H2O
10
100mM Phenylmethanesulfonylfluoride (PMSF)
(w/v) in Ethanol
20
69
β-Mercaptoethanol (Sigma M-7154)
10
10% Triton X-100(v/v) in H2O (BDH, 30632)
1000
500mM Na Fluoride (w/v) in H2O
1000
Protease Inhibitors (Sigma P8340)
100
Autoclaved H2O
6970
Table (2.5): Preparation of 10 ml Lysis Buffer (should be in ice), (Source: Dr. Alan
Bevington, University of Leicester).
70
Solutions Preparation
2x Loading Buffer
4ml dH2O, (1ml) 0.5M pH 6.8 Tris-HCL, 800μl
Glycerol, 1.6ml 10% sodium dodecyl sulfate
(SDS) (Fisher) (w/v) in H2O, Bromophenol
blue and 200mMDithiothreitol (DTT) (Sigma)
SDS-PAGE gel
12% Resolving Buffer: H2O, 30%
Acrylamide/Bis solution, 1.5M pH 8.8 Tris,
10% SDS, 10% Ammonium persulfate (APS)
(Sigma A-3678) and 10𝜇𝑙TEMED (Sigma T-
9281).
5% Stacking Buffer: H2O, 30% Acrylamide/Bis
solution, 1M pH 6.8 Tris, 10%SDS, 10% APS
and 6𝜇𝑙 TEMED.
10 x Running buffer
30g Tris-Base, 144g Glycine (Fisher) and 10g
SDS in 1L dH2O (for 1x Running buffer diluted
1:10 in dH2O).
1 x Blotting Buffer
5.9g Tris-Base, 2.9g Glycine, 100ml Methanol
and 3.4ml 10%SDS and 1L dH2O.
Table (2.6): Preparation of buffers for Western blot.
71
Primary Antibodies Dilution Company
Rabbit polyclonal-anti Villin-1 1:1000 Cell Signalling
(R814)
Mouse monoclonal-anti Caspase-3 1:1000 Santa Cruse
(sc-56053)
Goat polyclonal-anti Megalin 1:1000 Santa Cruse
(sc-16476)
Mouse monoclonal-anti C3 1:1000 Abcam (ab11874)
Goat polyclonal-anti FB 1:1000 Santa Cruse
(sc-34888)
Rabbit polyclonal- anti FH 1:500 Santa Cruse
(sc-33156)
Goat polyclonal-anti Properdin 1:500 Santa Cruse
(sc-67794)
Mouse monoclonal-anti TFF3 1:500 Biorbyt (orb243923)
Mouse monoclonal-anti 𝜷-actin 1:2000 Sigma (A5316)
Table (2.7): Primary antibodies.
(Conjugated HRP) Dilution Company
Swine anti-rabbit 1:2000 Dako (K5007)
Goat anti -mouse 1:2000 1 Dako (P0447)
Donkey anti -goat 1:2000 Santacruz (sc-2056)
Table (2.8): Secondary antibodies.
72
Dual Color (Catalog #161-0374) All Blue (Catalog #161-0373)
2.9.4 Preparing the Maxi Gradient Gel for the Megalin Western blot:
This type of gel is normally used to separate high molecular weight proteins like
megalin (~ 600 kDa). 3 gels are prepared separately with different concentrations (4, 15
and 4 %) (Table 2.9). After the 3 solutions were prepared, the 4% (Low concentration
(L)) and the 15% (High concentration (H)) were poured in the gradient gel maker, and
then a magnetic stirrer was used for mixing. Then, the power supply (Pharmacia LKB-
PUMP) was opened to encourage the (L) solution to move to the (H) in the gradient gel
maker, and the gradient gel maker should be on stir to let the magnetic stirrer to mix the
two concentrations together before transferring to the gel caster. Next, the gel was left
to dry, and the third solution 4% (stack) was poured. After the gel had polymerised, the
comb was taken out and the caster was put in the tank. The protein samples were
denatured as described previously and loaded. The marker was pre-stained with a
protein ladder, broad range 10-230KDa (Biolabs P7710S) and Hi Mark High Molecular
Figure (2.6): Protein marker (Precision Plus ProteinTM Standards, BIO RAD
(10-250 kDa)).
73
Weight protein standard (novex), then a running buffer (1x SDS) was poured in the tank
before running the gel in 300V/ 60-56 AM for 5h, then the normal immunoblot steps
were followed as described in (2.9.3).
Solution 4% 15% 4%
(Stack)
10% SDS (Sodium dodecyl sulphate) (Sigma L-
4509 nano pure)
250µl 250µl 100µl
Plus one Acrylamide PAGE (40%) 2.5ml 9.375ml 1ml
Resolving Buffer (1.5M Tris/HCL pH8.8) 6.25ml 6.25ml -
Stacking Buffer (1M Tris/HCL pH6.8) - - 2.5ml
Glycerol - 6.25µl -
dH2O 16ml 8.5ml 6.4ml
TEMED (Tetramethylethylenediamine) (Sigma) 25 µl 25 µl 12 µl
10% (w/v) APS (Ammonium persulphate) to be
added just before the gel is cast (initiates
polymerisation).
80µl 80µl 40µl
Table (2.9): Preparation for Gradient Gel.
74
2.9.5 Preparing the 4% Gel for the Megalin Western blot:
The same immunoblot technique was used as described in (2.9.3) but the gel preparation
was different; only a 4% resolving gel was used (Table 2.10).
2.10 Ultra structural analysis by transmission electron
microscopy (TEM):
A number of recent studies demonstrated that the induction of autophagy serves a
crucial role in protecting renal proximal tubular cells from many stresses (Inoki, 2013).
Based on this observation, the project analysed the presence of autophagic vacuoles in
HK2 (+/-GF) cells exposed to FAF-HSA and 𝜆-LC by TEM.
The HK2 (+/-GF) cells were sub cultured at (1x106 cells/well) density in a 6 well plates
for 24h to be adherent. The next day, the medium was harvested and the cells were
exposed to (5mg/ml) of FAF-HSA and 𝜆-LC in a serum free medium for 24 and 72h in
the incubator at 37C˚, 5% CO2. After each time point, the cells were washed twice with
PBS and trypsinized for 2min at 37C˚, collected with 2ml of serum free medium and
centrifuged for 5min at 200 x g. The supernatants were discarded and each pellet was
primary fixed in 2.5% glutaraldehyde in 0.1M Sørensen's phosphate buffer pH 7.3 for
24h.
The pellets from the centrifuged samples at 16,000 rpm were then washed in de-ionised
water 3x for 10min and 1% aqueous Osmium Tetroxide / 1.5% Potassium Ferricyanide
was added to each sample for post fixation for 1h. The samples were washed as before
4% Resolving Buffer ml
H2O 8.9
40% Acrylamide/Bis solution 2
Resolving buffer 3.8
20% SDS 0.15
10% Ammonium sulphate 0.15
TEMED 0.006
Table (2.10): Preparation of 4% gel.
75
and stained with 1% aqueous uranyl acetate for 1h at 4C˚, then the samples were
washed again as described previously. Next, the samples were embedded in Spurr’s
modified resin.
After polymerisation at 60C˚ for 16h, the embedded samples were sectioned using a
Reichert Ultracut E ultramicrotome. Ultrathin sections of ~ 80nm thickness were cut
from each sample and collected onto copper mesh grids. The sections were
counterstained for 2min in Reynold’s Lead citrate. The samples were viewed on the
JEOL 1400 TEM with an accelerating voltage of 80kV. The images were captured
using Megaview III digital camera with iTEM software. The subsequent procedure was
carried out by Natalie Allcock of the Electron Microscopy Laboratory, University of
Leicester.
2.11 Detection of Apoptosis:
Apoptosis, programmed cell death, can occur when disease or toxic agents damage
cells. Because albumin-induced apoptosis has been described in HK2 cells (Erkan et al.,
2007), this project analysed HK2 (+/-GF) cells after 24 and 72h protein stimulation
occurred using ApopTag® In Situ Apoptosis Detection Kits (Millipore, Cat no. S7100).
This method labels apoptotic cells by modifying fragmented DNA with free 3’-OH
groups using terminal deoxynucleotidyl transferase (TdT).
HK2 (+/-GF) cells (1x 106 cells/well) were cultured in two separate 6 well plates with
autoclaved glass cover slips (22x22mm) (ACADEMY, Cat no. 1200-03-14) for 24h to
be adherent. The following day the medium was replaced with a serum-free medium
with 𝜆-LC or FAF-HSA (5mg/ml) for 24 and 72h. After each time period the medium
was harvested and the wells were washed 2x with 2ml of PBS, and fixed with 1%
Paraformaldehyde (Agar, Cat no. R1018) in PBS (w/v) pH 7.4 for 10min at RT (Table
2.11). The wells were washed in two changes of PBS for 5min each. Then, the samples
were post-fixed for 5min in pre-cold Ethanol: Acetic acid (2:1) at -20C˚, then the cells
were washed as described previously. Next, freshly prepared 3.0% hydrogen peroxide
(Sigma, Cat no. 216763) in PBS (v/v) was added to the wells for 5min at RT and
washed. Immediately, 75μL of equilibration buffer was added to each well and
76
incubated for at least 10sec at RT. Subsequently, the equilibration buffer was discarded
and 55μL working strength TdT enzyme was added to each well for 1h and incubated at
37C˚ in the incubator. After 1h the working strength stop/wash buffer was added to the
samples at RT. Next, the samples were washed in 3 changes of PBS for 1min each and
65μL of anti-digoxigenin was added to each well and incubated at 37C˚ for 30min. The
samples were washed in 4 changes of PBS for 2min per wash at RT. Then, 75μL of
0.05% DAB (3, 3’-diaminobenzidine) (Sigma, Cat no. D-5637) (working strength
peroxidase substrate) in PBS (w/v) was added to each sample for 6min at RT, and
washed 3x with dH2O for 1min each.
Finally, the cells were stained with 0.5% Methyl green (Counterstain) for 10min at RT
(Table 2.11) and washed in 3 changes of dH2O, dehydrated in 100% isopropanol and
mounted in Xylene. Gently, each coverslip was removed from each well and placed
upside down on a slide prepared with one drop of D.P.X mountant (BDH, Cat no.
36029) and left to dry. The slides were examined under the light microscope.
Methyl Green
Acetate Buffer (0.133M), pH 4.0.
The 2% of methyl green was prepared
in dH2O (w/v) (contaminated with
crystal violet), and then washed with
chloroform to extract crystal violet.
The 2% methyl green was diluted with
acetate buffer 1:4 for 0.5% final
concentration.
1% Paraformaldehyde
100 ml dH2O boiled with 4μl of
10M NaOH
Then, in the fume hood 1g
paraformaldehyde was added and
shaken carefully.
Finally, 1 PBS tablet was added.
Table (2.11): Preparation of Paraformaldehyde and Methyl green
(They were prepared by Dr.Simon Byrne).
77
2.12 Quantitative measurement by ELISA:
2.12.1 Mini Elisa for candidate cytokines and chemokine from HK2
(+/-GF) cells:
Interleukin 6 (IL-6), Interleukin 8 (IL-8) and Monocyte Chemo-attractant Protein-1
(MCP-1) are important mediators released from epithelial cells (Stadnyk, 1994).
ELISA was used to quantitatively measure these inflammatory products in the sample
supernatant (Human IL-6, IL-8 and MCP-1 Mini ELISA Development Kit, 900-M16,
Peprotech, 900-M18 and 900-M31, respectively), the manufacturer’s protocol was
followed.
ELISA 96 well microplates (Nunc Maxisorp) were used. Firstly, the plates were coated
with capture antibodies that were diluted with PBS to a concentration of (1μg/ml for IL-
6, 0.5μg/ml for IL-8 and 0.25μg/ml for MCP-1) and immediately 100μl were added to
each well. The plates were sealed and incubated overnight at RT. On the next day, the
plates were aspirated to remove liquid and washed 4x with washing buffer (0.05% (v/v)
Tween-20 in PBS) 300μl/well. After the last wash the plates were inverted to remove
the remaining buffer and blotted on paper towels. Then, they were blocked with
300μl/well with 1% (w/v) BSA in PBS and incubated for 2h at RT; afterward the plates
were aspirated and washed 4x as described.
The IL-6, IL-8 and MCP-1 standards (figure 2.7) were diluted starting from (1.5 for IL-
6 and 1 for IL-8 and MCP-1 ng/ml to zero) in diluent (0.05% (v/v) Tween-20, 0.1%
BSA in PBS). Next, 100μl of standards and samples (supernatants) were added to each
well in triplicate and incubated at RT for at least 2h. The plates were aspirated and
washed 4 times. Subsequently, 100μl/well was added from detection antibodies that
were diluted to a concentration of 0.5μg/ml for all three ELISAs, and incubated for 2h
at RT. After 2h the plates were aspirated and washed 4x as described. Afterwards,
100μl/well from 5.5μl of Avidin-HRP conjugate, which was diluted 1:2000 for a total
volume of 11ml, was added and incubated for 30min at RT. Finally, the plates were
aspirated, washed 4x and 100μl/well of ABTS substrate solution was added to each well
(1-STEPTMABTS, Thermo scientific Cat No.37615), then incubated for 30min
maximum at RT for colour development. The colour development was monitored using
78
a plate reader (infinite f50, TECAN) at 405nm with wavelength correction set at 650nm.
The sensitivity of the ELISAs kits is less than 1.5ng.
2.12.2 Human TFF3 Immunoassay:
Trefoil Factor 3 (TFF3) release in supernatants from HK2 (+/-GF) cells stimulated with
FAF-HSA and 𝜆-LC (5mg/ml) for 24 and 72h was measured by TFF3 immunoassay
(QuantikineELISA, Human TFF3 Immunoassay (Cat no. DTFF30)) (done by Dr. Zina
Zwaini, Lab 211B, University of Leicester).
This is a quantitative sandwich enzyme immunoassay technique. Human TFF3
monoclonal antibody has been pre-coated onto a micro plate. At the beginning 50μL of
standards and samples, which were prepared as descried in the kit, were pipetted into
the wells in triplicate and incubated for 2h on shaker at RT. After 2h the plate was
washed 4x with 400μL of washing buffer (provided with the kit). Then 200μL of human
0 5 0 0 1 0 0 0 1 5 0 0
0 .0
0 .1
0 .2
0 .3
0 .4
0 .5
H u m a n I L 6 P g /m l
OD
(4
05
nm
)
0 5 0 0 1 0 0 0 1 5 0 0
0 .0
0 .1
0 .2
0 .3
0 .4
0 .5
H u m a n M C P -1 P g /m l
OD
(4
05
nm
)
0 5 0 0 1 0 0 0 1 5 0 0
0 .0
0 .2
0 .4
0 .6
0 .8
H u m a n I L 8 P g /m l
OD
(4
05
nm
)
Figure (2.7): Examples for Standard curves for (A) IL-6, MCP-1 (B) and (C) IL-8
Mini ELISA.
79
TFF3 conjugate was added to each well for 2h on shaker at RT. Afterwards, the plate
was washed as before and 200μL of substrate solution was added to each well and
incubated for 30min at RT (protected from light). A color developed in proportion to the
amount of TFF3 bound in the initial step. 50μL of stop solution was added to each well,
and the color in the wells changed from blue to yellow. The intensity of the color was
measured within 30min using a micro plate reader at 450nm and 540nm. The readings
at 540nm were subtracted from the readings at 450nm. The aim for this subtraction is to
correct the optical imperfections in the plate because the direct reading at 450nm
without correction may be higher and less accurate.
2.13 Determination of H2O2 Production by DCFDA:
H2O2 is one of the major reactive oxygen species (ROS) in the cell. This project chose to
measure H2O2 production by exposing the experimental cells to a cell permeable form
of fluorescein, DCFDA (2′, 7′-dichlorodihydrofluorescein diacetate). DCFDA
sensitively detects intracellular oxidants and can be used to follow changes in ROS
production over time (Eruslanov & Kusmartsev, 2010) (figure 2.8). A DCFDA Cellular
ROS Detection Assay Kit was used (Abcam, Cat no. ab113851).The HK2 (+/-GF) were
seeded with 10,000 cells/well density in a dark, clear-bottomed 96 well microplate
(PerkinElmer, Cat no.6005182) in standard medium and incubated overnight to be
adherent at 5% CO2, 37C˚. After that, the medium was removed and 100μL/well of 1x
buffer (supplied with the kit) was added to wash the cells. Next, the cells were stained
with 100μL/well of 25𝜇M DCFDA solution diluted in 1xbuffer for 45min at 5% CO2,
37C˚ in the dark. Then, the DCFDA solution was harvested and the cells were washed
again as described. Afterward the cells were treated and incubated with 100μL/well of
(5mg/ml) FAF-HSA or 𝜆-LC in free DMEM-F12 mediums for different time periods (5,
10, 20, 30, 60 and 360min) at 5% CO2, 37C˚ in the dark. After each time point the
100μL supernatants were transferred to a new dark 96 well microplate to measure the
conversion of DCFDA to DCF as indicator of the H2O2 released in the supernatant and
100μL of fresh free DMEM-F12 mediums were added to each well to measure the H2O2
production inside the cells.
80
Finally, the plates were measured using a fluorescent plate reader (Packard
FluoroCountTM microplate reader) with an excitation wavelength at 485nm and an
emission wavelength at 535nm.
81
Figure (2.8): Formation of fluorescent DCF by ROS activity: DCFDA is a
fluorogenic (non-fluorescent) dye. After diffusion in to the cell the DCFDA is
deacetylated by cellular esterase, which is later oxidized by ROS into highly
fluorescent compound DCF (2’, 7’ –dichlorofluorescein) that can be detected by
fluorescence spectroscopy.
OH HO
O-
DCFDA uptake by
cell
(Non-fluorescent)
DCF de-acetylation by
esterases
(Non-fluorescent)
DCF
(Fluorescent)
HO
O-
Cell membrane
Oxidation
Diffusion in to the cell
H2O2
H2O
ROS
82
2.14 Measuring Hydrogen Peroxide Production (H2O2)
Production by Amplex® Red:
H2O2 is a cell-damaging agent. The production of H2O2 from cells could lead to
oxidative stress and disease (Eruslanov & Kusmartsev, 2010). The H2O2 concentration
in cell culture supernatant was measured by Amplex® Red Hydrogen
Peroxide/Peroxidase Assay Kit (Invitrogen, A22188) according to the manufacturer’s
protocol. The Amplex red substrate (the hydrogen donor) is oxidised by H2O2 in the
presence of Hydrogen Peroxide (HRP) to create a coloured compound called resorufin
that can be detected (figure 2.9). So, increasing amounts of H2O2 in the sample will
form increasing amounts of fluorescent product.
After sub culturing cells in 6 well plates and incubating cells containing protein or
controls (un-stimulated cells) for different time periods, 50μl from each sample
supernatant and serial dilution (10, 5, 2.5, 1.25, 0.625, 0.3125, 0.15 and 0μM) of H2O2
standards (figure 2.10) as described in the kit and loaded into a 96 well plates in
triplicate. Then, 50μl was added from the Amplex red solution and horseradish
peroxidase (HRP) mixture to each sample and incubated for 30min at RT, protected
from light. The H2O2 concentration was measured in free medium as a control for
background absorbance. The plate was read spectrophotometrically at 560nm.
Figure (2.9): Conversion of Amplex Red to resorufin by HRP using H2O2
(Chemical reaction).
Amplex Red
Resorufin
H2O2 H2O
Hydrogen
peroxide (HRP)
83
2.15 Proteome Profile® analysis of HK2-GF cells:
In order to globally detect protein expression changes in HK2-GF cells before and after
protein stimulation, lysates were hybridised to a protein array, which is specifically
designed to detect proteins that have a role in renal cell and kidney function (Human
Kidney Biomarker Array kit, R&D Systems, Cat no. ARY019).
Four samples in a 6 well plate (1x 106 cells/well) of HK2-GF cells were sub cultured for
24h to be adherent. The next day the supernatants were discarded and three wells were
stimulated with 𝜆-LC (1 and 5 mg/ml) and FAF-HSA (5mg/ml) for 72h. The type of the
cells (HK2-GF) and the stimulation time (72h) were chosen depending on the indirect
cytotoxicity results (LDH) (See 5.2.1.2.1) and the ELISA results of IL-6, IL-8 and
MCP-1 (See 7.2.1). In addition, the HK2-GF cells were grown in the same medium that
primary proximal tubular cells grow in. However, 𝜆-LC (1 and 5mg/ml) concentrations
were decided on to examine the dose effects on the cells and the (5mg/ml) FAF-HSA to
examine the mechanism of damage between the 𝜆-LC and the FAF-HSA by using the
same concentration.
After 72h, the supernatants were harvested and the samples were washed with PBS.
After that, cell lysates were prepared by adding 200𝜇l of lysis buffer (Table 2.5) to each
well. The cells were scraped, collected in tubes and incubated for 30min on ice. Next,
the samples were centrifuged at 14,000 x g for 5min to remove cell debris. The
supernatants were collected in fresh reaction tubes. The protein concentration for each
Figure (2.10): Standard curve for Measuring Hydrogen Peroxide Production
(H2O2) Production by Amplex® Red.
0 5 10 150.00
0.05
0.10
0.15
0.20
H2O2 mMO
D (
560)
84
sample was determined as mg/ml using the Nanodrop machine (Thermo Scientific).
200μg of protein was used from each sample, according to manufacturer’s
recommendations.
The Human Kidney Biomarker Array kit had four nitrocellulose membranes, each
containing 38 different capture antibodies for the 38 different proteins printed in
duplicate. The membranes were blocked with 2ml blocking buffer (provided with the
kit) for 1h at RT with shaking. Then each sample was mixed with 15𝜇𝑙 of reconstitution
detection antibody cocktail and incubated for 1h at RT. The blocking buffer was
aspirated from the membranes, and then the samples were added to each membrane and
incubated overnight at 4C˚ on the shaker. The next day the membranes were washed
with the washing buffer 3x each for 10min and then each membrane was incubated for
30min at RT with 2ml of Streptavidin-HRP. Finally, the membranes were washed as
described previously and the face of the membrane exposed to Chemi Reagent Mix,
consisting of 1ml Chemi Reagent A and 1ml of B, wrapped in cling film, and exposed
to film for 10min in a light-tight cassette. Then the film was submerged in Develop
solution for 2min until antibody-reactive spots appeared, washed in water, and
submerged in solution, then washed in water and left to dry.
2.15.1 Proteome profile Data Analysis:
ImageJ2 software was used to analyse the data by measuring the pixel densities on
developed X-ray film for each spot that reflects the 38 different protein expression
levels (figure 2.11 A). The density of each protein, reference spots (positive control),
negative control (PBS) and background signal (clear area of the array (no antibody))
spots were measured in duplicate and the mean average was calculated (figure 2.11 B).
Then the average of the background density was subtracted from each spot (figure 2.11
C). Lastly, each spot was normalised with the reference spot and the graphs were
plotted to compare the signal of the 38 proteins in the four samples (figure 2.12).
The mean of each spot
The mean of the reference spots (positive control)
85
Figure (2.11): Example of the Human Kidney Biomarker Array result for HK2-
GF control sample. (A) Autoradiography film for the control sample shows the
positive signals on developed film. (B) Autoradiography film with light
background to measure the density of each signal. (C) The areas that were
measured by Image J2 software in fix circle size (13 diameters). The background
signal (clear area of the array (no antibody)).
C
Background
signal
B Positive signal
Negative signal
A
86
87
Figure (2.12): (A) The Human Kidney Biomarker Array coordinates. (B) The
table shows the reference of the 38 proteins, (Human Kidney Biomarker Array
kit, R&D Systems, Cat no. ARY019).
88
2.16 Phosphorylation of the recombinant expressed
cytoplasmic tail of Megalin receptor:
2.16.1 Rationale for use of pGEX-4T1 plasmid and MegCT-fusion
protein:
Meg-CT cDNA was ligated between the EcoRI/Xhol sites of pGEX-4T1 plasmid
(figure 2.14 A). The recombinant plasmid was used to transform E.coli (DH5α) to
induce a high-level expression of genes as fusions with Schistosoma japonicum
Glutathione-S-transferase (GST). Fragments of proteins fused to GST are easily and
rapidly purified. GST Fusion proteins have been widely used in protein/protein
interaction detecting methods in vitro because it easily binds to glutathione sepharose
beads and can be collected by centrifugation from the reaction mixture.
Competent cells (E.coli) 1ng were added to 100µl of plasmid DNA and mixed; the
mixture was incubated on ice for 30min before being heat shocked for 45sec at 42C˚.
After that, 900µl of SOC media were added and the mixture was incubated on ice for
2min. Then, the transfection was incubated horizontally in a shaking incubator at
225rpm at 37C˚ for 1h. The cells were grown by spreading 100µl of the transfection
mixture on Luria broth (LB) agar plates (containing 50µg/ml ampicillin) and incubated
overnight at 37C˚. The next day, one colony was used to inoculate 100ml of LB media
and grown overnight at 37C˚ with shaking. Finally, glycerol stocks of transformed
bacteria were made by mixing 10ml of the overnight culture with 4.5ml of a 50:50
mixture of sterile culture media and glycerol, stored at -80C˚. (The plasmid
construction and stocks preparation were prepared by Dr. Richard Baines, PhD
thesis, University of Leicester, 2010).
89
2.16.2 Preparation and collection of MegCT-GST Fusion protein:
The frozen glycerol stock in -80 (pGEX-4T1-MegCT transfected DH5α E. coli) was
scraped, inoculated in 20ml of LB with 20𝜇l of filter sterilised ampicillin diluted in
nanopure H2O (100 mg/ml stock) (w/v) and incubated at 37C˚ with shaking overnight.
The next day, 200-250ml of fresh LB broth (Table 2.12) were poured in a sterile flask
and 2.5ml of the overnight culture were added to a dilution of 1:100 and incubated at
30C˚ for 4h with shaking. After 4h 250𝜇𝑙 of filter sterile IPTG (1M stock) in dH2O
(w/v) (Isopropyl β-D-1-thiogalactopyranoside (Sigma, Cat no. I-6758)) was added to a
final concentration of 1mM to induce the expression of the fusion protein, and
incubation continued for additional 2h at 30C˚ with shaking. The bacterial pellet was
collected by centrifugation at 8000rpm (Beckman coulter Avanti j-e centrifuge) for
10min at 4C˚. The supernatant was discarded and the pellet was re-suspended in 19ml
of ice cold PBS. The cell wall of the bacteria was disrupted by brief sonication (MSE
Sanyo Soniprep 150) about 6 times, each time for 5sec, while on ice, until partial
clearing of the cell suspension was observed. Then the fusion protein was solubilised
with 1ml of 20% (v/v) of Triton X-100 (BDH chemicals, Cat no. 30632 4N) in dH2O to
a final concentration 1% and was gently shaken on ice for 30min. The pellet was
collected after 10min centrifuging at 12,000 x g at 4C˚ and the supernatant was
decanted. Afterward, 2ml of 50% slurry of glutathione sepharose 4B (52-2303-00 GE
Healthcare) (Table 2.12) in PBS were added to the supernatant, followed by mixing for
1h at 4C˚ on the tube rotor. The fusion protein bound to the glutathione sepharose bead
pellet was collected by centrifugation at 500 x g for 5min at 4C˚, followed by washing
the pellet 3x with 10ml of ice cold PBS and finally re-suspending in 2ml of PBS and
75µl of protease inhibitor cocktail was added (Sigma, Cat no. P8340) (figure 2.13).
90
Luria Broth (LB)
For 1L: 16g Trypton, 10g Yeast and 5g NACL.
After autoclaving, for each 1L of media 1ml of 100mg/ml stock
filter sterilised ampicillin sodium (Melford Laboratories LTD
A0104) diluted in nanopure water was added (100µg/ml).
Glutathione Sepharose 4B Preparation
Glutathione sepharose stock in 20% ethanol. 1.25 ml of the stock was
washed twice with 5ml PBS and centrifuged at 500g for 5min to
remove the ethanol. Then the 5ml of PBS was discarded and the
slurry was re-suspended in 1 ml fresh PBS to end up with 50% slurry.
Table (2.12): Luria Broth media and Glutathione Sepharose 4B
preparation
91
2.16.3 Stimulation of MegCT-GST fusion protein phosphorylation in
vitro:
There is a composite overview of this part in (figure 2.14). In 6 well plates, 500,000
cells/well were seeded and allowed to attach to be confluent in a standard culture
medium in the incubator, 5% CO2 at 37C˚. The confluent monolayers of HEK293 or
HK2 (+/-GF) cells were quiesced overnight in a serum free medium. The next day, the
medium was aspirated and freshly prepared agonists (Table 2.13). Each agonist was
diluted in 1ml of serum free medium and added to each well, and then the plates were
returned to the incubator for different times of incubation depending on the experiment
to investigate signalling kinetics. To halt the stimulation, the 6 well plates were put on
ice, the supernatants were harvested and each well was washed 2x with 2ml of ice cold
PBS. The cells in each well were lysed with 200µl of JNK lysis buffer for 10min (Table
2.14) while on a shaking rotator on ice. The samples were collected and centrifuged at
10,000 x g for 10min at 4C˚. The supernatants were transferred to new fresh reaction
tubes and 50µl from the MegCT-GST beads were added to each sample. The samples
were incubated for 1-2h at 4C˚ on an end-over-end rotator. Then, the beads were
washed once in 1ml of JNK lysis buffer and twice with 1ml of kinase buffer (Table
Figure (2.13): Preparations steps of MegCT-GST Fusion protein. (1) Bacteria
lysate from 24h growth (2) Bacteria lysate with IPTG for 2h (3) Bacteria after
sonication step (4) elate from beads.
4 3 2 1
50kDa
92
2.14). Afterward, they were collected by centrifugation at 3000 x g for 5min and 50µl
from 100µM Adenosine triphosphate (ATP) (Sigma, Cat no. A7669) (1mM ATP stock
diluted in H2O, then diluted with Kinase buffer to give a final concentration of 100µM
for each reaction) as a source of the phosphate and incubated for 30min at 30C˚. Finally,
the beads were collected after centrifugation for 5min at 3000 x g and washed 2x with
500µl of ice cold PBS. Thereafter, the samples were run on 12% SDS-PAGE after
solubilisation and denaturation in the loading buffer (ratio 1:2 for each sample)
followed by boiling at 95C˚ for 10min. Proteins were electrophoretically transferred to
methanol-activated PVDF membrane, blocked in 5% skimmed milk in PBS (w/v)
overnight at 4C˚ and then incubated with primary antibody, namely the antibody
generated in rabbit against the phospho relevant site (1:1000 dilution) (See 6) in fresh
5% skimmed milk, overnight at 4C˚.The blot was washed, incubated with HRP
conjugate and Swine-anti rabbit secondary antibody (1:2000) in 5% skimmed milk in
PBS (w/v) for 2h at RT and then reactive protein bands were visualised by incubating
with ECL Western Blotting Detection System (see 2.9.3).
93
Agonist Rationale
FAF-HSA (5 or 30mg/ml)
A major component of proteinuric
urine.
A ligand of Megalin receptor.
Phorbol 12,13-dibutyrate
(PDBU) (CALBIOCHEM,
Cat no. 524390) (positive
control) – a stimulator of
PKC (10µM final
concentration)
Protein kinase C activity stimulated by
HSA in PTC.
Protein Kinase C activity regulates
albumin endocytosis by PTECs in
vitro.
𝝀-LC (1 or 5mg/ml)
A major component of proteinuric
urine in Multiple Myeloma disease.
A ligand of Megalin receptor.
Table (2.13): Table of agents used in the studies of MegCT phosphorylation and
rationale for their use.
94
JNK Lysis Buffer Kinase Buffer
20mM Tris-HCL (Sigma)
0.5% Tergitol-type NP-40 (BDH,
Cat no.56009)
250mM Sodium chloride (NaCl in
dH2O) (Sigma)
-3mM Ethylenediaminetetraacetic
acid (EDTA pH 8.0 in dH2O)
(ALDRICH)
3mM Ethyleneglycoltetraacetic
acid (EGTA pH 8.0 in dH2O)
1mM PMSF in ethanol.
2mM Sodium orthovanadate
(Na3Vo4 pH 10.0 in dH2O)
(AlDRIH, Cat no. 450243)
1mM DTT (Sigma)
Protease Inhibitor Cocktail III
diluted 1:25
50mM 4-(2-
hydroxyethyl)-1-
piperazineethanesulfonic
acid (HEPES in dH2O)
(Sigma)
20mM β-
glycerophosphate
(Sigma, Cat no. G5422)
10mM Magnesium
chloride (MgCl2)
(FISONS reagent)
1mM DTT
50µM Na3Vo4 pH 10.0
Table (2.14): JNK and Kinase buffers preparations.
95
GST
pGEX
4T1
cDNA Megalin -CT
- Cloning of Megalin CT-GST in
prokaryotic expression vector.
- Production of MegCT-GST fusion
protein in E.coli (IPTG induction)
Coomassie blue gel of MegCT – GST
fusion protein
Albumin or LC
Activate
Kinase
pathway and
phosphorylate
MegCT in
PPPSP site
Cell
Megalin
Cells were stimulated and lysates were incubated with Meg-CT-GST bound to
glutathione beads for 2h at 4ºC, collected beads were incubated with ATP for 30
minutes at 30ºC. Finally; antibodies specifically raised against predicted
phosphorylation sites were used for detection of activation.
A B
96
2.17 Statistics and Data analysis:
The experiment’s conditions were kept as standard as possible and consistent replicates
results were analysed. Non-reproducible results for replicates of tested sample in the
experiment was not accepted, the experiment was excluded and should be repeated.
Data were expressed as Means ± SD for all experiments (n= the total number of
independent experiments, biological replicates). Statistical analysis was performed
using Graph Pad Prism 6 (Graph Pad, San Diego California, USA). For comparison of
one data set with a control data set, an unpaired t-test was performed. The values p<0.05
were deemed as significant. The standard curves were plotted by Graph prism 6
software, then the unknown samples were calculated. The density of Western blot and
PCR bands and the statistical analysis was measured by ImageJ2 software.
Figure (2.14): Phosphorylation of Meg-CT. (A) Production of construct,
purification of recombinant Meg-CT and (B) Detection of phosphorylation
signalling Meg-CT by utilising antibodies directed against specific activation sites
of the intracellular portion of megalin using stimulated cell lysate.
97
Chapter Three-FLC Purification
98
3. Purification of monoclonal Free Light Chain (FLC):
This chapter presents the development and optimisation of methodology for the
purification of FLC from urine. This was necessary in order to have purified
monoclonal light chains from a relevant source (multiple myeloma urine) with which to
assess their biological effects directly on proximal tubular epithelial cells in vitro. It was
not the scope of this work to test FLC from more than one patient or to include non-
monoclonal FLC in the analyses. The purpose of using monoclonal myeloma produced
FLC was to have a high concentration of uniform proteins with which high
concentration of uniform FAF-HSA would be compared. Non-monoclonal FLC that
might be considered as possible vehicle control of polyclonal would induce
heterogeneity in sample used for stimulation.
3.1 Source of Free Light Chain:
In multiple myeloma patients, the concentration of only one type of immunoglobulin
that is overproduced is very high in urine. In addition, it is often the main protein in the
urine, which aids in the purification process. Others have used urine from myeloma
patients as a convenient source of light chains (Sengul et al., 2002 and Li et al., 2008).
In this project, monoclonal FLC was purified from the urine of a patient with multiple
myeloma (MM) who had light chain proteinuria of ~5g/L. The light chain concentration
was measured by nephelometry at Leicester Royal Infirmary Hospital.
3.2 Urine Sample analyses:
The urine sample from the MM patient was a 24-hour collection sample (~1.5L) in a
plastic container (The urine sample was supplied by Dr. Mike Browning, Leicester
Royal Infirmary Hospital); from the physical examination the sample was foamy
(indicative of high protein content) and dark yellow in colour. In addition, in
microscopic examination the patient sample some crystal formation and casts showed.
The monoclonal FLC circulate as monomers (~25kD) and dimers (~50kD) (Wang &
Sanders, 2007). A denatured (5min in 95C˚) 20µl urine sample was separated using
99
12% SDS-PAGE gel and stained with coomassie blue (Table 3.1) by heating the gel
with the stain in the microwave for 5sec or leaving it to stain overnight on shaker at RT.
Then the gel was de-stained (Table 3.1) for at least 2h on shaker at RT or until the
protein bands are distinctly visible. A predominant band at (25kDa) is likely to be the
monomeric light chains (figure 3.1).
Coomassie Blue Stain
De-stain
For 1L:
1g Coomassie Brilliant Blue R250
(BIO-RAD, Cat.161-0400)
100ml Acetic Acid
400ml Methanol
500ml H2O
For 5L:
1.25L Methanol
0.5L Acetic Acid
3.25L H2O
Table (3.1): Coomassie Blue stain Preparation.
100
3.3 Dipstick test:
Typically, urinary analysis starts with a quick semi-quantitative chemical test called a
dipstick (Combur 10Test, Cobas, Cat no. 04510062). It screens for the presence of
proteins, blood and glucose in urine samples (de Jong & Curhan, 2006).
A control sample from normal patient (female) was used to compare with the patient
sample. It was a first-morning collection sample, which is suitable in the diagnosis of
the proteinuria (de Jong & Curhan, 2006). The dipsticks were dipped directly in the
non-centrifuged urine samples for 1sec in both the control urine sample ( C ) and in the
MM patient urine sample ( P ). The P sample was alkaline (pH 9.0) compared to the C
sample, which was acidic (pH 5.0). Urine is commonly acidic, with a pH (5.5-6.5),
however, alkaline urine may be seen in proximal renal tubular acidosis caused by a
failure of the proximal tubular cells to reabsorb bicarbonate from the urine due to
multiple myeloma disease (Patient, 2014).
Figure (3.1): Characterisation of urinary protein profile from a multiple myeloma patient.
20µl were run on 12% SDS-PAGE and coomassie blue stained (20µl of neat sample were
loaded).
( k D a )
2 5 0
1 5 0
1 0 0
7 5
5 0
3 7
2 5
2 0
1 5
1 0
101
Additionally, proteins were detected in the P sample by ~ +2 (1g/L) (the colour change
from yellow to the dark green colour and negative result for C (the colour did not
change). In addition, for further investigation the two samples were runs using SDS-
PAGE The gel shows the presence of a high amount of FLC protein and some other
high and low molecular weight proteins in the P sample, however, the C sample showed
significantly fewer proteins (figure 3.2).
( k D a )
2 5 0
1 5 0
1 0 0
7 5
5 0
3 7
2 5
2 0
1 5
1 0
C P
Figure (3.2): Comparing the urinary proteins in the patient (P) and the control (C)
sample, 20µl was run in 12% SDS-PAGE and coomassie blue stained (reduced
condition).
102
3.4 Albumin Excretion:
Albuminuria is a sign of renal damage. The albumin concentration was measured in the
myeloma patient sample by generating a standard curve from the known concentration
of BSA (PAA, Cat no. K41-001) from 5-200mg/L diluted in dH2O, and comparing to
the band of the size of albumin (~68kDa) obtained from the serially diluted BSA
samples run on a gel in parallel.
The classification of urinary albumin excretion in a male and female was demonstrated
in (Table 3.2) (de Jong & Curhan, 2006). 10μl from each reduced BSA sample and the
P sample were run in 12% SDS-PAGE gel and stained with coomassie blue stain (figure
3.3 A).
The gel was scanned, the band density areas were measured by using ImageJ2 software
and the standard curve was plotted by Graph prism 6 software (figure 3.3 B). Then, a
formulated standard curve was used to determine the albumin concentration of the P
sample. The P sample had ~ 12.7822 mg/L (high normal) by calculating the albumin
concentration from the standard curve. So, the patient had no albuminuria.
Previous studies such as (Li et al., 2008) purified LCs to use in their studies from the
urine of multiple myeloma patients with myeloma kidney, but with minimal or no
albuminuria to exclude patients with significant glomerulopathy and all LCs considered
tubulopathic. That means they affected the tubular cells, and that was what we focused
on in this project.
103
Albumin (mg/L)
Normal <10
High normal 10 to < 20
Micro albuminuria 20 to < 200
Macro albuminuria > 200
Table (3.2): The classification of urinary albumin excretion.
0 50 100 150 200 2500
1000
2000
3000
BSA
Conc mg/L
Area o
f D
en
sit
y
1 2 3 4 5 P
B A
( k D a )
2 5 0
1 5 0
1 0 0
7 5
5 0
3 7
2 5
2 0
1 5
1 0
Figure (3.3): Estimation of albumin concentration in MM patient urine sample.
(A) Coomassie blue 12% SDS-PAGE gel shows the known BSA concentration
samples with molecular weight ~68kDa from 1 to 5 (5, 10, 20, 100 and 200
mg/L), (P) the patient sample (10μl reduced condition) with the albumin band
appear in the same size of the BSA bands. (B) The plotted BSA standard curve
involving the five BSA points. The orange circles indicate pipette excision of
protein samples that were sequenced by the MALDI-TOF method.
104
3.5 Protein sequencing:
The high molecular weight proteins bands in the P sample were sequenced to identify
the type of proteins that were excreted in the urine of the myeloma patient with the light
chain (figure 3.3 A). Protein sequencings were performed in the University of Leicester
Protein Nucleic Acid Chemistry Laboratory (PNACL) by MALDI-TOF technique.
3.5.1 Gel Digestion Protocol (Protein Digestion):
The gel plug was placed into a 200μl reaction tube and washed with 100μl of
ammonium bicarbonate (400mM): 100% acetonitrile in a ratio of 1:1 twice for 20min
each to equilibrate (pH 8.0) and to remove the coomassie blue staining. After that, it
was washed briefly with 100μl acetonitrile to remove aqueous solution, and then the
plug was shrunk by washing in 100μl acetonitrile for 10-15min and dried for 10min.
Next, the 100μl of dithiothreitol solution (10mM) in ammonium bicarbonate (50mM)
(w/v) (DTT, Calbiochem) was added for 30min at 60C˚ in a heat block. The liquid was
removed without shrinking the gel and 100μl of iodoacetamide solution (100mM) in
ammonium bicarbonate (50mM) (w/v) was added for 30min at RT in the dark (these
two steps were repeated twice).
Afterward, the sample was washed briefly with 100μl acetonitrile twice for 10-15min
and left to dry for 10min to remove all of the acetonitrile. 10μl of trypsin solution
(containing 50mM ammonium bicarbonate) (v/v) was added (Modified Porcine Trypsin,
Promega) and the sample was then incubated at 37C˚ in a heating block for 3h. Then,
2μl of neat formic acid was added, mixed and left for 20min. Finally, the sample was
sonicated in an Ultrasonic Bath for 10min (optional). A 0.5𝜇𝑙 spot was washed with
ammonium phosphate (10mM) and left to dry. The sample is ready for the MALDI-
TOF or LC-MS/MS technique.
105
3.5.2 Matrix Assisted Laser Desorption/Ionization - Time-of-Flight
(MALDI-TOF):
The digested peptides were analysed using MALDI-TOF mass spectrometry. The
sample peptides were mixed 1:1 with the matrix mixture (α-cyano-4-hydroxycinnamic
acid (sigma) (10mg/mL in 0.1% Trifluoroacetic acid (TFA)/50% acetonitrile), and were
spotted onto a 96 well hydrophobic coated MALDI target plate using the drying droplet
method. The peptides were analysed using a Voyager DE-STR MALDI-TOF mass
spectrometer (Applied Biosystems). Spectra were acquired in the reflector mode, with
positive polarity between the mass ranges of 700 - 4000Da; an average of at least 500
laser shots were acquired. The spectra were analysed using Data Explorer software
(Applied Biosystems). Peptide Mass Fingerprint Database Search was carried out using
Mascot database search.
3.5.3 Results of MALDI-TOF MS analyses:
The protein samples from figure 3.3 were both identified as Serum Albumin ~68kDa, as
expected.
3.6 Extraction of protein from the urine sample:
The methodology of light chain purification overview presented in (figure 3.12).
Following methodology, standard proteins were initially precipitated with 70% (w/v)
saturated ammonium sulphate (MELFORD, A0502) in nanopure H2O overnight at 4C˚.
Afterward, the precipitated proteins were collected in 50ml tubes and centrifuged for
30min at ~1800 x g; the supernatants were then discarded and the pellets were collected
for dialysis against dH2O for 24h at 4C˚ with stirring. Cellulose dialysis membrane
tubes with a cut off of 12,000 to 14,000 Daltons were used (MEDICELL international
Ltd Dialysis Tubing-Visking, Cat no. DTV.12000.01), they were boiled in 50mM
EDTA pH 8.0 for 2min, and subsequently rinsed with dH2O. After the first 24h of
dialysis, the proteins were dialysed against 0.01M sodium phosphate buffer pH 9.0
(Table 3.3) for 24h at 4C˚ with stirring. Next, the protein solutions in dialysis tubes
106
were collected in fresh tubes, and 20µl from the urine sample before and after dialysis
were run in 12% SDS-PAGE and stained with coomassie blue to be compared (figure
3.4 A and B).
Table (3.3): preparation of 1M Sodium Phosphate Buffer pH 9.0.
1M Sodium Phosphate Buffer pH 9.0
178g of Na2HPO4
I L dH2O
The pH was adjusted with HCL
( k D a )
2 5 0
1 5 0
1 0 0
7 5
5 0
3 7
2 5
2 0
1 5
1 0
Figure (3.4): The purified free light chain (A) Original proteinuria
sample and (B) protein sample after dialysis separated in 12% SDS-
PAGE and stained with coomassie blue (20µl reduced condition).
Major Free Light Chain protein at 25kDa is clearly visible.
107
An ion exchange chromatography column was utilised to separate the proteins
according to the interactions between the charge of protein and the charge on the resin;
the monoclonal FLC is likely to be a negatively charged protein (cation).
To pilot binding different sample types (urine, protein after precipitation with 70%
saturated ammonium sulphate and protein after dialysis) were used with different ion
exchange anion resin, such as Diethylaminoethyl-cellulose (DEAE-cellulose) (Sigma D-
8382), Sepharose 4B (Sigma) and P Sepharoes with sodium phosphate buffer of
different pH 7.6, 8.0 and 8.5.
1ml of resin in column (BIORAD, Poly-Prep Chromatography column, Cat no. 731-
1550) was washed and equilibrated with 10ml of (100mM then 10mM) sodium
phosphate buffer for each resin with different a pH level starting with 7.6, 8 and 8.5.
Then, 2ml, 0.5ml and 0.5ml different pH protein samples, diluted 1:4 with (10mM)
sodium phosphate buffer, were loaded in the column. The flow through was collected
and the column was washed with 10ml of (10mM) sodium phosphate buffer to remove
the remaining non-bound proteins. After that, the column was eluted with 10ml of (1M)
NaCl in sodium phosphate buffer (w/v) (ACROS). The flow through and eluted samples
were run in 12% SDS-PAGE gel and stained with coomassie blue as described. The
protein of interest (FLC) did not bind to any resin (figure 3.5).
In 1989, Norden and his group demonstrated that the isoelectric point (pI) of LC from
MM patients was in the range of 5.0-7.5. Due to this, protein separation can be achieved
based on the pI of the protein. The pH of the sodium phosphate buffer was increased to
pH 9.0; the volumes of protein samples that loaded in the column were optimised
(figure 3.6), achieving around 99% of FLC binding to Q Saphrose Fast Flow beads (GE
Health Care Life Science 17-0510-01) and eluted with 10ml of 1M NaCl with 1:4
diluted sample in 0.01M sodium phosphate buffer (figure 3.7).
108
Figure (3.5): Comparison of FLC binding to different resin types using dialysis
urine sample with pH 7.6 sodium phosphate buffer in 12 % SDS-PAGE stained
with coomassie Blue reduced condition. (1) Original proteinuria sample, (2, 3 and
4) The flow throw the column after loading proteinuria sample (unbound proteins)
in P Sepharose, Sepharose 4B and DEAE cellulose, respectively. (5, 6 and 7) the
eluted (bound proteins) with 1M NaCl to the resin P Sephrose, Sepharose 4B and
DEAE cellulose, respectively.
( k D a )
2 5 0
1 5 0
1 0 0
7 5
5 0
3 7
2 5
2 0
1 5
1 0
1 2 3 4 5 6 7
2 5k Da
FL C
109
C A B
( k D a )
2 5 0
1 5 0
1 0 0
7 5
5 0
3 7
2 5
2 0
1 5
1 0
1 2 1 2 1 2
2 5k Da
FL C
Figure (3.6): Optimizing the volumes of dialysed protein sample loaded in 1ml Q
Sepharose Fast Flow column for better binding. (A) 2ml, (B) 0.5ml, (C) 0.5ml
diluted 1:4 in 0.01M sodium phosphate buffer pH 9.0. (A1, B1 and C1) show the
unbound proteins. (A2, B2 and C2) show the bound proteins (FLC) to the resin
and eluted with 1M NaCl. 12% SDS-PAGE analysis and coomassie blue staining
for (20 μl from each sample in reduced condition).
110
Figure (3.7): Electrophoretic (SDS-PAGE) final analysis of FLC purification.
(1) The original urine sample. (2) The dialysed sample. (3) The 1:4 diluted sample
in 0.01M sodium phosphate buffer pH 9.0. (4) The unbound proteins to the Q
Sapharose Fast Flow beads column. (5) The FLC bound to the column and eluted
with 1M NaCL.
( k D a )
2 5 0
1 5 0
1 0 0
7 5
5 0
3 7
2 5
2 0
1 5
1 0
1 2 3 4 5
2 5k Da
FL C
111
Next, a high-performance liquid chromatography (HPLC) system was used to purify
FLC from the mixture of proteins in the urine sample. The sample (dialysed proteins)
was diluted 1:2 in sodium phosphate buffer pH 9.0 and loaded by the pump to the
column (GE Healthcare Bio-Science AB) that contained 20-30ml Q Saphrose Fast Flow
beads. The column was washed with 40ml 0.01M sodium phosphate buffer pH 9.0 (low
salt buffer), 40ml 1M NaCl in 0.01M sodium phosphate buffer pH 9.0 (high salt buffer)
then low salt buffer again to be equilibrated and be ready to use (buffers should be
filtered to be degased). After loading the sample in the column (50ml in each
purification run) 40ml of 0.01M sodium phosphate buffer pH 9.0 was loaded to wash
and remove the unbound proteins. The bound proteins were collected as a 1.5ml/min
fraction in 1.5ml fresh reaction tubes by eluting with increasing NaCl concentration for
45min from 0 to 100%. Elution was monitored by measuring the absorbance at 2400
mAU (figure 3.8). The collected fractions were run in 12% SDS-PAGE gel (in reduced
condition) and stained with coomassie blue. The protein samples were contaminated
with high and low molecular weight proteins (figure 3.10 A). The fractions, which had a
very high concentration of FLC, were collected and pooled together (figure 3.10 A from
fraction 1 to fraction 12). The Superdex 200 16/60 column was used to purify the target
protein (FLC) by size (GE Healthcare Life Science, HiLoad 16/600 Superdex 200 pg).
This type of column is designed for a high-resolution preparative gel filtration
chromatography (figure 3.9). The column was washed with filtered PBS, and then 5ml
of the sample pooled from fractions was loaded each time in the column due to the
limited capacity of the column. Then, again the samples were collected as 1.5ml/min
fractions in 1.5 ml eppendorf tubes (figure 3.9) and run in 12% SDS-PAGE gel and
stained with coomassie blue. Figure 3.10 C shows FLC purified by ~95% from low and
high molecular weight proteins. (Thanks for Professor Russell Wallis and Dr. Chris
Furze for their help in HPLC).
112
Figure (3.8): Chromatogram of Ion exchange column High-performance liquid chromatography (HPLC) system. Fifty ml of 1:2 diluted
FLC sample in sodium phosphate buffer pH 9.0 was run through the Ion exchange column (Q Sepharose Fast Flow resin). Brown line is
conductivity; Blue line UV absorbance (mill absorbance units (mAU)); Green line % elution buffer (1M NaCl).
113
Figure (3.9): Chromatogram of removal of impurities from FLC sample by size exclusion High-performance liquid chromatography
(HPLC) system. Collected and mixed FLC fractions from the Ion exchange column were loaded in Superdex 200 16/60 column. The first
two small peaks separate the high molecular weight proteins. Fractions from 35-45 contain FLC.
114
1 2 3 4 5 6 7 8 9 1 0 1 1 1 2 1 3 1 4 1 5 1 6 1 7 1 8
( k D a )
2 5 0
1 5 0
1 0 0
7 5
5 0
3 7
2 5
2 0
1 5
1 0
1 2 3 4 5 6 7 8 9
( k D a )
2 5 0
1 5 0
1 0 0
7 5
5 0
3 7
2 5
2 0
1 5
1 0
1 2 3 4 5 6
C B
Figure (3.10): SDS-PAGE analysis for fractions
eluted from Ion exchange column 1.5ml/min. (A)
2µl from each fraction appears as a peak in figure
(3.11) the FLC protein is co-purified with unknown
higher and lower molecular weight protein.
Fractions 1-12 have high concentration of FLC
(they were collected and mixed for the Superdex
200 16/60 column. (B) 2µl from each fraction
appears as a peak in figure in non-reduced
condition. (C) 2µl from the same fractions in B in
reduced condition shows ~95% purified FLC.
Reduced: the sample boiled for 5mints at 95C ̊ with
loading dye has DTT to breakdown the sulphate
bound. The orange circles indicate the samples
taken to sequence analysis.
115
3.7 Purified FLC Protein Sequencing:
From the ~95% purified FLC that was run in 12% SDS-PAGE gel (non-reduced
condition) and stained with coomassie blue two spots were sequenced; the first one
from the band ~ 50kDa and the second one from the band (~ 25kDa). This was done by
the liquid chromatography–mass spectrometry (LC-MS/MS) technique (figure 3.10 B).
At the beginning the spot samples were digested as described previously (See 3.5.1).
Afterward, the LC-MS/MS was performed by using an RSLCnano HPLC system
(Dionex, UK) and LTQ-Orbitrap-Velos Mass Spectrometer (Thermo Scientific).
3.8 RSLCnano HPLC System:
To separate the protein peptides mixture, samples were loaded onto a Reverse-Phase
Trap Column (0.3mm ID x 1mm) (5μm particle size, 300 Å pore size, Acclaim PepMap
C18 media (peptide) (Dionex) and maintained at a temperature of 37C˚). The loading
buffer was (0.1% formic acid / 0.05% trifluoroacetic acid / 2% acetonitrile).
The protein peptides were eluted from the trap column at a flow rate of 0.3µl/min and
through a Reverse-Phase PicoFrit Capillary Column (75μm ID x 400mm) (Symmetry
C18 media, 100 Å pore size (Waters, UK)) that was packed in-house using a high-
pressure device (Proxeon Biosystems, Denmark). Peptides were eluted in 2h.
3.9 LTQ-Orbitrap-Velos Mass Spectrometer:
After peptide separation, they were characterised and identified using mass
spectrometry, which is a technique where the ratio between the mass and the charge
(m/z) of ionized molecules in the gas phase is measured. Generally, a mass spectrometer
consists of an ionization source, mass analyzer and detector (Gris & Baldoni, 2013).
116
The separated peptides from the column were sprayed directly into the nanospray ion
source of the LTQ-Orbitrap-Velos mass spectrometer. In this stage the molecules were
ionized and transferred to the gas phase. Then they were moved to the mass analyzer,
where the ions formed were separated with their m/z ratios and later detected.
3.10 LC-MS/MS Sequance Results:
The data was analysed using Scaffold Q+S4 (version 4.0.5, Proteome Software). The
two sequenced bands in (figure 3.10 B) were identified as a dimer (~50kDa) and
monomer (~25kDa) shapes for Ig Lambda-Light Chain-2 constant region (𝜆-LC-2).
The protein sequence and the number of peptides matching for both bands based on
(~82 %) identity match (figure 3.11) (highlighted in yellow).
3.11 Protein Concentrate column:
The protein samples were concentrated using Millipore's Amicon® Ultra-15 centrifugal
filter devices column for volumes up to 15ml with a 10K membrane cut off. The
purified protein fractions from the Superdex 200 16/60 column were each collected in
15ml amounts together as one sample. Then, the concentration of each sample was
measured by Nano-drop machine (Thermo Scientific) at A280 nm absorbance and stock
concentration was decided to be 100mg/ml for simple dilution calculations in the
experiment later.
G Q P K A A P S V T L F P P S S E E L Q A N K A T L V C L I S D F Y P G A V T V A W K A D S S
P V K A G V E T T T P S K Q S N N K Y A A S S Y L S L T P E Q W K S H R S Y S C Q V T H E G S T
V E KT V APTECS
Figure (3.11): Protein Sequence Coverage , 87/106 amino acid (~82%), (covered
locations were indicated in yellow).
117
The volume of the 𝜆-LC sample with 100mg/ml concentration was loaded to the column
and centrifuged at 3,000 × g for 30-45min. Once the desired concentration was achieved
(100mg/ml) the protein was recovered from the bottom of the unit in eppendorf tubes.
3.12 Endotoxin Measurement:
Endotoxin is a lipopolysaccharide (LPS) found in the outer cell wall of all gram-
negative bacteria. Even a small amount of endotoxin can cause interference in vitro
stimulation with purified proteins (activation, toxicity). As the monoclonal 𝜆-LC protein
will be used in tissue culture experiments, it was critical that the 𝜆-LC should be free of
endotoxin. A quantitative, chromogenic Limulus amoebocyte lysate (LAL) assay kit
(PierceLAL Chromogenic Endotoxin Quantitation Kit, Thermo Scientific, Cat
no.88282) was used to test and measure the presence of endotoxin in the FLC purified
sample. This assay uses the reaction of endotoxin with LAL to activate protease enzyme
that acts on a synthetic substrate to produce a yellow colour.
A 96 well plate was warmed for 10min at 37C˚. A standard was prepared in duplicate,
ranging from 1.0 - 0.1 Endotoxin Units (EU)/ml. 50 𝜇𝑙 of the 𝜆 -LC were tested.
Endotoxin free water was the negative control. After 5min at 37C˚, 50μl of LAL was
added to each well and incubated for 10min at 37C˚. Then 100μl/ well of substrate
solution was added and the plate was incubated for 6min at 37C˚. Finally, 100μl/well of
stop solution (25% acetic acid in dH2O (v/v)) was added. The plate was measured in the
plate reader at 405nm. The Endotoxin level in the 𝜆-LC was shown to exceed 1.0
EU/ml. One EU being equal to ~0.2ng endotoxin/ml; an approximation for the tested
samples is at least 0.4ng/ml endotoxin (Done by Dr. Cordula Stover).
(Sigma, http://www.sigmaaldrich.com/life-science/stem-cell-biology/3d-stem-cell
culture/learning-center/what-is-endotoxin.html).
118
3.12.1 Endotoxin Removal:
Endotoxin was removed from the 𝜆 -LC by using Pierce High-Capacity Endotoxin
Removal Spin Column 1.0ml (Thermo SCIENTIFIC, Cat no. 88276).
The column was equilibrated to RT and centrifuged for 1min at 500 x g to remove the
storage solution. Then, the column was regenerated by adding 8ml of 0.2N NaOH in
95% ethanol, incubated for 2h at RT and centrifuged at 500 × g for 1min to remove the
NaOH. After that, 8ml of 2M NaCl in endotoxin free water (w/v) (Sigma, Cat no.
95289), was added to the column, suspended and centrifuged. Next, 8ml of endotoxin
free water was added, suspended in the column and centrifuged. Afterward, 8ml of
150mM NaCl in PBS (w/v) was added to the column, suspended and centrifuged. Up to
10ml of the sample was added to the resin. After 1h of gentle mixing at 4C˚ the column
was centrifuged at 500 × g for 1min to collect the sample and stored in -20. All the
equipment that used was endotoxin free. The Endotoxin level in the 𝜆-LC was measured
after endotoxin removal and the result showed very low endotoxin level below 0.1
EU/ml (lower than ~ 0.02 ng endotoxin/ml).
3.13 Human Serum Albumin Devoid of Fatty Acids:
Albumin is the most extensively studied protein as it is by far the most abundant protein
in nephrotic urine. This project will examine the role of albumin overloading and
PTECs damage. In progressive renal disease, PTECs are exposed to high levels of
filtrated albumin. The effect of overloading albumin on the viability of HK2 (+/-GF)
cells will be measured by different assays in order to establish a model and then to study
disease mechanisms using this in vitro model. Albumin that is essentially free of fatty
acid will be used to exclude toxic effects of fatty acid. Albumin, normally, is a carrier
for fatty acids (FA) and previous studies have documented a tubule toxic effect of FA
carrying albumin in vitro at 24h of stimulation using primary human PTC (Arici et al.,
2003) .
119
Newman et al., 2000 used human serum albumin 95% pure and free of fatty acid in
concentrations from (0.05 to 5mg/ml) to cover the range of the normal and the
pathological condition in kidneys according to their calculation. However, they failed to
detect any significant effect from the albumin on HK2 cell proliferation after 8h
stimulation time. They suggested to use higher concentrations of albumin to inhibit
HK2 cells proliferation. Based on these studies, the concentrations of the albumin used
in our studies were chosen to target the pathological condition in kidneys and
inflammatory response.
3.14 Calculation of protein load:
The human serum albumin utilised in this project is more than 95% pure and essentially
fatty acid free (Sigma, Cat no. A1887). The stock concentration was 500mg/ml, using
endotoxin free water. After filter sterilisation, aliquots (500mg/ml) were stored at -20C˚.
The (5mg/ml) LC concentration chose depend on the LC concentration in the urine of
MM patients.
120
Urine sample from
MM patient had
(5g/L) free light chain
The sample was precipitated
in 70% saturated ammonium
sulphate for 24h at 4C˚
Precipitated proteins were dialysed
against 0.01M Sodium phosphate
buffer pH 9.0 for 24h at 4C˚
HPLC
was used
to purify
FLC (Ion
exchange
column)
The Superdex 200 16/60
column
The purified FLC was concentrated by
centrifugal filter devices column
The endotoxin (LPS) was
measured and removed from
the concentrated sample
The sample ready to use in the
tissue culture after filtration
(stored at -20C˚)
Figure (3.12): Methodology of Monoclonal Free Light Chain Protein Purification.
121
Chapter Four- Characterisation of Renal
Proximal Tubular Epithelial Cells
122
4. Introduction:
The kidney is key in cleansing the blood of otherwise toxic substances and producing
hormones such as erythropoietin and vitamin D metabolite (Van der Hauwaert et al.,
2013) Proximal tubules form a significant portion of the kidneys, and proximal tubule
epithelial cells are the most abundant cell type in kidneys (Nakhoul & Batuman, 2011)
and play a major role in the reabsorption of larger and smaller proteins such as albumin
(68kDa) and free light chain (FLC, 25kDa). Additionally, proximal tubule cells are
specifically sensitive and represent a primary target for toxins that effects can extend to
kidney failure (Van der Hauwaert et al., 2013). To study cellular effects of protein
uptake, human proximal tubular cells (HK2) were used.
This project has modeled the experimental designs on published work: a cell line HK2
was established and studied for the effects of different proteins overload such as FLC
and albumin.
As described in material and method (2.1), HK2 cells were grown in a medium
supplemented with an EGF cocktail that is favourable for cell differentiation, to study
the effects of the EGF cocktail on the HK2 cells proliferation and their response after
being exposed to pathological concentrations of FAF-HSA and 𝜆-LC proteins. They
were compared to HK2 grown in the absence of the EGF cocktail in their growth
medium. Also, mouse primary proximal tubule epithelial cell cultures were grown in a
medium with the EGF cocktail as a control for several experiments.
4.1 Aim:
The goal of the present study was initially to characterise features of the human
proximal tubule epithelial cell line (HK2) and mouse primary proximal tubule epithelial
cell (mPTEC) and to determine the effect of EGF cocktail on HK2 cells and their
differentiation.
123
4.2 Results:
4.2.1 Culture characteristics of Human Renal Proximal Tubular
Epithelial Cell line (HK2):
A sub confluent monolayer of HK2 cells was achieved in approximately one week when
seeded in a 75cm2 flask (figure 4.1 A). After 10 days of culturing the cells in (figure 4.1
B) show confluency, high cell density, and formation of typical domes (arrows). The
presence of domes is a routine feature of HK2 cells and is a hallmark of cultured renal
epithelial cells.
Domes are out-of-focus areas of the cell monolayer seen upon light microscopy
analysis. They are formed where fluid has become trapped underneath the monolayer
because of the active transport of ions and water across the cell monolayer. This is
thought to occur because of the typical apical to basolateral transport found in epithelial
cells. In a culture, this leads to local detachment of the monolayer from the plastic flask
surface, forming a raised area with an underneath reservoir of accumulated fluid (Kim
et al., 2002). The HK2-GF cells have the same culture morphology and dome
formations of HK2 features (data not shown).
Cells seem metabolically very active, as the phenol red containing medium acidifies
quicker than in other fast growing cultures such as J774 or HepG2.
124
10 X
Domes
Figure (4.1): Microscopic appearance of HK2 cells. (A) Shows HK2 cells grown
at low and (B) at high density. Cells are polygonal, sometimes spindle shaped (A)
and produce three-dimensional outgrowths, so-called domes (B) after about 10
days.
10 X 40 X
125
4.2.2 Transmission Electron Microscopy analysis (TEM) for HK2 cell
line:
For TEM, HK2 (+/-GF) cells were harvested by trypsin and fixed. The process carried
out by Natalie Allcock of the Electron Microscopy Laboratory, University of Leicester.
Figure (4.2) demonstrates the control HK2-GF cells; (A1) shows ultrastructural
evidence of microvilli reminiscent of brush border and (A2) nucleus in early prophase
of mitosis, because the chromosomes are visible. Numerous mitochondria are present in
figure 4.2 (B1), consistent with a metabolically active cell. Additionally, vacuoles are
typically found (figure 4.2 (B2)) (Liu et al., 2009). Figure 4.2 (C) shows the image of
the HK2 cell line, which has the same HK2-GF cell features that are explained in
figures 4.2 (A and B).
5 𝝁𝑴
1
2
126
5 𝝁𝑴
Figure (4.2): Transmission electron microscopy (TEM) for HK2 (+/-GF) cells.
They were harvested by trypsin, spun, and fixed. (A) HK2-GF and (C) HK2 cell
line. (A) Shows ultrastructural evidence of microvilli (1), nucleus (2) and (B)
Shows numerous mitochondria, consistent with a metabolically active cell (1) and
vacuoles of varying electron densities (2).
1𝝁𝑴
1
2
127
4.2.3 Scanning Electron Microscopy (SEM) analysis for brush border
of HK2 (+/-GF) cells:
SEM was used to visualise the basic characteristics of HK2 cells and in comparing the
cell surface of HK2 and HK2-GF cells; also, to evaluate the brush border that was made
by thousands of microvilli on the apical surface of epithelial cells.
All cells were cultured to confluence on glass cover slips in 12 well plates and fixed.
Then they used for electron microscopy, the subsequent procedure was carried out by
Natalie Allcock of the Electron Microscopy Laboratory, University of Leicester.
Images in (figure 4.3) characterise the observed morphology of HK2 cells. The brush
border is a typical differentiation of proximal tubule cells and microvilli constituents
appear clearly in HK2 cells (figure 4.3 (A2)). As well, (figure 4.3 (A2)) shows a
connecting net between the cells. Moreover, HK2 cells at 10μm magnification show
some ruffles and protrusions (figure 4.3 (A3)) and at higher magnifications (5 and 3μm)
typical microvilli appear on the cell surface (figure 4.3 (A4 and 5)).
On the other hand, images of HK2-GF first appear to be densely grown in (figure 4.3
(B2)) and in a possible dome formation (figure 4.3 (B3)). At 20μm magnification, cells
show ruffles, protrusions and densely packed microvilli (figure 4.3 (B4, B5 and B6)).
There was a difference in microvilli density between the HK2 and HK2-GF cells. The
HK2-GF showed densely packed microvilli compared to HK2 cells when focusing at
5μm magnification. This difference appears clearly by comparing (A5 to B6) in figure
4.3.
128
Microvilli
HK2 Cells
1
5
4 3
2
129
Microvilli
HK2-GF Cells
6 5
4 3
2 1
130
4.2.4 Villin-1 – A marker of brush border differentiation in renal cells:
Villin-1 is a specific protein marker for microvilli in tubular brush border cells. It
belongs to the actin-binding protein family. Villin-1 plays a role in the initiation,
organization, and formation of microvilli at the apical membranes of cells in developing
proximal tubules (Kang & Lee, 2014). Western blot was used to detect Villin-1 protein
expression from HK2 (+/-GF) cells. The cells were sub cultured in 6 well plates till 80%
confluence; cells were lysed and separated by SDS-PAGE as described in materials and
methods (see 2.9.3). Fresh mouse cortex and HEK293 cell lysates were used as positive
controls for mouse and human Villin-1 expression. A Villin-1 reactive band was
detected in the HK2-GF lysate and a fainter band in the HK2 cell lysate at the same size
of 95kDa, compared to the positive control HEK293 cells. Additionally, a clear band
was detected from the mouse cortex lysate. The same membrane was re-probed with β-
actin antibody to show protein loading (figure 4.4).
HK2-GF HK2 HEK293 Cortex
Villin-1
95kDa
𝜷-Actin
42 kDa
Positive controls
Figure (4.3): Typical scanning electron micrographs showing microvilli on the
surface of HK2 cells grown in a standard medium (A) or in cells in medium
supplemented with EGF (B). The cells were cultured in 12 well plates to achieve
80% confluency before fixing and processing of coverslips for SEM. Dome
formation is captured for cells grown in the presence of the EGF cocktail. In this
area, microvilli formation is particularly dense.
131
4.2.5 Mouse Proximal Tubular Epithelial Cells (mPTEC) preparation:
In some studies, to investigate or assess mechanisms of PTC physiology and
pathophysiology, primary cell culture systems can be helpful and are normally utilised
to avoid the complexity of whole organ or whole animal experiments. However,
isolation and preparation of primary cell cultures like mice has many disadvantages
such as a modest yield of PTC populations, contamination with other cell types (impure
culture) and they take a long time to grow. So, mouse PTCs were prepared to use as
positive control for some experiments in this project, and the initial idea to stimulate
them with albumin was abandoned.
Figure 4.5 illustrates the steps of isolation of the mPTEC culture obtained from the renal
cortex of C57BC/6 mice and was successfully grown to confluence. Figure 4.5 shows
(1) the morphology of isolated mouse renal tubules after sieving, (2) adherent polygonal
cells after 5 days plating the collagenase digest (3) confluent monolayer mPTECs
culture at days 7-10 and (4) cobblestone morphology with domes that have been
reported as a hallmark of mPTECs, which are partly a consequence of high cell density.
Figure (4.4): Western blot analysis of Villin-1 as a marker of brush border
differentiation. 20𝜇g of HK2 (+/-GF) was loaded in 12% SDS-PAGE gel. In
addition, mouse cortex and HEK 293 cell lysates were used as positive controls.
HK2-GF cells show more Villin-1 expression compared to HK2 cells. This
antibody crosses react (mouse and human). These Western blots are
representative of two individually performed experiments. The size of the Villin-1
band is as expected (same in the manufacture data sheet). The same protein
concentration was loaded from each sample (20𝜇𝑔) and β-actin was used to show
protein loading.
132
10 X
40 X
20 X 20 X
10 X
Tubule
Dome
1
2 3
4
Figure (4.5): Microscopic documentation of isolation of murine renal tubules (1),
outgrowth of adherent polygonal cells after 5 days (2), (3) confluency of cells
showing vacuolar inclusions after 7-10 days of incubating, evidence of lack of
contact inhibition at high cell densities after 10-14 days, dome formation (4).
133
4.2.6 Alkaline phosphatase enzyme marker of proximal tubular cells:
Alkaline phosphatase (ALP) is a normal constituent of the proximal tubular brush
border membrane. Kidneys were removed from C57BC/6 mouse, sectioned and reacted
with BCIP/NBT substrate to detect ALP in the cortex.
The representative image in figure 4.6 (A1) shows a positive blue area in the cortex of
the kidney section, which contains the renal tubules, indicative of ALP detection,
compared to the area of kidney medulla in the section with no blue staining. The area
with ALP detection appeared clear in higher magnifications 10X (A2) and 40X (A3),
respectively. 1% Neutral Red was used as a counterstain.
Figure 4.6 (B) demonstrates mPETCs, which were used as positive control for ALP
expression. They were prepared from C57BC/6 mouse kidneys as described (material
and methods, see 2.3.3). When mPETCs and HK2 cells in figure 4.6 (B and C) became
confluent in the 6 well plates, they were fixed and stained for ALP activity with a
Magenta substrate solution.
As shown in figure 4.6 (B1) the intensity of the staining was varied, with areas of
intense red or purple staining being separated by areas of less intense or no staining.
The amount of alkaline phosphatase positive cells varied and this may be due to the age
and confluency of the culture (Ryan et al., 1994). In contrast, all HK2 cells consistently
showed uniform staining for ALP (figure 4.6 (C)). Methyl green stain (Green colour
area) was used as a nuclear counterstain.
134
40 X
4 X 10 X
1
3
2
Cortex
Medulla
4 X 10 X
1 2
135
4.2.7 Human Proximal Tubule Epithelial cell culture:
The HK2 cell line was maintained as individually adapted sub-lines. One type was
grown in the medium supplemented with an EGF cocktail (HK2-GF), which was used
for primary proximal tubule epithelial cell culture, and the second type without an EGF
cocktail (materials and methods, see 2.1). HK2-GF cells grew and divided quicker than
HK2 cells. Also, they become confluent and formed domes faster. To study the HK2
(+/-GF) cells proliferation, both cell types were sub cultured with (2,500 cells/well)
density, incubated for different times, and the cell viability was indirectly determined by
MTT, crystal violet and LDH assays. Both cell types were sub cultured and analysed for
the proliferation experiments at the same time. HK2 (+/-GF) cells were initially
measured by adding the MTT solution to the cells after each time point figure 4.7 (A).
Figure (4.6): Histochemical alkaline phosphatase staining (ALP). (A) Paraffin
kidney section (5 micron) from wild type mice for brush-border ALP detection by
using (BCIP/NPT) substrate, which reacts with ALP, a marker enzyme for brush-
border, and become insoluble blue or black precipitate (the red arrow indicates the
area in (A1)). For the nuclear counterstain 1% Neutral Red stain was used (the red
area). Cytochemical staining for ALP activity, which is typically found in brush
border of epithelial cells with microvilli like (B) mPTECs and (C) HK2 cells. The
red or pink areas indicate the ALP activity. Methyl green stain (Green colour) was
used as a nuclear counterstain. There is a mixed population of cells positive for
ALP activity (A and B), with marked extent of enzymatic activity where cell
densities are high (B).
20 X
136
The mitochondrial activity of HK2-GF was increased significantly, double than of the
HK2 cells from the first 24h incubation, and this cell mitochondrial activity increased
with an increase in cell numbers; with HK2 (+/-GF) the mitochondrial activity increases
steadily with the time, but significantly more in HK2-GF. Similarly, cell viability was
determined by staining the cells after each time point, using crystal violet, which stains
the DNA of the adherent live cell.
Figure 4.7 (B) shows the number of the HK2-GF cells elevated gradually and
significantly more with time, compared with HK2 cells that increased and divided more
slowly. Lastly, cell proliferation was indicated by the LDH biomarker that can be
quantified in cell supernatant, which is normally released from injured or dead cells, for
the same experiment that was used to detect the cell viability indirectly by the MTT and
crystal violet to be comparable. As shown in figure 4.7 (C) by measuring the LDH
release from HK2 (+/-GF) cells after each time point, the LDH level increased
significantly with time in the HK2-GF cells compared to the HK2 cells after 96h.
Additionally, LDH released from the HK2 cells did not change in the first three days,
compared to the HK2-GF cells that showed more of an increase over the same three
days. For future stimulation work, the MTT and LDH release assays were chosen to
measured mitochondrial activity and cytoplasmic leakage, respectively.
In summary, by characterising the morphology and enzyme markers of HK2 (+/-GF)
cell line in this chapter, they appeared to be appropriate tool to study the cell injury and
repair in this project to establish the protein overload model in vitro and to study the
effect of proteinuria conditions on proximal tubular cells in kidney diseases.
137
Crystal Violet
24
h
48
h
72
h
96
h0.0
0.1
0.2
0.3
0.4
0.5
OD
(520 n
m)
HK2-GF
HK2
**
**
*
MTT assay
24h
48h
72h
96h
0.0
0.2
0.4
0.6
0.8O
D (
550
nm)
HK2-GF
HK2
***
**
*
**
138
Figure (4.7): Differences in proliferation in HK2 and HK2-GF cells. Cells were
grown for 24, 48, 72 and 96h at a density of 2500 cells/well in their respective
medium and different measures of proliferation were determined after each time
point using (A) MTT assay (Mitochondrial cell activity), (B) Crystal Violet (Cell
adherence) and (C) LDH assay (Cytoplasmic leakage). For LDH assay (C) the
supernatants were collected from the same cell experiments that were used to
detect the cell viability by MTT assay (A) and crystal violet (B) to be comparable.
The data are represented as means of triplicates ± SD (n = 2) (Unpaired t test P <
0.05).
C LDH assay
139
4.3 Discussion:
Proximal tubule epithelial cells (PTECs) are distinctly involved in renal disease because
of their sensitivity to injury (Liu et al., 2009). To create a protein overload model for
this project, which would allow for studying the PTECs physiology, injury and repair,
an isolated cell system was exposed to proteins PTECs might normally find themselves
exposed to.
Nowadays, there are many sources for human renal proximal tubule epithelium cells,
such as renal cell lines and primary cultures that are used for renal physiology and
nephrotoxicity studies (Van der Hauwaert et al., 2013). However, each source has
many advantages and disadvantages.
There are common problems with primary PTECs cultures such as the difficulty in
establishing pure PTECs cultures; the culture may be contaminated with different types
of kidney cells like distal nephron. Additionally, it is difficult to have high cell density
and reproducible characteristics from human primary PTECs cultures (Qi et al., 2007).
Also, commercial human PTECs cultures are very expensive and limited passage
numbers necessarily have the consequence of limiting the number of experiments.
The laboriousness of repeated isolation and confirmation of preparation uniformity
(Ryan et al., 1994) and inter individual differences adding to the inherent variation
when using this source (Van der Hauwaert et al., 2013) make alternatives attractive.
One of the advantages of using HK2 and HEK 293 cell lines is that they are easy to
grow for in vitro studies (Van der Hauwaert et al., 2013). However, in 1994 Ryan et al.
reported that as the HEK 293 cell line was transformed from original embryonic tissues,
they might not be ideal for mechanism studies of adult PTECs in physiology and
disease; furthermore, a systematic analysis of HEK293 cast doubt the stability of these
cells to study kidney epithelial cells become of their expression of neuunal protein
(Shaw et al., 2002). Because of these reasons, HEK293 was used in this project merely
as a positive control in some of the experiments.
Given the above considerations, the primary goal was to characterise the HK2 cells to
ensure their phenotypic purity, confirm the published inflammatory phenotype and
investigate other features that make HK2 cells comparable to primary cultured cells.
140
This was so much more important as Van der Hauwaert et al. (2013) assumed that the
HK2 cell line, because of long-term culture and multiple passaging, would gradually
lose its specific functions, epithelial phenotype and characteristics. In contrast, cultured
primary PTECs retain their phenotypic characteristics and specific functions, like brush
border enzymatic activity.
Ryan et al. (1994) prepared primary PTECs from adult male human kidney tissue and
because of the disadvantages of using primary PTECs; they transformed the primary
cells to establish an immortalised adult human kidney proximal tubular cell line
retaining the normal phenotypic expression. Transforming the cells with HPV-16 gene
resulted in a cell line that survived for more than one year in culture and can be frozen
in liquid nitrogen and thawed to reuse.
The cells reportedly showed clear microvilli that made the brush border, which is
observed in the primary culture. The transformed HK2 cells possessed several typical
brush border enzymes, like alkaline phosphatase and gamma glutamyl transpeptidase
that suggest normal phenotypic expression. Furthermore, by immunochemistry the cells
stained positively with cytokeratin, which is characteristic of epithelial cells. By
contrast, they did not stain for Factor VIII-related antigen or with antibodies for
CALLA endopeptidase, which are endothelial cell markers. Finally, a cell injury
experiment (provoked by exposure of the cells to H2O2) showed that HK2 cells
proliferation was markedly inhibited, consistent with the effect of H2O2 on freshly
isolated proximal tubular cells. Taken together, the cells are good model for cell
cytotoxicity studies.
The HK2 cell line in this project was prepared from adult male human kidney (HPV-16
transformed). Different studies that use primary human PTCs grow these cells in a
medium with EGF as a required supplement. In addition, the source of HK2 cells that
were used in this project recommends adding EGF to the culture medium. EGF is one of
EGFR ligands in kidney cells. EGFR can be activated under physiological or
pathophysiological conditions by several mechanisms. Depending on the activating
ligand, EGFR has different biological effects such as cell proliferation, differentiation
and survival (Zhuang & Liu, 2014).
However, some studies on HK2 cells avoid adding
EGF in culture media for two reasons. Firstly, to avoid a confounding effect of EGF on
cells when they are treated with excess proteins, as in this project. Secondly, although
141
EGFR/EGF contributes in renal repair, it is also involved in the development and
progression of renal fibrosis. One study showed decrease in renal fibrosis in mice with
deletion of EGFR in proximal renal tubular cells after angiotensin II infusion (Tang et
al., 2013). So, the HK2 cells in this study were grown in the same medium (DMEM-
F12) but with different supplements, namely with and without EGF cocktail, which was
used to allow differentiation in primary PTCs cultures.
The HK2 (+/-GF) cells behaved similarly; they showed typical epithelial morphology
with high cell density and dome formation after 10 days of confluency. Van Der Biest et
al., 1994 showed dome formation in primary human PTCs after twelve days of
confluency, dome formation being a routine feature of tubular cells.
Ultrastuctural analysis of HK2 (+/-GF) cells showed clear evidence of microvilli and
noticeably numerous mitochondria. Qi et al. (2007) demonstrated the cellular
ultrastructure for human PTC monolayer using TEM grown in a medium supplemented
with EGF. These primary cells are characterised by apical microvilli and close
association of mitochondrial rich cells.
HK2 cells grown without EGF had also been shown to be rich in microvilli, rough
endoplasmic reticulum and mitochondria (Liu et al., 2009). The brush border and
microvilli on the HK2 cells’ surface were evaluated clearly with SEM. The HK2-GF
cells showed densely grown cells with possible dome formation compared with HK2
cells at the same time of growing. In addition, on the HK2 cells’ surface typical
microvilli appeared with some ruffles, however, microvilli were densely packed on the
HK2-GFs’ surface. In 2008, Wieser and his group, who investigated HK2 cells that
were grown in media supplemented with EGF, showed densely packed microvilli and
solitary cilia by SEM.
Villin-1 is a specific protein marker for microvilli and is required for the assembly of
microvilli at the apical membranes of cells in developing proximal tubules (Ongeri et
al., 2011). In 1986, Grone and his group showed that the brush border of the proximal
tubular epithelium in sections of normal human kidney was stained strongly positive
with the Villin-1 antibody, compared with negative staining for Villin-1 in distal tubules
and medullary tubular parts in the kidney. Similarly, our results showed the presence of
Villin-1 in HK2 (+/-GF) cells and also HEK293 cells, which were used as a positive
142
control. Additionally, cortex from C57BC/6 mouse tested positive for Villin-1
expression. However, the product size for Villin-1 was different between the HK2 (+/-
GF) cells and the mouse cortex samples, and this could be due to post translation
modification, such as glycosylation. The result sizes for mouse and human Villin-1
were consistent with manufacturer’s information.
To further characterise HK2 (+/-GF) cells, cell functionality of alkaline phosphatase,
which is one of the enzyme markers and a normal constituent expressed by proximal
tubular brush border membrane, was tested. According to Van Der Biest and his group
in 1994, who reported a lower activity of alkaline phosphatase in the primary human
PTCs compared to the value of fresh renal tissue from medulla, this could be due to a
loss of alkaline phosphatase during the preparation of PTCs from kidney tissue. In
contrast, our results showed strongly positive alkaline phosphatase in the cortex of the
mouse kidney sections, which contains the renal tubules, compared to the area of kidney
medulla.
In 2012, Kamiyama et al. reported that alkaline phosphatase activity was high in
purified mouse proximal tubules; similarly, the primary human PTCs contained high
alkaline phosphatase activity (Qi et al., 2007).
Comparably, the mPTECs that were used as positive control for alkaline phosphatase
staining in vitro showed that the intensity of the staining was variable; the proportion of
alkaline phosphatase positive cells varied with confluency of the culture. In contrast, the
HK2 (+/-GF) cells consistently demonstrated uniform staining for alkaline phosphatase,
so the HK2 (+/-GF) cell line showed similar alkaline phosphatase expression to the
primary proximal tubules.
Lastly, it was noticed that the proliferation was different between the HK2-GF and HK2
cells. The HK2-GF grew, divided and became confluent faster than HK2 cells, which
were measured in several ways (viability and activity assays). The EGF cocktail that
was added to the medium for cell differentiation is likely to have had a role in the
proliferation of HK2-GF cells.
In summary, the present chapter describes that an immortalized adult human proximal
tubular cell line, HK2 (+/-GF), has similar functional and morphologic characteristics to
normal primary adult human proximal tubular epithelium cell culture, as available from
143
the literature. In addition, HK2 (+/-GF) cells could prove to be a powerful and positive
choice for the study of the proteinuria model for this project, including physiology,
pathophysiology and mechanisms of cell injury and repair.
144
Chapter Five- Establishing an in vitro
Model of Protein-Induced Epithelial Cell
Damag
145
5. Introduction:
The studies in this chapter examine the effect of protein overload on the cellular integrity of
PTECs. In progressive renal disease, PTECs are exposed to high levels of protein like
albumin or LC in MM patients. Several investigators have examined the ability of large
quantities of albumin and LC to cause damage in HK2 cells, but data on this issue is
conflicting.
Albumin is the most abundant protein in proteinuric tubular fluid. Several investigators
have examined the ability of large quantities of albumin to cause cytotoxicity in PTCs
(Arici et al., 2003). Also, recent studies have shown that a significant amount of LC, which
is a low molecular weight protein to be endocytosed into PTECs, is capable of causing cell
damage and may lead to kidney disease (Wang & Sanders, 2007). A series of experiments
designed in this chapter to pursue the hypothesis that overload albumin and LC proteins
have a toxic effect on the HK2 (+/-GF) cells.
The cytotoxic effect of overload proteins (FAF-HSA and 𝜆-LC) was measured indirectly by
MTT assay to capture cellular metabolic activity and cell viability. In addition, to support
the MTT results, the LDH release was measured as well, which is a marker for lethal cell
injury in vitro because the enzymatic activity is relatively stable in a cell culture medium
and can be measured easily after leakage out of cells with a compromised membrane (Riss
& Moravec, 2005).
In addition, one of the effects of protein overload includes probably triggering the
autophagy pathway. Takabatake et al., 2014 demonstrated that proximal tubules expend a
large amount of energy through the reabsorption process and these tubules contain large
number of mitochondria that provide the energy for this reabsorption. The lysosomal
machinery plays a role in the reabsorption and degradation of albumin and low molecular
weight proteins like LC from the glomerular filtrate. Consequently, autophagy possibly
plays an important role in proximal tubules. Therefore, the intracellular response of HK2
(+/-GF) cells stimulated with FAF-HSA or 𝜆 -LC was investigated by TEM, which
specifically evaluates autophagy.
146
In pathological conditions like protein overload may contribute to progressive renal damage
by inducing apoptosis, tubular cell injury and death. Apoptosis is a physiologic mechanism
for eliminating unwanted cells like ischemia and nephrotoxicity injury. Several caspases
are involved in the apoptotic process, and they play an essential role during the initiation of
apoptotic cell death. Caspase-3 is an important protease in the execution of apoptosis (Lee
et al., 2013). So, apoptosis and caspase-3 were measured in HK2 (+/-GF) cells stimulated
with FAF-HSA or 𝜆-LC.
Lastly, several kidney injury markers were measured in mRNA levels, due to their allowing
for monitoring the disease progression at initial and early stages such as TGF-𝛽1 cytokine.
It is one of the critical genes in the pathogenesis of kidney disease and promotes cell
apoptosis via the activation of caspases that cause renal fibrosis (Hsieh et al., 2012). In
addition, it is involved in widely different biological processes like cell
growth/proliferation, differentiation, and regulation of the immune system (Sullivan et al.,
2009). Also, it was reported that the up-regulation of TGF-𝛽1 expression is consisted in
most fibrotic disease (Sullivan et al., 2009). Furthermore, TNF-𝛼 is one of the cytokines
produced by many cell types in response to infection or injury, and it may modulate the
cellular differentiation, proliferation and apoptosis (Sullivan et al., 2009). Also, KIM-1 is
markedly expressed by PTECs but plays a conflicting role in kidney injury and healing
(Lim et al., 2014). The role of KIM-1 in our condition was discussed in this chapter.
Finally, clusterin is a further kidney injury marker (Vaidya et al., 2008); clusterin protein
translated in the renal tubular epithelium cells after expression of clusterin mRNA
following the kidney injury (Khan & Pandey, 2014).
147
5.1 Aim:
The aim of these experiments was to determine and quantify the effects of protein overload
on the HK2 (+/-GF) cells in order to establish a model of protein induced epithelial cell
damage, study disease mechanisms using this model in vitro and to monitor the response
and health of cells in culture after treatment with various stimuli. To do this, commercially
available human serum albumin devoid of fatty acid and purified immunoglobulin light
chains were used in parallel.
148
5.2 Results:
5.2.1 Dose and time dependent influence of FAF-HSA and 𝝀-LC on cell
viability:
5.2.1.1 MTT Assay:
The effect of high dose FAF-HSA and 𝜆-LC on HK2 cells grown in different media (+/-
GF) was analysed using the photometric MTT assay, which detects changes in
mitochondrial activity.
HK2 (+/-GF) cells were stimulated with FAF-HSA (5, 10, 20 and 30mg/ml in serum free
medium) for different time periods and un-stimulated cells in serum free medium served as
a control for each time point.
At early time points (2, 4 and 6h stimulation) over a range of FAF-HSA concentrations,
there was no evidence of a toxic effect on both types of HK2 (+/-GF) cells (figure 5.1).
Also, when stimulating the HK2-GF cells with the same concentrations of FAF-HSA for
longer periods, a distinctly different observation was made: after the 24 and 48h incubation
period, there was no significant change in cell viability compared to the control for each
time point separately. In contrast, at 72h, there was a major decrease in the number of the
cells after stimulation with FAF-HSA compared to the control, and this gradually decreased
as the concentration of FAF-HSA increased (figure 5.2 A). Thus, there is an inverse
relation between the viability of the cells and the concentration of FAF-HSA at this time
point.
However, HK2 cells showed reduced cell viability with all different FAF-HSA
concentrations compared to the un-stimulated control from the first 24h of stimulation and
even more pronounced at 48 and 72h. There appears to be an inverse relationship between
cell viability and the concentration of FAF-HSA: The greater the concentration of FAF-
HSA, the lower the reading of mitochondria activity (figure 5.2 B).
149
While activity levels of control cells remain stable for 24 and 48h, there is an increase of
activity for HK2 (+/-GF) at 72h, suggesting increased proliferation at this time point in the
presence of the EGF cocktail. The effect, however, is not sufficient to inhibit the toxic
effect of high doses of FAF-HSA. In addition, HK2-GF shows a significant protection from
the FAF-HSA induced toxic effect compared to HK2 at all-time points, with no decrease in
the number of the cells in the first 24 and 48h and a significant decrease at 72h with the
higher concentration of FAF-HSA. In contrast, the HK2 cells show a significant decrease
from the first 24h with the higher concentration of FAF-HSA. For example, with
(30mg/ml) FAF-HSA the HK2 cells showed significant reduction from the initial 24h
incubation up to 72h, however, FAF-HSA with the same concentration had no effect on
HK2-GF cells at 24 and 48h but a significant decrease at 72h.
Next, HK2 (+/-GF) cells were sub-cultured and stimulated with 𝜆-LC (1, 5 and 10mg/ml in
a serum free medium) for 24, 48 and 72h. Un-stimulated cells in a serum-free medium were
used as controls for each time point. 𝜆-LC at 10mg/ml was found to significantly impair
HK2-GF cell viability after 24h of incubation when compared with un-stimulated cells. By
contrast, after 48 and 72h of stimulation with a range of 𝜆-LC between (1 and 10 mg/ml),
cell viability decreased compared to the control (figure 5.3 A).
Also, 𝜆-LC showed evidence of a toxic effect in the first 24h incubation time of HK2 cells,
however, there was a significant decrease in cell viability after 48 and 72h of incubation
time with all 𝜆-LC concentrations (1-10 mg/ml) compared with the control (figure 5.3 B).
150
Figure (5.1): Effects of FAF-HSA overload on cell viability measured using MTT
assay in HK2 (+/-GF) cells. The HK2 (+/-GF) cells were cultured at density
(2,500 cells/well) for 24h and treated with ascending concentrations of FAF-HSA
(5, 10, 20 and 30mg/ml) in serum free media. After incubation for 2, 4 and 6h
mitochondrial activity, indicative of cell viability, was determined and expressed
as photometrical densities of the solubilised end product, formazan. Exposure to
FAF-HSA showed on change in cell viability for HK2 (+/-GF) cells. Un-treated
cells were used as control. The data are represented as means of triplicates ± SD
(n = 3) (Unpaired t test p < 0.05vs. control), C: control sample.
2h
4h
6h
C 5
10
20
30
C 5
10
20
300.0
0.1
0.2
0.3HK2-GF
HK2
OD
(55
0 nm
)mg/ml
c 5
10
20
30 c 5
10
20
300.0
0.1
0.2
0.3HK2-GF
HK2
OD
(55
0 nm
)
mg/ml
c 5
10
20
30 c 5
10
20
300.0
0.1
0.2
0.3HK2-GF
HK2
OD
(550 n
m)
mg/ml
151
C 510
20
30 C 5
10
20
30 C 5
10
20
300.0
0.5
1.0
1.5
OD
(55
0nm
)
24h
48h
72h
mg/ml
*
HK2-GF Cells
C 51
02
03
0 C 51
02
03
0 C 51
02
03
00.0
0.5
1.0
1.5
OD
(550nm
)
24h
48h
72h
*** ** ***
mg/ml
HK2 Cells
Figure (5.2): Effects of FAF-HSA overload on cell viability measured using MTT
assay in HK2 (+/-GF) cells. The HK2 (+/-GF) cells were cultured at density
(2,500 cells/well) for 24h and treated with ascending concentrations of FAF-HSA
(5, 10, 20 and 30mg/ml) in serum free media. After incubation for 24, 48 and 72h
mitochondrial activity, indicative of cell viability, was determined and expressed
as photometrical densities of the solubilised end product, formazan (A) HK2-GF
and (B) HK2 cells. Exposure to FAF-HSA showed a dose and time-dependent
decrease in cell viability for HK2 cells, however, a significant decrease in cell
viability after 72h with the highest concentration of stimulant in HK2-GF cells.
Un-treated cells were used as control. The data are represented as means of
triplicates ± SD (n = 3) (Unpaired t test p < 0.05vs. control), C: control sample.
152
Figure (5.3): Effects of 𝜆-LC on cell viability measured using MTT assay in HK2
(+/-GF) cells. The HK2 (+/-GF) cells were cultured for 24h and treated with
ascending concentrations of 𝜆-LC (1, 5 and 10mg/ml) in serum free media. After
incubation for 24, 48 and 72h mitochondrial activity, indicative of cell viability,
was determined and expressed as photometrical densities of the solubilised end
product, formazan. (A) HK2-GF and (B) HK2 cells exposure to 𝜆-LC showed
decrease in cell viability after 48 and 72h time points in relation to ascending 𝜆-
LC concentration compared to the control. Un-treated cells were used as control.
The data are represented as means of triplicates ± SD (n = 3) (Unpaired t test p <
0.05 vs. control), C: control sample.
c 1 5
10 c 1 5
10 c 1 5
100.0
0.1
0.2
0.3
0.4
OD
(550
nm)
mg/ml
** ***
*
**
c 1 5 10
c 1 5 10
c 1 5 10
0.0
0.1
0.2
0.3
0.4
OD
(59
5nm
)
24h
48h
72h
mg/ml
** ***
*
HK2-GF Cells
HK2 Cells
c 1 5
10 c 1 5
10 c 1 5
100.0
0.1
0.2
0.3
0.4
OD
(550nm
)
Comparing GF LC MTT
24h
48h
72h
mg/ml
*
**
*
153
5.2.1.2 LDH Activity Assay:
To further quantify cytotoxicity of FAF-HSA and 𝜆-LCon HK2 (+/-GF) cells, the Lactate
Dehydrogenase assay (LDH) was used to capture cell membrane damage. While a decrease
in optical density in the MTT assay signifies decreased metabolic activity or cell numbers,
an increase in optical density in the LDH assay quantifies the extent of cytoplasmic
leakage.
Integrity of HK2 (+/-GF) cells was analysed by LDH release into the culture media after
stimulation with FAF-HSA (5, 10, 20 and 30mg/ml) in serum free media for 24, 48 and
72h. Un-stimulated cells in serum-free media served as controls and medium alone for
background.
At the beginning HK2 (+/-GF) cells were seeded (2,500 cells/well) in 96 well plates for
each time point separately, stimulated, and then the activity of LDH released in the media
was measured at the end of the stimulation. At 24 and 48h of stimulation over a range of
FAF-HSA concentrations, there was a significant increase in LDH media release, however,
after 72h the LDH activity was significantly reduced compared with activity in the previous
time points on both types of HK2 (+/-GF) cells (figure 5.4 (A and B)). This was
unexpected. Therefore, the experiments were repeated with increased cell numbers. The
HK2 cells (+/-GF) were seeded (5,000 and 10,000 cells/well) and the experiments were
performed as described. It was found that the LDH activity was significantly increased at
higher concentrations of FAF-HSA compared to the un-stimulated control. There was an
incremental increase of LDH release from cells stimulated with increasing concentration of
FAF-HSA over 24, 48 and 72h. The greatest cytoplasmic leakage was observed for all test
samples at 72h. Control cells showed increased LDH release at 48 up to 72h, probably due
to an increase in density (figure 5.5 and 5.6).
Comparing the LDH release after 72h of stimulation in HK2-GF and HK2 cells, it is
notable that the maximum LDH activity was achieved in HK2 cells, suggesting a possibly
protective effect of the EGF cocktail in the presence of high albumin concentration (20 and
30mg/ml) with HK2-GF cells (figure 5.6).
154
From the pilot experiments were conducted in order to establish the optimal cell number
needed to analyse protein induced cell damage at different time points using different FAF-
HSA concentrations. From this, it was concluded that (10,000 cells /well) was optimal to
analyse the impact of 𝜆-LC on HK2 (+/- GF) cell viability.
HK2 (+/-GF) cells were incubated with 𝜆-LC (1, 5 and 10mg/ml) in a serum free medium;
un-stimulated cells in serum free media were controls and medium alone was used for
background measurement. There was no significant difference between LDH releases from
HK2 (+/-GF) cells treated with different 𝜆-LC concentration at 24h (figure 5.7), while, after
48h there was a statistically significant increase in the supernatant LDH presence with (5
and 10mg/ml) 𝜆-LC concentrations from HK2-GF (figure 5.7 A) and with (10mg/ml) from
HK2 cells (figure 5.7 B). At 72 h, treating HK2 (+/-) GF with 𝜆-LC caused the largest LDH
release compared to the un-stimulated control (figure 5.7 (A and B)).
In summary, from MTT and LDH assays results suggest that high FAF-HSA and 𝜆-LC
concentrations cause reduction in cell viability and elevation in LDH released in the
supernatants of HK2 (+/-GF) with a long time of incubation.
5.2.1.2.1 PTECs Protein Overload Model:
In order to have sufficient numbers of cells for several analyses in this project, it was
necessary to provide evidence that the stimulation model performed so far in a 96 well
plate’s format (see 5.2.1) was transferable to a 6 well plate format. A photometric LDH
activity assay was used to assess whether FAF-HSA or 𝜆-LC overload causes cell injury.
This was confirmed successfully by measuring the LDH leakage as a marker of damage
induced by FAF-HSA and 𝜆-LC, therefore providing cells and supernatants for subsequent
analyses in (chapter 7).
HK2 (+/-GF) cells were transferred into 6 well plates with density (5 x 105 cells/well),
incubated for 24 and 72h with (5mg/ml) FAF-HSA or 𝜆-LC, and cells with no added
protein in the medium were used as controls. Figure 5.8 (A) shows a significant rise in the
LDH release in supernatants from HK2 (+/-GF) cells treated with FAF-HSA at 72h
155
compared to the control. In contrast, released LDH from HK2 (+/-GF) cells after 𝜆-LC
stimulation was increased significantly after the first 24h of incubation. While after 72h of
incubation the LDH level was elevated more compared with the 24h level from both HK2
(+/-GF) cells, by comparing both cellular medium conditions, HK2 cells showed a much
higher LDH release than HK2-GF at 72h (figure 5.8 (A)). The addition of the EGF cocktail
appears to exert a protective effect when 𝜆-LC induced cell damage. This effect is not
pronounced when incubating the cells with FAF-HSA. In figure 5.8 (B) the red colour
reflects the amount of the LDH activity in the sample, and it can be seen that HK2 (+/-GF)
cells showed more intense colour with longer time stimulation with HSA-FFA and 𝜆-LC at
72h compared to the faint reaction for the control or low LDH activity sample; however,
maximum intensity appeared with 𝜆 -LC stimulation. Thus, as with the previous
experiments in (see 5.2.1.2), it can be conclusively proven that FAF-HSA and 𝜆-LC exert
cytotoxic effects on HK2 (+/-GF) cells.
156
Figure (5.4): Impact of FAF-HSA on HK2 (+/-GF) cells viability, assessed by
measurement of LDH. HK2 (+/-GF) cells were cultured overnight (2,500
cells/well) in 96 well plates. Following this, the cells were treated with (5, 10, 20
and 30mg/ml) FAF-HSA in serum free media for 24, 48 and 72h. Cytoplasmic
leakage was quantified by measuring released LDH concentrations in the
supernatants. (A) HK2-GF and (B) HK2 cells. Un-treated cells were used as the
control. In addition, the LDH was measured in the standard medium alone for
each type of cells to use as a background control. The data are represented as
means of triplicates ± SD (n = 3) (Unpaired t test p < 0.05vs. control), C: control
sample.
HK2-GF (2,500 cells/well)
HK2 (2,500 cells/well)
c 51
02
03
0 c 51
02
03
0 c 51
02
03
00.0
0.1
0.2
0.3
OD
(490nm
)
24h
48h
72h
mg/ml
Med
ium
c 51
02
03
0 c 51
02
03
0 c 51
02
03
00.0
0.1
0.2
0.3
OD
(490
nm)
24h
48h
72h
mg/ml
Med
ium
157
Figure (5.5): Impact of FAF-HSA on HK2 (+/-GF) cells viability, assessed by
measurement of LDH. HK2 (+/-GF) cells were cultured overnight (5,000
cells/well) in 96 well plates. Following this, the cells were treated with (5, 10,
20 and 30mg/ml) FAF-HSA in serum free media for 24, 48 and 72h.
Cytoplasmic leakage was quantified by measuring released LDH
concentrations in the supernatants. (A) HK2-GF and (B) HK2 cells. Un-
treated cells were used as the control. In addition, the LDH was measured in
the standard medium alone for each type of cells to use as a background
control. The data are represented as means of triplicates ± SD (n = 3)
(Unpaired t test p < 0.05vs. control), C: control sample.
HK2 (5,000 cells/well)
HK2-GF (5,000 cells/well)
c 51
02
03
0 c 51
02
03
0 c 51
02
03
00.0
0.1
0.2
0.3
OD
(490 n
m)
24h
48h
72h
mg/ml
Med
ium
c 51
02
03
0 c 51
02
03
0 c 51
02
03
00.0
0.1
0.2
0.3
OD
(490 n
m)
24h
48h
72h
mg/ml
Med
ium
158
c 5 10 20 30
c 5 10 20 30
c 5 10 20 30
0.0
0.1
0.2
0.3
OD
(490
nm)
24h
48h
72h
mg/ml
**
Med
ium
**
**
HK2-GF (10,000 cells/well)
HK2 (10,000 cells/well)
c 5 10 20 30
c 5 10 20 30
c 5 10 20 30
0.0
0.1
0.2
0.3
OD
(490
nm)
24h
48h
72h
mg/ml
Med
ium
**
*
*
Figure (5.6): Impact of FAF-HSA on HK2 (+/-GF) cells viability, assessed by
measurement of LDH. HK2 (+/-GF) cells were cultured overnight (10,000
cells/well) in 96 well plates. Following this, the cells were treated with (5, 10,
20 and 30mg/ml) FAF-HSA in serum free media for 24, 48 and 72h.
Cytoplasmic leakage was quantified by measuring released LDH
concentrations in the supernatants. (A) HK2-GF and (B) HK2 cells showed
that there was a steady increase in LDH release in relation to ascending FAF-
HSA concentrations. Significant differences are indicated compared to the
control. Un-treated cells were used as the control. In addition, the LDH was
measured in the standard medium alone for each type of cells to use as a
background control. The data are represented as means of triplicates ± SD (n =
3) (Unpaired t test p < 0.05vs. control), C: control sample.
159
Figure (5.7): Impact of 𝜆-LC on HK2 (+/-GF) cells viability, assessed by
measurement of LDH. HK2 (+/-GF) cells were cultured overnight (10,000
cells/well) in 96 well plates. Following this, the cells were treated with (1, 5
and 10mg/ml) 𝜆-LC in serum free media for 24, 48 and 72 h. Cytoplasmic
leakage was quantified by measuring released LDH concentration in the
supernatants. (A) HK2-GF and (B) HK2 cells showed an increase in LDH
release in relation to ascending 𝜆-LC concentration after 48 and 72h of
incubation time compared to the control. Un-treated cells were used as the
control. In addition, the LDH was measured in the standard medium alone
for each type of cells to use as a background control. The data are
represented as means of triplicate ± SD (n = 3) (Unpaired t test p < 0.05vs.
control), C: control sample.
HK2-GF (10,000 cells/well)
HK2 (10,000 cells/well)
c 1 51
0 c 1 51
0 c 1 51
00.0
0.1
0.2
0.3
OD
(49
2nm
)
Comparing HK2 LC LDH
24
48
72
mg/ml
Med
ium
**
****
c 1 51
0 c 1 51
0 c 1 51
0
0.0
0.1
0.2
0.3
OD
(490nm
)
Comparing GF LC LDH
24h
48h
72h
mg/ml
Med
ium
****
****
160
FA
F-H
SA
GF
HK2
HK2
C S C S
24h 72h
GF
𝝀-L
C
C2
4h
24
h
C7
2h
72
h
C2
4h
24
h
C7
2h
72
h
C2
4h
24
h
C7
2h
72
h
C2
4h
24
h
C7
2h
72
h0.0
0.5
1.0
1.5
OD
(490nm
)
LC
HSA-FFA
Med
ium
***
**
*** ***
*
***
***
GF HK2GF HK2
FAF-HSA
𝜆-LC
Figure (5.8): Impact of 24 and 72h incubation of HK2 (+/-GF) cells with excess
amounts of FAF-HSA or 𝜆-LC on LDH release into the medium. HK2 (+/-GF) cells
were cultured overnight (5 x 105 cells/well) in 6 well plates. Following this, the
cells were treated with (5mg/ml) FAF-HSA or 𝜆 -LC in serum free media.
Cytoplasmic leakage was quantified by measuring released LDH concentration in
the supernatants. (A) FAF-HSA and 𝜆-LC proteins increased LDH release in a
time-dependent manner’ significant differences were indicated compared to the
control. Un-treated cells were used as controls. In addition, the LDH was measured
in the standard medium alone for each type of cell to use as a background control.
(B) 50𝜇𝑙 aliquot from supernatants measured in A are shown in B. The data are
presented as means of triplicates ± SD (n = 4) (Unpaired t test p < 0.05 vs. control).
C: control sample, and S: stimulated sample.
161
5.2.2 Autophagy as a response of HK2 (+/- GF) to cell damage by protein
overload:
Transmission electron microscopy (TEM) was chosen to detect the presence of autophagy
in cells exposed to protein overload. HK2 (+/-GF) cells were sub-cultured in 6 well plates
and stimulated with FAF-HSA or 𝜆 -LC (5mg/ml) for 24 and 72h, or with 0.2μM
tunicamycin for 16h (positive control to induce autophagy by endoplasmic reticulum stress)
(Moon et al., 2014). The samples were detached, spun and fixed, then processed for TEM.
The subsequent procedure was carried out by Natalie Allcock of the Electron Microscopy
Laboratory, University of Leicester.
Time point matched un-treated cells were used as controls. This analysis benefits from
literature describing ultrastructural criteria of autophagic vacuole formation.
Representative images for stimulated cells with (FAF-HSA, 𝜆-LC and tunicamycin) and
un-stimulated were chosen from a total number of about (150 for HK2-GF with FAF-HSA
and 𝜆 -LC), (130 for HK2 with FAF-HSA and 𝜆 -LC) and (50 for HK2-GF with
tunicamycin) images.
In the electron micrographs, different stages of autophagocytosis were seen in HK2-GF
cells exposed to tunicamycin. Figure 5.9 (A and B) show early/initial autophagosomes
containing intact cytosol or organelles in double membranes, whereas (C and D) show
autophagolysosomes (late autophagy) with more or less degraded cytoplasmic material.
Compared to figure 5.10, the control HK2-GF cell has a normal appearing lobulated
nucleus, empty vesicles, organelles and numerous microvilli. Furthermore, the cells in
(figure 5.10 (A2 and B2)) are in early prophase of mitosis because the chromosomes are
visible and the cell nucleus is still intact.
162
Stimulation HK2-GF cells with FAF-HSA for 24h (figure 5.11 (A1 and A2)) produces
multilamellar bodies. Multilamellar bodies are lysosomal organelles expressed under
various physiological and pathological conditions, and several factors, like autophagy,
contribute in lamellae formation within secondary lysosomes and autolysosomes (Lajoie et
al., 2005). Morphologically, these bodies are possibly lipid storage or organelles that could
be surrounded by a membrane and have a core composed of multilamellar membranes
(Schmitz & Muller, 1991). However, (figure 5.11 (A6)) shows multilamellar vesicles that
have many membrane layers, and multivesicular vesicles encapsulate smaller vesicles. In
(figure 5.11 (A3 and A4)) autophagylysosomes are seen, filled with cellular debris that is
formerly called the degradative or late autophagic vacuoles (Liu et al., 2014). Also, after
72h FAF-HSA stimulation, multilamellar body (figure 5.12 (A1 and A2)) and numerous
autophaglysosomes were clearly detected (figure 5.12 (A3 and A4)) compared with the
controls (figure 5.10).
Next, exposure of HK2 cells to FAF-HSA for 24h illustrates autophaglysosome (figure
5.14 (A1)) and a significant number of unilamellar vesicles with single bilayer, varying
considerably in size (100 nm to 2400 nm) ((figure 5.14 (A2)) (van Swaay, 2013).
Moreover, figure 5.14 (A3) demonstrates a large number of vesicles that could be lipid
vesicles. The overload of FAF-HSA on HK2 cells for the 72h (figure 5.15 (A1)) also shows
visibly large autophagosome compared to control cells (figure 5.13).
The overall morphology of un-treated control cells with a serum free medium alone for 24
and 72h appeared normal with a lobulated nucleus. Numerous mitochondria and microvilli,
typical of differentiated proximal tubular cells, were observed (figure 5.13).
However, exposure of HK2-GF to 𝜆 -LC for 24h shows the different stages of
macroautophagy, a type of autophagy. It is a multistep process starting with the phagophor
stage, which is a double membrane that encloses and isolates the cytoplasmic components
during the macroautophagy (figure 5.16 (A3)) and autophagosome. Figure 5.16 (A4) shows
the last stage in the macroautophagy process that is the autophaglysosomes. The HK2-GF
cells show the same results after stimulation with 𝜆-LC for the longer time of 72h, the
different stages of macroautophagy (figure 5.17 (A1)) and autophaglysosomes (figure 5.17
(A2)). However, it showed a huge number of lipid vesicles (figure 5.17 (A3)) compared to
163
empty vesicles in control cells (figure 5.10 (A2)). The HK2 cells after 𝜆-LC treating for the
same time point display the same response of HK2-GF, phagophor with ribosomes (figure
5.18 (A2 and A3)) and autophaglysosomes (figure 5.18 (A1)) at the 24 and 72h (figure
5.19).
In summary, the same concentration of FAF-HSA and 𝜆 -LC produce comparable
morphological changes in both HK2 (+/-GF) cells.
164
5 𝝁𝒎
1 𝝁𝒎
1 𝝁𝒎 1 𝝁𝒎
5 𝝁𝒎
Figure (5.9): Representative transmission electron micrographs (TEM) showing different
stages of autophagocytosis in cells exposed to (0.2 μM) tunicamycin for 16h (positive
control for autophagy). (A and B) autophagosome (early autophagy) (vacuoles with double
membrane), (C and D) autophaglysosomes with degraded cytoplasmic material (late
autophagy), (E) mitochondria.
165
Control 72h HK2-GF
1 2 5 𝝁𝒎 5 𝝁𝒎
Control 24h HK2-GF
2 5 𝝁𝒎
1 5 𝝁𝒎
Figure (5.10): Representative transmission electron micrographs (TEM) of HK2-GF cells
incubated in serum free media for 24 and 72h (control cells). The cells have a lobulated
nucleus, microvilli (A1), (A2) empty vesicles, (B1) are rich in mitochondria. The cells in
(A2) and (B2) are in early prophase of mitosis because the chromosomes are visible and the
cell nucleus is still intact.
166
FAF-HSA 24h HK2-GF
1 𝝁𝒎 5 𝝁𝒎
5 𝝁𝒎
5 𝝁𝒎
1
5 6
4 3
2
1 𝝁𝒎
5 𝝁𝒎
Figure (5.11): Representative transmission electron micrographs (TEM) of HK2-GF cells
treated with (5mg/ml) FAF-HSA for 24h. (A1 and A2) show multilamellar body. (A3 and
A4) show autophaglysosomes with degraded cytoplasmic material. (A5) shows
autophagosome and finally (A6 ) shows multilamellar vesicles.
167
FAF-HSA 72h HK2-GF
3 4
2 1
1 𝝁𝒎
5 𝝁𝒎
1 𝝁𝒎
1 𝝁𝒎
Figure (5.12): Representative transmission electron micrographs (TEM) of HK2-GF cells
treated with (5mg/ml) FAF-HSA for 72h. (A1 and A2) show multilamellar body. (A3 and
A4) show autophaglysosomes with degraded cytoplasmic material.
168
Control 72h HK2
Control 24h HK2
5𝝁𝒎
5𝝁𝒎
1
1 2
2
1 𝝁𝒎
1 𝝁𝒎
Figure (5.13): Representative transmission electron micrographs (TEM) of HK2 cells
incubated in serum free media for 24 and 72h (control cells). The cells have a lobulated
nucleus (A1). The cells in (A2) and (B2) are in the early prophase of mitosis because the
chromosomes are visible and the cell nucleus is still intact.
169
FAF-HSA 24h HK2
1 𝝁𝒎
1 𝝁𝒎
3
2 1 1 𝝁𝒎
Figure (5.14): Representative transmission electron micrographs (TEM) of HK2 cells
treated with (5mg/ml) FAF-HSA for 24h. (A1) show autophaglysosomes with degraded
cytoplasmic material. (A2) show many autophagosomes with double membranes and (A3)
could be lipid vesicles.
170
5 𝝁𝒎 2 1
1 𝝁𝒎
FAF-HSA 72h HK2
Figure (5.15): Representative transmission electron micrographs (TEM) of HK2 cells
treated with (5mg/ml) FAF-HSA for 72h. (A1 and A2) show clear autophagosomes with
double membranes. In addition, (A2) shows Golgi apparatus (arrow).
171
𝝀-LC 24h HK2-GF
1
4
2
3
5 𝝁𝒎
1 𝝁𝒎
1 𝝁𝒎
1 𝝁𝒎
Figure (5.16): Representative transmission electron micrographs (TEM) of HK2-GF cells
treated with (5mg/ml) 𝜆-LC for 24h. It shows different stages of macroautophagy process
and autophagosome (A3) and autophagolysosome (A4).
172
Figure (5.17): Representative transmission electron micrographs (TEM) of HK2-GF cells
treated with (5mg/ml) 𝜆-LC for 72h. (A1) show different stages of macroautophagy. (A2)
show autophaglysosomes with degraded cytoplasmic material. (A3) may be numerous
numbers of lipid vesicles and (A4) show multilamellar body.
𝝀-LC 72h HK2-GF
1 𝝁𝒎
1 𝝁𝒎
4
2
3
1 1 𝝁𝒎
1 𝝁𝒎
173
Figure (5.18): Representative transmission electron micrographs (TEM) of HK2 cells treated
with (5mg/ml) 𝜆-LC for 24h. (A1) shows autophaglysosomes containing partially degraded
cytoplasmic material. (A2 and A3) show ribosomes in autophagosomes.
𝝀-LC 24h HK2
5 𝝁𝒎
5 𝝁𝒎
3
2 1 1 𝝁𝒎
174
Figure (5.19): Representative transmission electron micrographs (TEM) of HK2 treated
with (5mg/ml) 𝜆-LC for 72h shows autophaglysosomes containing partially degraded
cytoplasmic material. (A6) show rough endoplasmic reticulum.
𝝀-LC 72h HK2
1 2
3 4
5 6
5 𝝁𝒎
1 𝝁𝒎
1 𝝁𝒎
1 𝝁𝒎
1 𝝁𝒎
1 𝝁𝒎
175
5.2.3 Effect of overload protein concentration to induce apoptosis:
To examine whether excessive protein doses can lead to apoptosis, cell injury and death,
HK2 (+/- GF) cells were sub-cultured in 6 well plates and incubated for 24 and 72h in a
serum free medium in the presence of FAF-HSA or 𝜆-LC (5mg/ml). Then, the presence
of apoptotic cells was analysed using ApopTag® In Situ Apoptosis Detection Kit.
Among FAF-HSA treated HK2-GF cells, there were few cells that stained positive for
TdT activity, indicative of apoptosis at 24h (figure 5.20 (A3)). More noticeable
apoptotic bodies and fragmented nuclei appeared after 72h (figure 5.20 (A4)). In
contrast, very few or no apoptotic cells were detected in the control cells incubated with
a serum free medium alone for 24 and 72h (figure 5.20 (A1 and A2)). Consistently,
apoptotic cells were shown after 𝜆-LC incubation for 24h (figure 5.20 (A5)). At 72h, 𝜆-
LC significantly induced more apoptosis HK2-GF cells compared to control cells
(figure 5.20 (A6)).
As a result, FAF-HSA induced apoptosis after treating HK2 cells for 24h (figure 5.20
(B3)), and at 72h of incubation time the number of the apoptotic cells was increased
(figure 5.20 (B4)). Similarly, 𝜆-LC induced apoptosis in 24h and the number of the
apoptotic cells was significantly increased at 72h of incubation time (figure 5.20 (B5
and B6)) compared to no apoptotic cells in control cells at 24h (figure 5.20 (B1)) and
few in the control cells at 72h (figure 5.20 (B2)). The controls were incubated in a
serum free medium.
Quantification by cell counting for 3 different fields for each sample at 10X
magnification showed HK2-GF treatment with (5mg/ml) FAF-HSA induced a 1-fold
increase in apoptosis comparing to the control and a two-fold increase with (5mg/ml) 𝜆-
LC at 24h. At 72h, the number of apoptotic cells after 𝜆-LC treatment was increased
more than 2-fold in 24h, however, FAF-HSA had no additional effect (figure 5.20 (C)).
Moreover, FAF-HSA had no significant effect on HK2 cells during the first 24h
stimulation time compared to the control, but a statistically significant increase by two-
fold in the number of the apoptotic cells after 72h of incubation. Whereas, 𝜆-LC raised
the number of apoptotic cells by 2-fold after 24 and 72h compared with controls (figure
5.20 (D)).
176
HK2-GF
(Control 24h)
(FAF-HSA 72h) (FAF-HSA 24h)
(Control 72h)
4 3
2 1
177
(𝝀-LC 24h) 6 5 (𝝀-LC 72h)
Figure (5.20): Specific staining of DNA fragmentation associated with apoptosis (ApopTag®) in stimulated HK2 (+/-GF) cells with
overload proteins. (A) HK2-GF cells exposed to (5mg/ml) FAF-HSA or 𝜆-LC for 24 and 72h. Reaction of TdT enzyme was
visualised by peroxidase substrate (nuclear brown colour for apoptotic cells) after stimulating the cells compared to the control (un-
treated cells) (red arrows indicate an example of apoptotic cells). Methyl green was used as counterstain. Objective x10.
178
HK2
(Control 24h)
(FAF-HSA 72h) (FAF-HSA 24h)
(Control 72h)
4 3
2 1
179
(𝝀-LC 24h) 5 6
(𝝀-LC 72h)
(B) HK2 cells exposed to FAF-HSA or 𝜆-LC (5mg/ml) for 24 and 72h. Reaction of TdT enzyme was visualised by peroxidase
substrate (nuclear brown colour for apoptotic cells) after stimulating the cells compared to the control (untreated cells) (red
arrows indicate an example of apoptotic cells). Methyl green was used as counterstain. Objective x10.
180
HK2 HK2-GF
Contr
ol
HS
A-F
FA
LC
Contr
ol
HS
A-F
FA
LC
0.0
0.5
1.0
1.5
2.0
24 h 72 h
Arb
itra
ry d
ensi
tom
eter
y u
nits
( x10 f
ield
)**
**
**
**
Contr
ol
HS
A-F
FA
LC
Contr
ol
HS
A-F
FA
LC
0.0
0.5
1.0
1.5
2.0
Arb
itra
ry d
ensi
tom
eter
y u
nits
( x10 f
ield
)
**
*
* **
24 h 72 h
(C and D) Quantitative analysis for immunostaining results of apoptotic HK2 (+/-GF) cells after exposure to FAF-HSA or 𝜆-LC
(5mg/ml) for 24 and 72h. Densitometric analysis of data obtained from the mean of three different fields (x 10) for each sample
and compared to un-stimulated controls (measuring the apoptotic cells (brown colour in each field)). The data are represented
as the mean of three fields ± SD (Unpaired t test p < 0.05). There were statistically significant differences between the
conditions. Image J software was used.
181
Caspase-3 is a downstream effector in this cascade that mediates apoptosis when
activated by various upstream signals (Lin et al., 2014). To investigate the effects of
protein overload on caspase-3 expression, HK2 (+/-GF) cells were incubated with FAF-
HSA or 𝜆-LC (5mg/ml) for 24 and 72h. The mRNA and protein expression of caspase-3
were measured by RT-qPCR and Western blot, respectively.
Figure (5.21) shows the expression of procaspase-3 in HK2 (+/-GF) cells from
stimulated and un-stimulated cells at (33kDa) size; however, activated caspase-3
(17kDa, cleaved product) could not be detected in treated cells, perhaps reflecting the
relatively small number of ApopTag® positive cells (figure 5.20). Caspase-3 mRNA
gene expression was increased with time in HK2 cells after FAF-HSA treatment at 24
and 72h compared to the un-treated control, but HK2-GF did not show any rise after the
stimulation (figure 5.22 (A)). Similarly, HK2 cells treated with 𝜆 -LC showed a
significant increase in caspase-3, as compared to un-treated control cells, however,
HK2-GF cells showed elevation in caspase-3 after 72h of stimulation with 𝜆-LC (figure
5.22 (B)).
In summary, although both FAF-HSA and 𝜆-LC induced apoptosis in HK2 (+/-GF)
cells, 𝜆-LC had a more pronounced effect on cells.
182
C S C S C S C S
24h 72h 24h 72h
HK2-GF HK2
FAF-HSA
𝝀-LC
Caspase-3
33kDa
𝜷 -actin
42kDa
𝜷 -actin
42kDa
Caspase-3
33kDa
Figure (5.21): Western Blot analysis of Caspase-3 from stimulated HK2 (+/-GF)
cells with overload proteins. The effect of FAF-HSA or 𝜆 -LC on caspase-3
protein production from HK2 (+/-GF) cells. Cells were cultured (5 x 105) in 6
well plates and stimulated with FAF-HSA or 𝜆-LC (5mg/ml) for 24 and 72h. Cell
lysates were prepared and analysed by Western blot SDS-PAGE. Cell lysates
(20𝜇𝑔 protein) were used. 𝛽-actin was used as loading control. C: control sample
and S: stimulated sample.
183
FAF-HSA
Contr
ol
24
h
72
h
24
h
72
h0.0
0.5
1.0
1.5
2.0
m R
NA
Cas
pas
-3 e
xpre
ssio
n
(Fold
chan
ge
vs.
contr
ol)
***
**
GF HK2
𝝀-LC
Contr
ol
24
h
72
h
24
h
72
h0
1
2
3
4
5
m R
NA
Cas
pas
-3 e
xpre
ssio
n
(Fold
chan
ge
vs.
contr
ol)
***
GF HK2
Figure (5.22): Effects of FAF-HSA or 𝜆 -LC on Caspase-3 mRNA
expression from HK2 (+/- GF). Cells were sub-cultured in 6 well plates (5
x 105) and incubated with 5mg/ml 𝜆-LC or FAF-HSA for 24 and 72h. (A)
FAF-HSA up-regulated caspase-3 expression from HK2 compared to the
control (B) 𝜆 -LC elevates caspase-3 expression (in a time dependent
manner) in HK2 cells (+/-GF) by (Quantitative RT-PCR) (2^-ΔΔCT value
was used, the mRNA expression normalized to β-actin and calibrated to
the average of un-treated controls). The data are represented as means of
duplicate ± SD (n = 2) (Unpaired t test P < 0.05).
184
5.2.4 Effect of FAF-HSA and 𝝀-LC on mediators of inflammation in
kidney damage:
In this study, after exposing HK2 (+/-GF) cells to the FAF-HSA or 𝜆-LC (5mg/ml),
total mRNA was isolated from control and stimulated cells at 24 and 72h. RT-PCR and
qRT-RCR were used to determine gene expression from stimulated HK2 (+/-GF) cells.
Housekeeping genes are constitutive genes, which are essential for basic cellular
function. They are expressed at a constant level in all cells under normal and
pathophysiological conditions (Eisenberg & Levanon, 2003) However, some of the
housekeeping genes might express differently depending on the experimental condition
(Greer et al., 2010). Because of this, three different housekeeping genes were tested
with our proteinuric condition by RT-PCR and RT-qPCR, glyceraldehyde 3-phosphate
dehydrogenase (GAPDH), beta 2 microglobulin (𝛽2M) and beta-actin (𝛽-actin). Our
results showed a variant expression in GAPDH and 𝛽2M from HK2 (+/- GF) cells
before and after stimulation with FAF-HSA (data not shown). So, FAF-HSA overloads
effects on the expression of both genes. In addition, in tubular proteinuria disease the
low molecular proteins such as 𝛽2M, that is completely reabsorbed by proximal tubules
in normal conditions appears in urine (Pacific Biomarker, 2012), which might explain
the differences in this gene expression from our PTECs in our protein overload
condition (the effect of protein overload on 𝛽2M was investigated and discussed in
chapter 7). However, the expression of β-actin was stayed constant upon stimulation.
Therefore, it was used as a reference (housekeeping gene).
Transforming growth factor-𝛽1 (TGF- 𝛽1) is an important mediator of tubular kidney
disease and one of the most important profibrotic cytokines in renal damage (Hsieh et
al., 2012). Treating HK2-GF cells with FAF-HSA for 24 and 72h up-regulated TGF-β1
mRNA expression significantly. On the other hand, HK2 cells showed an important
increase after 72h of stimulation compared with the control (figure 5.23 (A)). After 𝜆-
LC stimulation, the mRNA expression of TGF-β1 was elevated after 72h compared to
control in HK2-GF cells. The expression levels of TGF-β1 at both time points were
increased significantly in HK2 (figure 5.23 (B)).
Tumor necrosis factor (TNF- 𝛼) is one of the pro-inflammatory cytokines and a
mediator of inflammatory tissue damage. The effect of protein overload on HK2 (+/-
185
GF) cells on TNF- 𝛼 gene expression was measured. As shown in (figure 5.24 (A))
TNF-α expression was clearly increased with the long stimulation time of 72h from
HK2 (+/-GF) cells with FAF-HSA stimulation, compared to control cells. However,
stimulating the HK2 (+/-GF) cells with 𝜆 -LC up-regulated the TNF-α mRNA
expression significantly in a time-dependent manner compared to the control (figure
5.24 (B)).
Kidney Injury Molecule-1 (KIM-1) is a type 1 transmembrane protein and a specific
biomarker of human proximal tubular cell injury (van Timmeren et al., 2006). KIM-1 is
implicated in the pathogenesis of proteinuria induced renal damage or repair (Lim et al.,
2014). The HK2 cell line expresses KIM-1 under normal culture conditions but up
regulates in proximal tubules in nephron toxic injury (Han et al., 2002 and van
Timmeren et al., 2006). Gene expression of KIM-1 as a marker of tubular damage was
measured. KIM-1 was detected in HK2 (+/-GF) cells. At 24h of FAF-HSA stimulation,
the HK2 (+/-GF) did not show any significant change in KIM-1 mRNA levels, however,
it was elevated after 72h compared to the control (figure 5.25 (A)). On the other hand,
exposing the HK2 (+/-GF) cells to 𝜆-LC for 24 and 72h showed a significant decrease
in KIM-1 mRNA level compared to the control (figure 5.25 (B)).
To investigate another kidney cell injury biomarker, the clusterin mRNA level was
measured in stimulated HK2 (+/-GF) cells with FAF-HSA or 𝜆 -LC. Clusterin is a
glycoprotein; the mRNA and protein levels increase in tubular cells after injury like
KIM-1. It has been associated with kidney injury to both glomeruli and tubules (Vaidya
et al., 2008).
Figure (5.26) illustrates that FAF-HSA and 𝜆-LC were elevated in the clusterin gene
expression after stimulating HK2-GF cells compared to no or a very faint band from
untreated control cells at 24 and 72h. However, the HK2 cells did not show any band
with both protein treatments at both time points, the 24 and 72h (data not shown). 𝛽-
actin gene expression was used as a housekeeping gene and load control.
In summary, in this chapter it can be conclusively demonstrated that high concentrations
of FAF-HSA and 𝜆-LC have a cytotoxic effect on HK2 (+/-GF) cells with a long time of
incubation. The different readouts (MTT, LDH, and TEM) are likely to capture a
population of cells, which do not react uniformly to the stimulations. While some
186
undergo apoptosis, other involved in autophagic repair. While some proliferate, others
are leaky. mRNA expression studies analyse those cells, which are metabolically intact.
187
FAF-HSA
C 2
4h
24
h
C 7
2h
72
h
C 2
4h
24
h
C 7
2h
72
h0.0
0.5
1.0
1.5
2.0
Rat
io o
f m
RN
A (
TG
F-β
1 /β-a
ctin
)**
**
***
GF HK2
Contr
ol
24
h
72
h
24
h
72
h0.0
0.5
1.0
1.5
m R
NA
TG
F-b
1 e
xpre
ssio
n
(Fold
chan
ge
vs.
contr
ol)
***
******
GF HK2
𝝀-LC
Figure (5.23): mRNA expression of TGF-𝛽1 from stimulated HK2 (+/-GF) cells
with overload proteins. HK2 (+/-GF) cells were sub-cultured in 6 well plates (5 x
105) after exposure to 5mg/ml (A) FAF-HSA or (B) 𝜆-LC for 24 and 72h. (A)
Shows significant increase in TGF-𝛽1 level after 72h stimulation with FAF-HSA
from HK2 (+/-GF) cells compared with the controls (untreated cells) by semi-
quantitative RT-PCR. The results are presented as a ratio of densitometry analysis
of the gene relative to β- actin mRNA expression (housekeeping gene) using Image
J software. (B) Shows significant rise in TGF-𝛽1 mRNA expression from HK2
cells (+/-GF) after 𝜆-LC stimulation for 72h by RT-qPCR, 2^-ΔΔCT value was used,
the mRNA expression normalized to β-actin and calibrated to the average of
untreated controls. The data are represented as means of duplicate ± SD (n = 2)
(Unpaired t test P < 0.05), C: control sample.
188
Figure (5.24): mRNA expression of TNF-𝛼 from stimulated HK2 cells (+/-GF)
with overload proteins. HK2 (+/-GF) cells were sub-cultured in 6 well plates (5
x 105) after exposure to 5mg/ml (A) FAF-HSA or (B) 𝜆-LC for 24 and 72h. (A)
Shows significant increase in TNF-𝛼 level after 72h of stimulation with FAF-
HSA from HK2 (+/-GF) cells comparing with the controls (un-treated cells).
Similarly, (B) shows a significant rise in TNF-𝛼 mRNA expression from HK2
(+/-GF) cells after 𝜆-LC stimulation for 72h by semi-quantitative RT-PCR. The
results are presented as a ratio of densitometry analysis of the gene relative to β-
actin mRNA expression (housekeeping gene) using Image J software. The data
are represented as a means of duplicate ± SD (n = 2) (Unpaired t test P < 0.05),
C: control sample.
FAF-HSA
C 2
4h
24
h
C 7
2h
72
h
C 2
4h
24
h
C 7
2h
72
h0.0
0.5
1.0
1.5R
atio
of
mR
NA
(T
NF
-a/β
-act
in)
**
****
GF HK2
𝝀-LC
C 2
4h
24
h
C 7
2h
72
h
C 2
4h
24
h
C 7
2h
72
h0.0
0.5
1.0
1.5
Rat
io o
f m
RN
A (
TN
F-a
/β-a
ctin
)
GF
*
***
HK2
*
189
FAF-HSA
C 2
4h
24
h
C 7
2h
72
h
C 2
4h
24
h
C 7
2h
72
h0.0
0.2
0.4
0.6
0.8
Rat
io o
f m
RN
A (
KIM
-1/β
-act
in)
**
GF HK2
Con
trol
24h
72h
24h
72h
0.0
0.5
1.0
1.5
m R
NA
Kim
-1 e
xpre
ssio
n
(Fol
d ch
ange
vs.
cont
rol)
***
******
GF HK2
𝝀-LC
Figure (5.25): mRNA expression of KIM-1 from stimulated HK2 (+/-GF) cells
with overload proteins. HK2 (+/-GF) cells were sub-cultured in 6 well plates (5 x
105) after exposure to 5mg/ml (A) FAF-HSA or (B) 𝜆-LC for 24 and 72h. (A)
Shows increase in KIM-1 level after 72h of stimulation with FAF-HSA from HK2
(+/-GF) cells compared to the controls (untreated cells) by semi-quantitative RT-
PCR. The results are presented as a ratio of densitometry analysis of the gene
relative to β-actin mRNA expression (housekeeping gene) using Image J
software. (B) Shows significant decrease in KIM-1 mRNA expression from HK2
(+/-GF) cells after 𝜆-LC stimulation for 72h by RT-qPCR; 2^-ΔΔCT value was
used, the mRNA expression normalized to β-actin and calibrated to the average of
untreated controls. The data are represented as a means of duplicate ± SD (n = 2)
(Unpaired t test P < 0.05), C: control sample.
190
Figure (5.26): Semi-quantitative analysis of clusterin mRNA expression from
HK2-GF cells after stimulating with 5mg/ml FAF-HSA or 𝜆-LC for 24 and
72h. Clusterin gene expression was increased significantly after treating HK2-
GF cells with FAF-HSA and 𝜆-LC compared with absent or low expression
from untreated control cells. 2𝜇g mRNA was used from each sample. 𝛽-actin
was used as a housekeeping gene, C: control sample and S: stimulated sample.
24h 72h
Clusterin
800 bp
FAF-HSA
𝝀-LC
C S C S
C S C S
𝜷-actin
210 bp
191
5.3 Discussion
Studies have pointed to a direct pathogenic effect of protein on PTC to explain the
relation and extent of diseased kidney and proteinuria (Shalamanova et al., 2007 and Li
et al., 2008).
Treating HK2 (+/-GF) cells with FAF-HSA (5, 10, 20 and 30mg/ml) for (2, 4, 6, 24, 48
and 72h) as a time course to monitor the effect of the FAF-HSA on the proliferation of
the cells showed that after early time points (2, 4 and 6h) there was no difference in the
number of HK2 (+/-GF) cells when compared with their controls. Our results agreed
with a previous study, which used HK2 cells grown in a medium with EGF and
stimulated with (5mg/ml) HSA (95% pure and fatty acid free) for 8h. There was no
statistically significant impact on the proliferation of the HK2 cells using MTSTM
proliferation dye (Newman et al., 2000).
Another study investigated the effects of FAF-HSA (30mg/ml) for a longer incubation
time (24h) with primary cultures of human PTCs and determined the cell number by
hemocytometer. They found that the percentage of the proliferation of human PTC was
significantly increased compared with control cells, thus, no toxic effect (inhibition) on
the proliferation of human PTCs with a high concentration of albumin (Arici et al.,
2003). Interestingly, our HK2-GF cells showed no inhibition on growth with all FAF-
HSA concentrations after 24 and 48h of incubation time. These results agreed with
Arici et al. (2003). Whereas, we could not detect a significant increase in cell growth as
they detected after the 24h incubation, this difference might be due to the different cell
types used in both studies. In contrast, after 72h of incubation there was significant
decrease in cells number with the highest FAF-HSA concentration (30mg/ml) compared
to the control. One explanation may be due to the long-time of the incubation.
The fact that HK2 cells behave differently than HK2-GF when treated with FAF-HSA
might be due to the differences in media culture conditions. From the first 24h of
incubation with same concentrations of FAF-HSA, the viability of HK2 cells decreased
and the greatest reduction was observed with the highest concentration of FAF-HSA
(30mg/ml) compared to the control at all three time points.
An unexpected result with LDH release from stimulated HK2 (+/-GF) cells with a range
of concentrations of FAF-HSA for 24, 48 and 72h, the LDH activity was found to
192
increase at 24 and 48h but decrease at 72h. These results are at variance with MTT
results that showed the maximum decrease in cell activity with longer incubation time
with the range of FAF-HSA concentrations for HK2 (+/-GF) cells. This might be due to
the cell number that was used in the LDH assay (2,500 cells/well). The cells may
release the maximum LDH in the supernatant at 48h, and a higher number of cells were
used in LDH assay. For example, Hills et al. (2013) used (5,000 cells/well) in a 96 well
plates to study the cytotoxic effect of visfatin on HK2 cells for 48h by LDH assay. Also,
Wu et al. (2009) utilised HK2 cells plated in 96 well plates at (10,000 cells/well) for
testing the cytotoxicity of different compounds measured for 5-24h by LDH assay. In
both studies they used higher cell numbers than the one used in our study and for a
shorter incubation time up to 48h.
At 24h, the LDH release was increased significantly from HK2-GF cells stimulated with
FAF-HSA concentrations, when higher number of cells was used. By comparing the
LDH (leakage injured cells) and MTT (cell activity) at 24h of FAF-HSA stimulation,
we concluded that FAF-HSA led to injure the HK2-GF cell membrane (LDH release
increased), but did not let them die, so we did not detect decrease in the cell number
with MTT assay. However, when HK2 cells were treated with a range of FAF-HSA for
24h, the MTT showed an inhibition in growth with all concentrations and, compared
with LDH release for this experiment. In, 72h of incubation with FAF-HSA
demonstrates that the maximum LDH release from the HK2 (+/-GF) cells occur with the
highest concentrations (30 mg/ml) FAF-HSA, however, HK2 cells show more LDH
release compared to HK2-GF. The HK2-GF cells being more differentiated as brush
border; this seemed beneficial to respond to FAF-HSA stimulation. In addition, these
results were comparable with MTT results, which showed the maximum cell death
achieved after 72h of incubation with the highest concentrations for HK2 (+/-GF) cells.
In conclusion, exposure PTECs grown in a medium with or without an EGF cocktail to
high (30mg/ml) or low (5mg/ml) concentrations of albumin for short times will have no
effect on cells proliferation. The EGF cocktail in the growth media of HK2 cells may
play a protective role and save the cells from damage for a longer time. Lastly,
incubating HK2 (+/-GF) cells with a high concentration of albumin led to cell toxicity.
193
When exposing HK2 (+/-GF) cells to different concentrations of 𝜆 -LC (1, 5 and
10mg/ml) for 24, 48 and 72h, a slight decrease in mitochondrial activity was noticed by
MTT assay with 1 and 5 mg/ml (40 and 200 𝜇𝑀, respectively) 𝜆-LC at 24h, however,
with the higher dose 10mg/ml (400𝜇𝑀), a significant reduction was detected.
In 2008, Li and his group determined a significant decrease in the number of HK2 cells,
which were grown in a medium supplemented with EGF, after 24h treated with (50 𝜇𝑀)
LC by MTS cell proliferation/cytotoxic assay. While their study used 𝜅-LC, the present
work used 𝜆-LC. On the other hand, others displayed a significant reduction in HK2 cell
viability treated with 𝜅-LC (50 𝜇𝑀) but after 48h of incubation (Li et al., 2008). The
reason for that might be the different source from which the LC was purified (donor
urine sample) that may affect the LC toxicity. Our results from stimulated HK2-GF
cells with 𝜆-LC are in agreement with Li et al. (2008). The viability of our HK2-GF
cells was decreased with the similar 𝜆-LC dose 1mg/ml (40𝜇𝑀) and as well with higher
doses at 48h and also 72h, although, we used different types of LCs. Similarly, HK2
cells illustrated a significant reduction in cell viability after 48 and 72h of incubation
time with all 𝜆-LC concentrations (1, 5 and 10 mg/ml) compared to the control.
To confirm the toxic effects of 𝜆-LC on HK2 (+/-GF) cells by different assay, LDH
release from injured cells was measured at the end of each incubation time with
different 𝜆-LC concentrations. Exposure of HK2 (+/-GF) cells to 𝜆-LC produced no
significant effects on LDH release to the supernatant at 24h. However, Wang & Sanders
in 2007 showed conflicting results. They demonstrated a significant increase in LDH
release from HK2 cells after 24h incubation with (5mg/ml) 𝜆-LC. Two differences
could explain that; first, the source of the LC, and the toxic effect as explained
previously. Also, their cells growing in a different type of media may play a role in the
cell sensitivity. Nonetheless, after 48 and 72h showed the maximum LDH release from
HK2 (+/-GF) cells with (10mg/ml) 𝜆 -LC. These results are comparable with MTT
results.
Our work and results have given evidence that high concentrations of FAF-HSA and 𝜆-
LC exert an inhibitory effect on the proliferation and viability of HK2 (+/-GF) cells by
measuring the cellular metabolic activity and cell membrane injury with MTT and LDH
assays, respectively. In addition, by comparing the effect of (5mg/ml) FAF-HSA and 𝜆-
LC on HK2 (+/-GF) cells, we can conclude that 𝜆-LC had a more toxic effect on the
194
cells; it showed a significant decrease in cell viability at 48 and 72h with 𝜆-LC, but
FAF-HSA had no effect by MTT assay. These finding are important to prove our
protein overload conditions are able to inhibit HK2 (+/-GF) cell proliferation and had a
pathological effect on the cells, and can be used as proteinuria model in this project for
more investigative experiments.
Liu et al. (2014) investigated the activation of autophagic pathways in response to
urinary protein (UP), which is purified from a minimal change nephrotic syndrome
patient (MCNS), or (HSA with fatty acid) in HK2 cells. Exposure HK2 cells to an
arrangement of UP (0.1-8mg/ml) for 8h showed a significant increase in the number of
microtubule-associated protein 1 light chain 3 (LC3-II, a key marker of autophagy) by
immunofluorescence staining and Western blot. In parallel, typical image of early/late
autophagic vacuoles were shown by TEM. However, the range of HSA (0.1-8mg/ml) on
HK2 cells for 8h showed that only the high dose induced an increase in LC3-II. They
explained the different effect of HSA and UP that might be observed from the complex
components in UP, like immunoglobulin. Another study characterised the ultrastructure
of HK2 cells following (10mg/ml) bovine serum albumin with fatty acid (BSA) for 12h
by TEM. They found that BSA induced HK2 cells to generate secondary lysosomes,
cytoplasmic vacuolisation, and damaged rough endoplasmic reticulum and
mitochondria (Liu et al., 2009).
Similarly, our results demonstrated that FAF-HAS and 𝜆 -LC (5mg/ml) produced
different stages of macroautophagy stages in HK2 (+/-GF) cells at 24 and 72h,
autophagosoms, autolysosomes and a lot of multilamellar bodies.
Taken together, previous studies showed autophagy activation in response to albumin
(with fatty acid) overload. Our results proved that FAF-HAS and 𝜆 -LC induced
autophagy in HK2 (+/-GF) cells. However, the meaning of up-regulation of autophagy
in the kidney proximal tubules is not clear. One study suggested a cytoprotective role of
autophagy in kidney injury; in contrast, another study reported that autophagy is
positively involved in cell death in renal tubules (Takabatake et al., 2014). For example,
although Liu et al. (2014) indicated the autophagy activation in HK2 cells in response to
high HSA, they concludes the autophagy activation was a cytoprotective response
because pretreating HK2 cells with an autophagy inhibitor led to increased autophagic
flux, but reduced the apoptosis and different kidney injury markers.
195
The main aim in our study was to investigate the autophagy activation in HK2 (+/-GF)
cells in response to FAF-HSA and 𝜆-LC, but the role of this activation is not clear.
Stimulating HK2 (+/-GF) cells with 𝜆-LC induced morphological alterations in cultured
cells, including detachment of the cells from the culture plate and aggregation (data not
shown). By contrast, with FAF-HSA appeared less harmful, as most of the cells
remained attached to the flask surface. Li and his group in 2008 showed similar results
with stimulating HK2 cells with 𝜅-LC (50𝜇M) for 24h and comparing with control
cells. So, maybe autophagy plays a cytoprotective role with the FAF-HSA experiment,
but it has a role in cell injury with light chain stimulation. However, more investigation
is needed on this issue.
In vivo, the presence of proximal tubule apoptosis was shown in kidney biopsy
specimens of patients with focal segmental glomerulosclerosis (FSGS); in addition,
there was a significant correlation between the extent of proteinuria and the number of
apoptotic cells. In vitro, a model of albumin overload showed an increase in apoptosis
in a concentration dependent manner in proximal tubule cells (HKC-8) after exposure to
(5 and 10mg/ml) HSA (endotoxin free) for 24h by fluorescence microscopy (stained
with Annexin V, an early marker of apoptosis) and Hoechst 33342 (staining for late
apoptosis), but, there was no additional apoptosis with 20mg/ml HSA. In contrast, the
20mg/ml FAF-HSA induced the maximum necrosis with trypan blue staining (Erkan et
al., 2007). Comparably, the cell culture system used in this project, FAF-HSA induced
apoptosis in HK2-GF cells at 24 and 72h by the same level and this could be because
the protective role of the EGF cocktail, however, the apoptotic cells increased in HK2
cells with incubation time. 𝜆-LC induced apoptosis to the same extent in HK2 (+/-GF)
at 24 and 72h, and this may be due to a high number of cells detaching from the culture
plate or becoming necrotic; remaining attached cells were stained for apoptosis by the
ApopTag® kit, which distinguishes apoptosis from necrosis by specifically detecting
DNA cleavage and chromatin condensation associated with apoptosis.
It was reported that up-regulation apoptosis in the kidney is associated with increases in
caspase-3 activity, protein and mRNA levels (Yang et al., 2001). For example, Erkan et
al. (2005) showed significant elevation in caspase-3 activity HKC-8 treated with
(5mg/ml) HSA (endotoxin free) for 24h. Also, caspase-3 activity increased in
196
stimulation of HK2 cells with (1mg/ml) of two monoclonal FLCs (𝜅2 and 𝜆3) that were
purified from the urine of patients who had multiple myeloma and light chain
proteinuria, at 24 and 48h.
In this project the procaspase-3 (33kDa) was detected from HK2 (+/-GF) cells
simulated with (5mg/ml) FAF-HSA or 𝜆-LC for 24 and 72h; however, the cleaved
caspase-3 (17kDa) could not be detected. This is an unexpected result because the cells
showed apoptosis after stimulation as explained previously, but this could be due to the
low protein concentration (20𝜇g) of the lysates analysed by Western blot. One study
detects the cleaved caspase-3 from (100𝜇g) proximal tubule lysates stimulated with 200
𝜇M H2O2 for 8h (Kaushal et al., 2004). Also, the mRNA caspase-3 level was measured
in HK2 (+/-GF) cells treated with (5mg/ml) FAF-HSA or 𝜆-LC. The results showed a
gradual increase in caspase-3 mRNA level from HK2 cells stimulated with FAF-HSA at
all-time points, but no elevation was detected in treated HK2-GF. Nonetheless, 𝜆-LC
led to an increase the expression of caspase-3 mRNA from HK2-GF at 72h
significantly, and from HK2 cells at 24h and persisting through 72h.
Different kidney injury markers were measured in this project. This study examined the
effect of (5mg/ml) FAF-HSA and 𝜆-LC on TGF-𝛽1 cytokine on HK2 (+/-GF) at 24 and
72h. It was reported that a high concentration of albumin up-regulated TGF-β1 mRNA
expression in PTCs (Zoja et al., 2003). Our result showed that treated HK2-GF with
FAF-HSA increased TGF-β1 mRNA expression significantly. A further study
investigated the effect of treating HK2 cells; grown with a medium supplemented with
EGF, with (5mg/ml) FAF-HSA, a mild increase only was described for TGF-β1
production after 8h of incubation. This mild increase could be due to the short time of
incubation (Newman et al., 2000). On the other hand, HK2 cells showed an important
increase just after 72h of stimulation compared to the control. Li et al. (2008) analysed
the level of TGF-β1 mRNA and protein expression in cell culture medium from
stimulated HK2 cells with 𝜅-LC (25𝜇𝑀) for a time course (8, 24, 48 and 72h). They
found that TGF-β1 mRNA and protein levels were significantly elevated at 24h
persisting through 72h. Comparably, the (5mg/ml) (200 𝜇𝑀) 𝜆-LC in our project up-
regulated the mRNA level significantly from HK2 cells (+/-GF) at 24h and persisted
through 72h. In conclusion, stimulating PTCs with albumin or LC led to elevated TGF-
β1 gene expression with time.
197
The effects of FAF-HSA on the mRNA level of TNF-𝛼 from HK2 (+/-GF) cells was
significantly elevated at 72h, but no change occurred at 24h. By contrast, the (5mg/ml)
𝜆-LC leads to an increase of mRNA for TNF-𝛼 slightly at 24h and significantly at 72h.
However, previous study showed different results, where the exposure of human PTCs
(SV40) to a range of LC (1.5 and 3 mg/ml) and HSA with fatty acid (10 and 30mg/ml)
for 24h, the LC and HSA had no effect on the TNF-𝛼 production in the supernatant
(Sengul et al., 2002). This might be because of the shorter incubation time with
albumin, low 𝜆-LC concentrations or toxic effect.
Our data showed that the mRNA level of KIM-1 did not increase after stimulating HK2
(+/-GF) cells with (5mg/ml) FAF-HSA at 24h, but expression was increased at 72h. Lim
and his group in 2014 presented similar results, where stimulating HK2 cells with
5mg/ml HSA (with fatty acid) for a time course (4, 24, 48 and 72h) significantly
enhanced the KIM-1 mRNA expression with time, but the KIM-1 protein level was
increased significantly in the early (4 and 24h) and reduced with the late time points (48
and 72h). KIM-1 produced from injured PTECs has two roles: to be a marker associated
with tubular damage, or to clear the debris from damaged renal tubules. Clearance of
the necrotic and apoptotic cells from injured tubular is a critical process for restoration
of normal tissue (Lim et al., 2014). The early induction of KIM-1 from an injured
kidney might serve an adaptive function to clear apoptotic, necrotic cells and debris
from injured tubular that lead to a decrease in the inflammatory response in the
damaged tubule. In contrast, the continuous expression of KIM-1 during tubular damage
may cause inflammation and leads to further tubular damage and loss of renal function
(Lim et al., 2014). This may explain the late KIM-1 production from HK2 (+/-GF) cells
at 72h after FAF-HSA stimulation. Nonetheless, exposure of HK2 (+/-GF) cells to 𝜆-LC
showed a decrease in the KIM-1 mRNA level and this could be due to KIM-1 produced
as protein in the supernatants. So, in the conditions reported in this work, KIM-1 may
plays a clearance role of apoptotic cells and debris from damaged renal tubules (Lim et
al., 2014) with FAF-HSA stimulation but it was produced as a marker for cell damage
with 𝜆-LC treatment because the cell culture with 𝜆-LC showed lots of detached and
floating cells in the supernatants.
198
Our results showed a significant increase in clusterin mRNA expression from HK2-GF
cells after exposure to FAF-HSA and 𝜆-LC compared to no or very slight expression in
the control sample. Unexpectedly, HK2 cells did not show any clusterin expression after
stimulating with both proteins.
The novelty of this work is the side-by-side comparison of 𝜆-LC and FAF-HSA on HK2
(+/-GF) cells in parallel. Our study in this chapter proved that FAF-HSA and 𝜆-LC
overload in proximal tubules had an inhibitory effect as assessed by low cell
proliferation/viability, detectable autophagy, and cellular apoptosis. The inflammatory
responses coincide with the measure of damage and, possibly, repair. These effects are
included in figures (8.1 and 8.2).
199
Chapter Six-Megalin Phosphorylation in
Renal Proximal Tubular Epithelial Cells
200
6. Introduction:
Megalin, a luminally expressed receptor of the renal proximal tubules in the kidney. It is
glycoprotein and belongs structurally to the low-density-lipoprotein (LDL-R) receptor
family. It has a pivotal function together with cubilin and other receptors such as CD36
to bind filtered proteins and mediate their uptake by the endocytosis process in PTECs.
Megalin consists of a large extracellular domain and a short cytoplasmic domain/tail.
The large extracellular domain made up of four complementary types of ligand binding
repeats, epidermal growth factor repeats (EGF), YWTD spacer domains, a single
transmembran domain of 22 amino acids and NPXY short cytoplasmic domain. The
human megalin cytoplasmic domain/tail consists of 209 amino acids with three NPXY
motifs; this domain regulates the trafficking, function and endocytic activity of the
megalin receptor (figure 6.1 (A)) (Yuseff et al., 2007 and Marzolo & Farfán, 2011).
The cytoplasmic tail of megalin (MegCT) links the PTECs’protein (filtered proteins)
exposure with signalling effects within the cell. Activation signalling of cascades and
protein-protein interactions lead to protein phosphorylation of MegCT. The
phosphorylation of MegCT has the role of decreasing the expression of megalin on the
cell surface by a negative regulation (reduction) of megalin recycling (Marzolo &
Farfán, 2011). Excessive megalin mediated endocytosis might damage PTECs and
proteinuria will develop (Saito et al., 2010). The megalin receptor is constitutively
phosphorylated by a protein kinase at serine/threonine residues that enhance the
endocytosis rate (Yuseff et al., 2007). The MegCT has multiple potential
phosphorylation sites; these sites will phosphorylate when they are activated by protein
kinase C (PKC), casein kinase-l (CK-1) and glycogen synthase kinase-3 (GSK-3)
(Marzolo & Farfán, 2011) as distinct sites (figure 6.1(B)).
Previous work investigated if the phosphorylation of MegCT occurs, and by which
agents relevant to the urine of proteinuria patients. HSA (essentially fatty acid free) was
used because it is a major component in proteinuric urine and one of megalin receptor
ligands. EGF was used as another megalin receptor ligand, and PDBU a stimulator of
PKC (positive control). They used the same technique that was described in materials
and methods (See 2.16.2 and 2.16.3), however, after collecting the beads and being run
201
on 12% SDS-PAGE, the gel was dried and exposed to autoradiograph film to detect the
results. They found that in primary human proximal tubular cells that were pre-
stimulated with HSA (1mg/ml) and PDBU (1𝜇M), the MegCT-GST phosphorylation
was augmented compared to un-stimulated control cells and the GST (the beads) alone.
When cells were pre-stimulated with different concentration of EGF (10,100 and
500pg/ml), maximal phosphorylation was obtained with 500pg/ml. Thus, they
confirmed that MegCT is a phosphor-acceptor protein and in this case, the HSA and
EGF activate intracellular kinase pathways that as capable to phosphorylate MegCT
such as PDBU activate PKC.
Phosphorylation sites in MegCT Mass Spectrometry of tryptic digests of MegCT-GST
revealed the presence of phosphorylated in vitro by analysis of lysates prepared from
HK2 stimulated with HSA (1 mg/ml) or EGF (500 pg/ml). Five phosphorylated sites
identified in the MegCT (figure 6.1 (B)).
Another study also showed different MegCT phosphorylation sites by PKC and PKA
and investigated if MegCT phosphorylate within the PPPSP motif and GSK-3 is
required for phosphorylation (Yuseff et al., 2007). They identified that the PPPSP site
in the MegCT is significantly phosphorylated mainly by GSK-3, which adds a
phosphate molecule onto the serine amino acid residue. In addition, they displayed that
MegCT phosphorylated in vitro by using a minireceptor construct containing the
complete cytoplasmic domain of human megalin with amino terminal HA epitope
(Hemagglutanin Tag), in labelled LLC-PK1 (Procine kidney proximal tubule cells).
Additionally, they transfected the minireceptor in Chinese ovary hamster (CHO) cells
and Madin-Darby canine kidney (MDCK) cells; the results showed phosphorylation in
the megalin tail minireceptor (Yuseff et al., 2007).
Also, to detect megalin phosphorylation in the PPPSP cytoplasmic motif by GSK-3, the
minireceptor with wild type (PPPSP) or mutant peptide sequence (PPPAP or PPPDP)
with cytoplasmic domain were expressed in MDCK cells, which were labelled with 35S-
methionine/cysteine or 32P-orthophosphate for 2 to 4h and cell lysates were analysed by
SDS-PAGE and autoradiography. The results showed the wild type (PPPSP) motif with
serine constitutes the main phosphosite in the megalin cytoplasmic domain, as the
(PPPDP and PPPAP) mutant receptors were not highly phosphorylated as the wild type
(PPPSP). After that, they showed the GSK-3 binds directly to the megalin tail and
202
phosphorylates the receptor cytoplasmic domain by transfected HEK293 cells with
GSK3-HA; cell lysates incubated with MegCT-GST or GST alone as a control and anti-
HA was used by Western blot. The results showed the megalin cytoplasmic domain
interacts with GSK-3 (Marzolo & Farfán, 2011).
Based on these knowledge, three amino acid sequences (FHYRRTGSLLPAL),
(SRRDPTPTYSATE) and (TPPPSPSLPAKP) were phosphorylated in vitro and
injected into a rabbit with Freund’s Adjuvant (providing stimulation) (FHYRRTG-S
(PO 3 H 2) -LLPAL), (SRRDP-T (PO 3 H 2) -P-T (PO 3 H 2) –YSATE) and (TPPP-S
(PO 3 H 2) - PSLPAKP) (modified peptides) in an attempt to raise phosphor-specific
antibodies (Prof. Nigel Brunskill). In parallel, the unmodified peptides (not
phosphorylated, TPPPSPSLPAKP) were used as control peptides to obtain antiserum,
which could be used at the affinity purification stage to remove immunoglobulin that
recognises non-phosphorylated parts of the phosphor peptides. After that, the final
bleeds of immunised rabbits were obtained and affinity purified antisera were tested on
opossum kidney (OK) cells that were pre-stimulated with albumin and on the control
un-stimulated cells, which was done by Dr. Ravinder Chana at University of Leicester.
From all antisera tested, anti (TPPPSPSLPAKP) differentiated best between detecting
phosphorylated MegCT-GST and the un-phosphorylated peptidase sequence. Therefore,
this antiserum was chosen to use in this project to detect the phosphorylation signalling
in the cytoplasmic tail of megalin. By utilising these antibodies directed against specific
activation sites of the intracellular portion of megalin, they could be tested for their
effect on phosphorylation of Meg-CT, using FAF-HSA and 𝜆-LC two components in
the urine of MM patients with LC proteinuria and ligands of the megalin receptor.
This chapter will examine the phosphorylation of the megalin receptor by albumin and
light chain in a specific site of the cytoplasmic tail in vitro. Additionally, the expression
of megalin and CD36 receptors will be followed in our protein overload conditions in
vitro due to the fact that they are important receptors in the renal tubular endocytosis
process.
203
6.1 Aim
The goal of these studies was to first elucidate and follow the expression of megalin and
CD36 expression from PTECs in our vitro protein overload conditions, and secondly to
investigate if MegCT is a phosphor-acceptor protein in vitro by using cell lysate from
HK2 (+/-GF) cells pre-stimulated with overload proteins. This was made possible by
expanding work that characterised megalin phosphorylation (Baines, 2010).
204
A
B
HYRRTGSLLPALPKLPSLSSLVKPSENGNGVTFRSGADLNMDIGVSGFGPETAI
DRSMAMSEDFVMEMGKQPIIFENPMYSARDSAVKVVQPIQVTVSENVDNKNY
GSPINPSEIVPETNPTSPAADGTQVTKWNLFKRKSKQTTNFENPIYAQMENEQ
KESVAATPPPSPSLPAKPKPPSRRDPTPTYSATEDTFKDTANLVKEDSEV
EGF-type repeat
Complement type repeat
YWTD-region
NPXY motif
Transmembrane domain
Figure (6.1): The Megalin receptor. (A) Shows megalin receptor structure (Verroust &
Christensen, 2002) and (B) Demonstrates the 209 amino acid sequence of the human MegCT
(NM_004525.2). The blue highlight line shows the specific site of phosphorylation on the
cytoplasmic tail by GSK-3. The red highlight line shows the identified sites by (Baines, 2010).
The green highlight lines shows the sites of phosphorlation on the cytoplasmic tail by PKC
(Baines, 2010). The yellow lines shows the three peptides that were used to immunise rabbits
in the production of antisera.
205
6.2 Results
6.2.1 Expression of mRNA and protein of Megalin in HK2 (+/-GF)
cells:
To investigate the expression of megalin from HK2 (+/-GF) cells, total mRNA from
HK2 (+/-GF) cells was extracted, then cDNA was prepared from (5𝜇𝑔) mRNA and
analysed by RT-PCR (see 2.7). In addition, HEK 293 was grown to use as a positive
control for this analysis. 𝛽 -actin was utilised as a housekeeping gene because it is
expressed in comparable levels in HK2 (+/-GF) and HEK 293 cells.
As shown in (figure (6.2)), while β-actin expression was easily detectable, no megalin
band with the expected size (300bp) was detected from either HK2 or HK2-GF,
contrasting with an abundant expression of megalin mRNA in HEK293 cells.
L HEK293 HK2 HK2-GF
Figure (6.2): Analysis of megalin mRNA expression in HK2, HK2-GF and
HEK 293 cells. RT-PCR products were run on 1% agarose with 1-kb
DNA ladder (L). (A) mRNA expression for megalin in HEK293 cells
(positive control for megalin expression) but both HK2+/-GF showed no
megalin expression. The same amount of RNA (5 𝜇 g) was used for
HEK293 and HK2 (+/-GF) to prepare cDNA. (B) mRNA expression for β-
actin housekeeping gene.
𝛽-actin
170bp
Megalin
300bp
300 bp
200 bp
100 bp
400 bp
300 bp
200 bp
100 bp
206
Next, RT-qPCR was used in the assumption that mRNA megalin in HK2 (+/-GF) cells
were expressed at very low levels, which escaped the sensitivity of standard PCR (35 x
cycles). First, the efficiency and specificity of the primers (Megalin and β-actin) were
tested using HEK293 cDNA as described in materials and methods (see 2.8.2). Figure
(6.3) shows the amplification, standard curve and melting curve of β-actin and megalin
primers.
After that, HK2 (+/-GF) cells were tested. As presented in (figure 6.4 (A1)) the β-actin
amplification started early in cycle number 10; that means the expression in samples is
abundant, however, (figure 6.4 (B1)) shows the amplification with megalin increased
after cycle number 35, which means the expression of this gene is very scarce. Different
annealing temperatures were used (53-60C˚) to get a clear single band for megalin from
HK2 (+/-GF) cells at the correct size, as judged by running the qPCR samples in 1%
agarose gel (figure 6.5).
For megalin protein production, Western blot analysis was used for HK2 (+/-GF) cells
and HEK293 cells (as positive control), and whole cell lysates from the two cell lines
were prepared as described in material and methods (see 2.9.1). The protein samples
were separated using a gradient SDS-PAGE gel (4-15%) electrophoresis, transferred to
a PVDF membrane overnight at 30V and subsequently incubated with human anti-
megalin antibodies. Two human anti-megalin antibodies were used, commercially goat
anti-human megalin (see Table 2.7), and rabbit anti-MegCT antisera; this primary
antibody was generated as part of Richard Baines’ PhD work at the University of
Leicester (Baines, 2010) to detect intact megalin in HK2 cell lysate. The immunoblot
analysis showed no expression of megalin in HK2 (+/-GF) cell lysates, whereas megalin
was clearly detected in the cell lysates from HEK293 cells (figure 6.6 (A)).
As a last attempt to detect protein megalin expression from HK2 (+/-GF) cells, high
concentrations of protein samples (100-150𝜇g) were run through a 4% SDS-PAGE gel,
and then the Western blot steps were followed as described in materials and methods
(see 2.9.3). The same human anti-megalin antibodies were used. However, the
immunoblot analysis also showed no expression of megalin in HK2 (+/-GF) cell lysates,
whereas it was abundantly expressed in HEK293 cells (150𝜇g loaded) (figure 6.6 (B)).
207
Megalin 𝜷-actin
Figure (6.3): RT-qPCR efficiency for megalin and β-actin gene expression
in HEK293 cells. (A1 and B1) Show the amplification of β-actin
(housekeeping gene) and megalin in the serial dilution of cDNA (1:10)
prepared from (5𝜇𝑔 mRNA) HEK293 cells respectively. (A2) The standard
curve of β-actin (efficiency = 0.99) and (B2) the standard curve of megalin
(efficiency = 0.96). (A3 and B3) Show the melting curves analysis for β-
actin and megalin samples to determine specificity of the products,
respectively. Duplicate reactions were run for each sample.
208
Figure (6.4): RT-qPCR for mRNA megalin and β-actin gene expression in (5𝜇𝑔
mRNA) HK2 (+/-GF) cells (A1) the amplification of β-actin (housekeeping gene)
started early in cycle 10 but (B1) the amplification of megalin started very late at
cycle 35 (58C˚ annealing temperature). (A2 and B2) Show the melting curves
analysis for β-actin and megalin samples to determine specificity of the products,
respectively. Duplicate reactions were run for each sample.
A 𝜷-actin B Megalin
1
2
209
Figure (6.5): Gel electrophoresis analysis for RT-qPCR product (megalin
receptor). The RT-qPCR products were run in 1% agarose gel to show the
expression of (A) 𝛽-actin (170 bp) and (B) Megalin receptor (300bp) from
HK2 (+/-GF) cells at the correct size. Analysis of HEK293 cDNA was
included as a positive control for the expression of both genes. The products
from HK2 (+/-GF) cells are visibly as abundant as from HEK293 cells.
Megalin
300 bp
400bp
300bp
200bp
100bp
B
NTC HEK293 HK2 HK2-GF
800 bp
600bp
500bp
400bp
300bp
200bp
100bp
𝛽-actin
170bp NTC HEK293 HK2 HK2-GF
A
210
50KDa
37KDa
𝛽-actin (42KDa)
200KDa
4%
SD
S-P
AG
E
L 20 50 100 150/𝜇𝑔
Megalin (~600KDa) HEK293 cells
𝛽-actin (42KDa)
50KDa
37KDa
4-1
5%
SD
S-P
AG
E g
rad
ient
gel
200 KDa
Megalin (~600KDa)
L HK2 HK2-GF HEK293
211
6.2.2 MegCT-GST fusion protein phosphorylation in HK2 (+/-GF)
cells:
To test the hypothesis that MegCT phosphorylates at the PPPSP site, cell lysates from
HEK293 and HK2 (+/-GF) cells pre-stimulated with PDBU, FAF-HSA and 𝜆-LC at
different concentrations and times were examined using the PPPSP phosphor specific
antibody (See 2.16.2 and 2.16.3).
Cell lysates derived from HEK293 cells pre-stimulated with 10µM PDBU over a time
course (10, 20, 30 and 60min) showed that MegCT-GST phosphorylation was
augmented at 10 and more at the 20min (figure 6.7). Due to the maximum
phosphorylation on MegCT in HEK293 cells being detected at 20min, HK2 (+/-GF)
cells lysates were examined after being pre-stimulated with 10µM PDBU for 20min;
surprisingly, no phosphorylation in MegCT was detected in this condition. Therefore, to
determine whether the phosphorylation observed in HK2 (+/-GF) cells was
physiologically relevant, a time response experiment to 10µM PDBU was performed.
MegCT-GST phosphorylation was detected within 10min in the pre-stimulated lysate
compared to the control (un-stimulated) cells in HK2-GF cells, but no phosphorylation
detected at 20min of incubation, which explained why initially the phosphorylation of
MegCT-GST could not be detected (figure 6.8 (A)). Similarly, the time course of HK2
cells pre-stimulated with 10µM PDBU showed phosphorylation after 10 min compared
to the control and other stimulation times (figure 6.8 (B)). Based on this finding, HK2-
GF cells were pre-simulated with FAF-HSA (5 and 30mg/ml) for this short time of
10min. MegCT-GST phosphorylation was observed with 30mg/ml concentration
compared to un-stimulated control cells and pre-stimulated cells with 5mg/ml FAF-
HSA that showed no phosphorylation band. In addition, HK2-GF pre-stimulated with
10µM PDBU for 10min was used as positive control and the unmodified peptide (not
phosphorylated, TPPPSPSLPAKP) was detected by anti-peptide antibody in MegCT
Figure (6.6): Western blot analyses of megalin. (A) HK2 (+/-GF) and HEK293
cells lysate (20𝜇g) were loaded onto a 4-15% SDS-PAGE gradient gel, primary
antibody goat anti-human (1:1000) was used to detect megalin. (C) HEK293 cell
lysates (20, 50, 100 and 150 𝜇g) were loaded onto a 4% SDS-PAGE gel; primary
antibody rabbit anti-MegCT antisera (1:1000) detect intact megalin. (B and D) 𝛽-
actine was used as the loading control, (20𝜇g) from each sample were loaded onto
a separate 12% SDS-PAGE gel. The arrow indicates megalin.
212
in each sample as loading control (figure 6.9 (A)). Similarly, HK2 cells that pre-
incubated with (5 and 30 mg/ml) FAF-HSA for 10 min has been phosphorylated the
MegCT-GST with the 30mg/ml FAF-HSA compared to the absence of phosphorylated
band appear with 5mg/ml FAF-HSA stimulation and control cells (figure 6.9 (B)). 𝜆-LC
observes phosphorylation in vitro was investigated by a concentration response
experiment. 𝜆-LC stimulated the phosphorylation of MegCT-GST fusion protein at a
concentration (1mg/ml); however, higher phosphorylation was elicited by (5mg/ml) 𝜆-
LC compared to the un-stimulated control sample HK2-GF cells. The HK2-GF cells
were pre-stimulated with FAF-HSA (30/mg/ml) and PDBU (10µM) as positive controls
(figure 6.10 (A)). HK2 cells also showed similar results when the cells were pre-
stimulated with 𝜆-LC; the MegCT-GST activated and showed phosphorylation with
(1mg/ml) and the phosphorylation augmented with (5mg/ml) 𝜆-LC. As expected, no
phosphorylation was detected in un-stimulated HK2 cells compared to phosphorylate
MegCT-GST with lysates derived from HK2 pre-stimulated with FAF-HSA (30mg/ml)
and PDBU (10 and 20 µM) as positive controls (figure 6.10 (B)).
In summary, because the antibodies successfully discriminated between the
phosphorylation states of this peptide motif, this thesis could show that our protein
overload conditions using HK2 (+/-GF) cells led to phosphorylation of megalin
cytoplasmic tail in vitro. Multiple kinases regulate MegCT-GST fusion protein
phosphorylation (Baines, 2010), but this work specifies GSK-3 due to its proposed
phosphorylation of serine in our peptide of interest, PPPSP.
213
Anti-Phospho peptide
50kDa
Anti-Peptide
50kDa
HEK293 cells
(10µM PDBU)
C 10 20 30 60 /min
Figure (6.7): Time course of PDBU stimulated phosphorylation of MegCT-GST
fusion protein. HEK293 cells were pre stimulated with PDBU (10µM) for 10 up
to 60min. Stimulated cell lysates were incubated with MegCT-GST complex for
60min. Samples were run on 12% SDS-PAGE. PVDF membranes were then
probed with anti-phospho peptide antibody. As shown, HEK293 cells were
maximum phosphorylated after 20min incubation with PDBU compared to no
phosphorylation in control (un-stimulated cells) and less phosphorylation after
10min. Anti-peptide antibody detected the un-phosphorylated peptide was used as
loading control. One representative blot of at least two is shown.
214
Figure (6.8): Time course of PDBU stimulated phosphorylation of MegCT-GST
fusion protein by HK2 (+/-GF) cells. HK2 (+/-GF) cells were stimulated with PDBU
(10µM) for 10 up to 60min. Stimulated cell lysates were incubated with MegCT-
GST complex for 60min. Samples were run on 12% SDS-PAGE. PVDF membranes
were then probed with anti-phospho peptide antibody. (A) Shows HK2-GF cells were
phosphorylated after 10min incubation with 10µM PDBU compared to no
phosphorylation in control (un-stimulated cells) and (B) Show less phosphorylation
after 10min stimulation for HK2 cells. Anti-peptide antibody detected the un-
phosphorylated peptide and was used as loading control. One representative blot of at
least two is shown.
Anti-Phospho peptide
50kDa
Anti-Peptide
50kDa
HK2 cells
(10µM PDBU)
C 30 20 10/min
Anti-Phospho peptide
50kDa
HK2-GF cells
(10µM PDBU)
C 10 20 30 60/min
Anti-Peptide
50kDa
215
Figure (6.9): Effect of FAF-HSA on phosphorylation of MegCT-GST fusion
protein. HK2 (+/-GF) cells were pre-stimulated with FAF-HSA (5 and 30 mg/ml)
for 10min. Stimulated cell lysates were incubated with MegCT-GST complex for
60min. Samples were run on 12% SDS-PAGE. PVDF membranes were then probed
with anti-phospho peptide antibody. (A and B) Show HK2 (+/-GF) cells were
phosphorylated after 10 min incubation with 30mg/ml FAF-HSA and with PDBU
(10µM, positive control) comparing to no phosphorylation in control (un-stimulated
cells) and stimulated cells with 5mg/ml FAF-HSA. Anti-peptide antibody detected
the un-phosphorylated peptide and was used as loading control. One representative
blot of at least two is shown.
HK2-GF cells
10 min
Anti-Phospho peptide
50kDa
Anti-Peptide
50kDa
HK2-GF cells
10 min
Co
ntr
ol
10
µM
PD
BU
5 m
g/m
l F
AF
-HS
A
30
mg/m
l F
AF
-HS
A
Anti-Phospho peptide
50kDa
Anti-Peptide
50kDa
Contr
ol
5 m
g/m
l F
AF
-HS
A
30 m
g/m
l F
AF
-HS
A
216
Co
ntr
ol
10
µM
PD
BU
1 m
g/m
l 𝜆
-LC
30 m
g/m
l F
AF
-HS
A
HK2-GF cells
10 min
Anti-Phospho peptide
50kDa
Anti-Peptide
50kDa
Contr
ol
1 m
g/m
l 𝜆
-LC
30 m
g/m
l F
AF
-HS
A
10µ
M P
DB
U
20
µM
PD
BU
HK2 cells
10 min
Anti-Phospho peptide
50kDa
Anti-Peptide
50kDa
5 m
g/m
l 𝜆
-LC
5m
g/m
l 𝜆
-LC
Figure (6.10): Effect of 𝜆 -LC on phosphorylation of MegCT-GST fusion
protein. HK2 (+/-GF) cells were stimulated with 𝜆-LC (1 and 5 mg/ml) for
10min. Stimulated cell lysates were incubated with MegCT-GST complex for
60min. Samples were run on 12% SDS-PAGE. PVDF membranes were then
probed with anti-phospho peptide antibody. (A and B) Show HK2-GF cells
were phosphorylated after 10min incubation with both 𝜆-LC concentrations,
FAF-HSA (30mg/ml) and PDBU (10µM) as positive controls comparing to no
phosphorylation in control (un-stimulated cells). Similarly. Anti-peptide that
detected the un-phosphorylated peptide was used as loading control. One
representative blot of at least two is shown.
217
6.2.3 Effects of protein overload on mRNA expression for Megalin and
CD36 by HK2 (+/-GF) cells:
Megalin is a receptor that plays a role in the uptake, reabsorption and transport of
urinary protein by endocytosis in renal PTECs (Leheste et al., 1999) . Megalin-
mediated endocytic overload leads to damage of PTECs and this might develop
proteinuria (Saito et al., 2010). In addition, several studies suggest that additional
receptors for proteins in PTECs may exist and have a role in renal proximal tubule
fibrosis when up regulated in proteinuric condition such as CD36 (Yang et al., 2007).
To investigate the effects of protein overload on megalin and CD36 mRNA expression
in vitro, HK2 (+/-GF) cells were sub cultured in 6 well plates, then stimulated with
FAF-HSA or 𝜆-LC (5mg/ml) for 24 and 72h. After each time point the mRNA and
cDNA were prepared and gene expressions were analysed by RT-qPCR for both
receptors. HK2-GF cells exposed to FAF-HSA for 72h showed a significant increase in
mRNA CD36 expression; however, the mRNA CD36 expression from HK2 cells was
down regulated significantly after stimulation with FAF-HSA at the same 72h (figure
6.11 (A1)). On the other hand, stimulation with 𝜆-LC showed no change in CD36
mRNA expression and was observed in HK2 (+/-GF) cells at 24h, compared to a clear
and noticeable increase in mRNA CD36 expression at 72 from HK2 (+/-GF) cells
(figure 6.11 (B1)).
Next, HK2-GF cells stimulated with FAF-HSA showed a slight increase in megalin
receptor mRNA expression level at 72h. In contrast, HK2 cells displayed significant
elevation in megalin expression at 24h and persisted through 72h compared to the
control sample (figure 6.11 (A2)). With 𝜆-LC stimulation, HK2-GF cells had no change
in megalin receptor mRNA expression at both time points compared to the control
sample. Likewise, there was no change in megalin receptor mRNA expression level
after 24h of stimulation with 𝜆-LC, but the level was decreased after 72h in HK2 cells
(figure 6.11 (B2)).
218
FAF-HSA
Contr
ol
24
h
72
h
24
h
72
h0
1
2
3
m R
NA
CD
36 e
xpre
ssio
n
(Fold
chan
ge
vs.
contr
ol)
**
***
**
GF HK2 Contr
ol
24
h
72
h
24
h
72
h0
1
2
3
4
5
m R
NA
Meg
alin
expre
ssio
n
(Fold
chan
ge
vs.
contr
ol)
**
**
GF HK2
*
𝝀-LC
Contr
ol
24
h
72
h
24
h
72
h
0
1
2
3
m R
NA
CD
36 e
xpre
ssio
n
(Fold
change v
s.c
ontr
ol) ***
*
GF HK2
Contr
ol
24
h
72
h
24
h
72
h
0
1
2
3
4
5
m R
NA
Megalin e
xpre
ssio
n
(Fold
change v
s.c
ontr
ol)
***
GF HK2
*
Figure (6.11): Effect of FAF-HSA or 𝜆 -LC on megalin and CD36 mRNA
expression from HK2 (+/- GF) cells. Cells were sub cultured in 6 well plates (5 x
105 cells/well) and incubated with 5mg/ml 𝜆-LC or FAF-HSA for 24 and 72h. (A2)
FAF-HSA elevates megalin expression gradually from HK2 (time dependent)
compared to the control, however, (A1) CD36 expression from HK2-GF at 72h, but
significant decrease from HK2 cells at both time points comparing with the control.
(B2) 𝜆-LC decreased megalin mRNA expression at 72h from HK2 cells and no
change in HK2-GF with both time points, but (B1) It increased CD36 mRNA
expression at 72h from HK2 by (Quantitative RT-PCR) (2^-ΔΔCT value was used,
the mRNA expression normalized to β-actin and calibrated to the average of un-
treated controls). The data are represented as means of duplicate ± SD (n = 3)
(Unpaired t test P < 0.05).
219
In summary, from the results in this chapter it can be confirmed that MegCT is
phosphorylated in vitro by using cell lysates derived from HK2 (+/-GF) cells that were
pre-stimulated with FAF-HSA or 𝜆 -LC in a specific site (PPPSP) in the megalin
cytoplasmic domain, which may have a role in proximal tubular injury in proteinuria.
220
6.3 Discussion:
The mechanism of tubular handling of filtered proteins and pathomechanisms of
developing proteinuria remains an issue of interest. Megalin is the main receptor that is
responsible for protein endocytosis process in PTECs. Therefore, a high concentration
of proteins like albumin on proximal tubular cells is a sign of decreased endocytosis and
lead to proteinuria. Several studies reported that albuminuria might cause tubular
disease (Caruso-Neves et al., 2005).
Our in vitro work initially identified the gene and protein megalin expression in the
HK2 (+/-GF) cell line. In 2012, Sawada and his group examined the gene and protein
megalin expression in HK2 cells that were grown in a DMEM/F-12 medium with 10%
BSA. They found that HK2 cells showed a very slight expression of megalin mRNA
and protein. Our study agreed with Sawada et al. (2012) finding; our results showed no
mRNA expression in HK2 (+/-GF) cells by RT-PCR compared to a clear megalin band
from HEK293 (positive control). We explained that might be due to the low megalin
expression from HK2 (+/-GF) cells in our cultured condition; also, it might be the PCR
technique’s sensitivity to detect a very low expression of megalin from the cells. Thus,
the qRT-PCR’s more sensitive technique was used to detect the megalin expression and
we showed a clear but low megalin mRNA expression from HK2 (+/-GF) cells
compared to a clear abundance of meglain mRNA expression from HEK293 (positive
control). Fifty cycles were required to detect megalin mRNA in HK2 (+/-GF) cells
using the same primers for RT-PCR and qRT-PCR, while the housekeeping gene was
readily detectable. Low abundance of expression was the likely explanation of not
different splicing although this was not investigated.
In addition, our study could not detect megalin protein expression, compared to
considerable production that was detected with HEK293 cells (positive control). In
contrast, these observations were inconsistent with other studies that showed clear
megalin protein expression in HK2 cells. For example, Li et al. (2008) showed a clear
megalin protein production by Western blot from HK2 cells that were cultured in a
keratinocyte serum free medium supplemented with 5ng/ml EGF and 0.05% bovine
pituitary extract. Thus, one reason might explain the different levels of megalin mRNA
and protein expression, which is the cultured medium that was used in our conditions,
because the same Western blot method and anti-human megalin antibody (C-19) that
221
were used in Li et al. (2008) to detect megalin protein expression in HK2 cells were
utilised in this project.
The megalin endocytosis process might contribute to develop proximal tubular cell
damage in proteinuric conditions. This contribution might be mediated by (i) as initially
explained, the excessive amount of filtered protein in tubular filtrate leads to a decrease
in the endocytosis process, (ii) accumulation macromolecules ligands on tubular cells
(Baines, 2010), (iii) megalin ligands activate signalling pathways in proximal tubular
cells that lead to phosphorylate the megalin cytoplasmic domain in a specific site, and
this phosphorylation is able to decrease megalin cell surface expression (negative
recycling) (Marzolo & Farfán, 2011).
Part of this project carried on from a previous study (Baines, 2010), which identified
megalin as phosphor-acceptor protein. This study showed augmented phosphorylation
of MegCT-GST when this recombinant tool was incubated with primary human
proximal tubular cell lysates that were pre-stimulated with FAF-HSA (1mg/ml) or
PDBU (10µM) compared to no phosphorylation detected in the control un-stimulated
cells. This phosphorylation was detected by autoradiography (Baines, 2010). There are
multiple potential sites for phosphorylation in MegCT. As described initially, Baines
(2010) identified several phosphorylation sites in the MegCT (figure 6.1), which could
be affected by different kinases.
Based on previous studies, our project investigates if MegCT phosphorylates in PPPSP
site in vitro by protein-protein interaction. In vitro, our proteins overload conditions
(stimulate HK2 (+/-GF) cells with high concentration of FAF-HSA and 𝜆-LC) were
used to investigate if they phosphorylate the MegCT by incubating MegCT-GST with
pre-stimulated HEK293 and HK2 (+/-GF) cell lysates to activate kinases and this
activation causes the MegCT phosphorylation. Different FAF-HSA concentrations were
used to activate kinases that are capable of phosphorylating MegCT, like PDBU when
activated by PKC. Initially, this project showed MegCT phosphorylated in pre-
stimulated HEK293 and HK2 (+/-GF) cells by PDBU (10µM). Likewise, FAF-HSA
was shown to activate kinases and MegCT phosphorylated in HK2 (+/-GF) cells,
however, the phosphorylation in MegCT for HK2 (+/-GF) cells was detected with a
high concentration of FAF-HSA (30mg/ml) but no phosphorylation occurs with
(5mg/ml) at 10min; maybe the (5mg/ml) FAF-HSA needs a longer time to activate
222
kinases to phosphorylate MegCT. By comparing our finding with Baines (2010), in this
study (1mg/ml) FAF-HSA was used to pre-stimulate the primary human proximal
tubular cells and MegCT was phosphorylated; in contrast, in our study a fivefold higher
concentration was used (5mg/ml) FAF-HSA to pre-stimulate HK2 (+/-GF) cells but no
MegCT phosphorylation was detected compared to the augmented amount with HK2
(+/-GF) cells pre-stimulated with (30mg/ml) FAF-HSA. One reason might explain the
different between our results and Baines (2010) is that the type of proximal tubular
cells. Thus, the primary human proximal tubular cells maybe more sensitive, however,
the main idea, which is MegCT phosphorylates by albumin, was confirmed in both
conditions with primary or cell line proximal tubular cells.
Additionally, our work investigated if 𝜆 -LC protein is capable of phosphorylating
MegCT in the PPPSP site. The results showed a clear phosphorylation in MegCT after
pre-stimulating the HK2 (+/-GF) cells with (1mg/ml) 𝜆 -LC. Likewise, higher
phosphorylation occurred with (5mg/ml) 𝜆-LC in both HK2 (+/-GF) cells, compared to
no phosphorylation that was detected from un-stimulated cells and a clear
phosphorylation with FAF-HSA (30mg/ml) and PDBU (10 and 20𝜇M) as positive
controls.
In 2011, Marzolo & Farfán documented that the phosphorylation of MegCT by GSK-3
is able to decrease its cell surface expression (negative megalin recycling), because
when GSK-3 was blocked with two different inhibitors (LiCl or SB216763) the MegCT
phosphorylation was decreased significantly; more megalin was expressed on the cell
surface and was more efficiently recycled (Yuseff et al., 2007).
The interaction of albumin or 𝜆-LC with proximal tubular epithelial cells and MegCT
phosphorylation in the PPPSP site involving GSK-3 will activate several signalling
pathways that regulate this phosphorylation event. In 2007, Yuseff et al. showed that
the PPPSP site in MegCT was phosphorylated mainly by GSK-3 with a small
contribution from PKC. In addition, they reported that the phosphorylation occurring by
PKC and PKA in different sites in the cytoplasmic domain receptor were not the main
phosphorylation target because the deletion of the region with the PPPSP motif
markedly reduced the megalin phosphorylation; that means PPPSP is the major
phosphorylation and/or a priming site to allow phosphorylation in other sites within the
megalin cytoplasmic domain.
223
Among the kinases that regulate the MegCT phosphorylation, there is PI3-Kinase,
which has role in several cellular functions such as cell growth, proliferation,
differentiation, motility, survival and intracellular trafficking. Many of these functions
relate to the ability of PI3K to activate protein kinase B (PKB) and C (PKC) (Peart &
Gross, 2006 and Cabezas et al., 2011). PKB, also known as AKT, and PKC are
serine/threonine-specific protein kinases. The PKC activate the extracellular-signal-
regulated kinases/ Mitogen-activated protein kinase (ERK/MAPK), and the activation
of ERK and PKB will inhibit GSK-3 (figure 6.12).
PI3K is implicated in several PTCs processes and a main regulator of MegCT
phosphorylation and albumin endocytosis in PTCs (Brunskill et al., 1998). In addition,
it regulates apoptosis by phosphorylating PKB, and phosphorylating PKB will lead to
inhibiting Bcl-2-associated death promoter (BAD) and thereby inhibits apoptosis
(Caruso-Neves et al., 2005); also, albumin-induced phosphorylation of MegCT is
dependent on ERK activity (Dixon & Brunskill, 2000). ERK is stimulated by oxidative
stress and has an inhibitory influence on PKB in PTCs (Sinha et al., 2004). Thus,
MegCT phosphorylation may be the result of a complex series of interactions between
ROS, ERK and PI3k/PKB activity. Also, these kinases are involved in GSK-3
activity/inhibition and regulate the MegCT phosphorylation. PI3K activates PKB/AKT,
which activates MAPK/ERK to inhibit GSK-3, and at the same time it activates PKB
also to inhibit GSK-3. However, when MAPK/ERK activates by ROS and this
activation lead to inhibit PKB/AKT, which lead to activate GSK-3 and phosphorylation
event will occur (Baines, 2010) (figure 6.12). To confirm this observation, the
production of ROS from HK2 (+/-GF) cells in our protein overload conditions will be
investigated in the next chapter.
224
FLC (Free Light Chain)
MegCT (Megalin Cytoplasmic Tail)
PI3K (Phosphatidylinositide 3-kinase)
PKB/AKT (Protein Kinase B)
PKC (Protein Kinase C)
ERK (Extracellular-signal-regulated kinases)
MAPK (Mitogen-activated protein kinase)
GSK3 (Glycogen synthase kinase 3)
ROS (Reaction Oxygen Species)
PTECs (Proximal Tubular Epithelial cells)
Activation
Inhibition
Stop
Phosphorylation
MegCT- XXXXXPPPSPXXXXX MegCT- XXXXXPPPSPXXXXX
P
GSK-3 Activation GSK-3 Inhibition
PI3K
PKB/AKT PKC
MAPK/ERK
GSK-3
ROS
Megalin Receptor
PTECs
GSK-3
PI3K
PKB/AKT PKC
MAPK/ERK
Albumin or FLC
P
ROS
Figure (6.12): Interactions of Albumin or 𝝀-LC with PTECs and different signalling kinase pathways that regulate
MegCT phosphorylation.
225
As explained initially, filtered proteins are reabsorbed in PTECs by receptor-mediated
endocytosis process such as megalin and cubilin receptors. Evidence suggests that other
receptors for those proteins might exist like CD36. In 2005, Caruso-Neves and his
group said a high concentration of albumin like in proteinuric conditions down regulates
megalin; in contrast, in proteinuric nephropathies, albumin up-regulates CD36 (Baines
et al., 2012).
In vitro, Baines et al. (2012) showed an increase in CD36 expression from HK2 cells
stimulated with albumin (10mg/ml) for 48h; also, in vivo they found an increase in
CD36 expression in PTC in kidney sections from patients with three different nephrotic
diseases. These results suggested a direct relation between CD36, albumin uptake and
reabsorption in PTECs. Another study also showed an increase in CD36 expression
from stimulated proximal tubular cells (LLC-PK1) with albumin (1 and 10mg/ml) for
36h, and this increase in CD36 may interact with thrombospondin-1 (TSP-1) and lead to
activating TGF-𝛽, which initiates and regulates fibrosis (Yang et al., 2007). Our results
agreed with previous studies in that stimulated HK2-GF cells with FAF-HSA (5mg/ml)
showed an increase in CD36 mRNA expression at 72h, however, HK2 cells showed the
opposite result. The CD36 expression was down regulated at 72h. Also, stimulating
HK2 (+/-GF) cells with 𝜆-LC (5mg/ml) showed a significant increase in CD36 mRNA
expression at 72h. Thus, our data showed increases in CD36 in our proteinuria
conditions with both albumin and 𝜆-LC, which might contribute to and cause further
progression of renal tubular dysfunction.
On the other hand, in in vivo proteinuric animal models of diabetic nephropathy megalin
expressions are down regulated (Baines et al., 2012). In vitro, the effects of protein
overload conditions on PTC megalin expression were studied by stimulating HK2 (+/-
GF) cells with FAF-HSA and 𝜆-LC for 24 and 72h. Our results showed that megalin
mRNA expression increased slightly in HK2-GF cells at 72h; in contrast, HK2 cells
showed a significant increase in megalin expression at 24h and persisted through 72h in
a time-dependent manner with FAF-HSA.
On the other hand, stimulating the cells with FAF-HSA showed an increase in megalin
expression from HK2-GF cells at 72h, however, HK2 cells showed significant elevation
in megalin mRNA levels at 24h and persisted through 72h. A previous study examined
the effect of a pathophysiological concentration of albumin on megalin mRNA
226
expression by incubating LLC-PK1 cells with a range of albumin (with fatty acid)
concentrations for 24h by RT-PCR. The results showed a decrease in megalin mRNA
by 40% with 20mg/ml (Caruso-Neves et al., 2005). By comparing this study with our
results, we can clarify that the megalin mRNA level increase in our protein overload
conditions could be because of the low concentration of albumin; they used a range of
albumin concentration starting with (0.1 up to 20 mg/ml) and the decrease was detected
just with five times higher concentration of albumin than our concentration. Also, they
used albumin with fatty acid and this might affect the results. In spite of this, 𝜆-LC
(5mg/ml) had no effect on mRNA megalin expression at 24h, but at 72h the level was
decreased significantly in HK2 (+/-GF) cells compared to the 24h expression level.
Taken together, the same (5mg/ml) FAF-HSA and 𝜆 -LC had different effects on
megalin mRNA expression from the HK2 (+/-GF) cells. Further studies are needed to
investigate the function relationship between megalin and CD36 expression.
In summary, our results in this chapter provide confirmation of our hypothesis that
MegCT is phosphorylated in vitro by using cell lysates derived from HK2 (+/-GF) cells
in response to FAF-HSA and 𝜆-LC, which might be has a role in PTECs damage in
proteinuric conditions.
227
Chapter Seven- Effects of Protein
Overload on Proximal Tubular Cells in
the Progression of Damage In Vitro
228
7. Introduction:
Renal failure means a decrease in kidney function. This condition can be a cause for
high morbidity and mortality, so early diagnosis is very important because it might help
to save the kidney from additional damage.
Proteinuria is recognised as a marker of renal disease and could be pre-glomerular
injury. Albuminuria causes PTCs injury that leads to kidney injury; this injury occurs
through the albumin uptake endocytosis process that leads to activate many different
intracellular signaling pathways in PTCs.
Inflammatory and dysregulation mechanisms in kidneys lead to nephron loss (Kriz &
LeHir, 2005). This chapter focuses on protein overloading of PTECs and the resultant
production of key cytokines and chemokines as an important cell type specific
mechanism responsible for the progression of renal insufficiency in proteinuric diseases
such as IL-6, IL-8 and MCP-1, which are made at a basal level by epithelial cells
(Stadnyk, 1994). It has been reported that albumin induces IL-8 in PTECs at both
transcriptional and translational levels (Tang et al., 2003). Also, a normal kidney
expresses MCP-1 (Wang et al., 1997) that is up regulated in PTCs challenged with
protein overload (Zoja et al., 2003). The effect of FAF-HSA and 𝜆 -LC (protein
overload) on mRNA expression and protein production for these cytokines from HK2
(+/-GF) cells was measured in this chapter to investigate their role in PTECs damage.
The application of developed complement inhibition to renal diseases with proteinuria
has previously been discussed (Inal et al., 2003) but the development has been
hampered by the need of treating progressive disease over a long period, more data are
needed. Many pathophysiological mechanisms have been proposed to be a reason for
proteinuria induced kidney injury such as the activation of the complement system
(Morita et al., 2000). There is accumulating evidence showed that complement
activation pathways in the PTECs may have a major role that leads to cell damage; this
might occur if complement components are activated in tubular cells then lead to cell
activation, resulting in tubular damage (Gaarkeuken et al., 2008). The alternative
pathway (AP) of the complement system is involved in kidney diseases. In in vitro
studies there was evidence that PTECs activate complement via AP by measuring the
229
C5b-9 membrane attack complex on cells surface; this measurement is in the presence
of AP-favoring Mg-EGTA conditions. In vivo, C3 and C5b-9 were found in PTCs in rat
kidneys induced by protein overload (Zoja et al., 2003).
In 1999, Peake and his group demonstrated that HK2 cells express mRNA for all the
alternative pathway components by PCR. The hypothesis that the protein overload
effects on the expression of AP complement components was examined in this chapter.
Also, one of the effects in response to protein overload is activation the hydrogen
peroxide (H2O2) pathway and generation H2O2 in human proximal tubular cells (Abbate
et al., 2006). The production of H2O2 from the PTCs as a response to protein overload
may activate different cascades, leading to inflammation, fibrosis or apoptosis for cells.
For example, the production of H2O2 will activate the caspase cascades and lead to cell
apoptosis; also, it will stimulate IL-8 and TGF-𝛽1 and lead to cell fibrosis (Imai et al.,
2004). The effect of FAF-HSA and 𝜆-LC on H2O2 generation and their role in PTECs
damage was investigated in the chapter.
Lastly, this chapter scans for possible biomarkers of proteins that might induce kidney
injury. An array was used in order to identify a potential biomarker from in vitro studies
that could be useful in early diagnosis, guiding targeted intervention and monitoring
disease progression and resolution. 38 different types of protein biomarkers were
examined for kidney injury. They divided to four main categories: low molecular
weight proteins, up regulated proteins, cytokines/chemokines and anti-inflammatory
cytokines (figure 7.17).
7.1 Aim:
The aim of this chapter is to study how protein overloading might modulate/influence
production of inflammatory markers, complementary components and ROS, which is
implicated in the progression of cell injury and kidney disease.
230
7.2 Results:
7.2.1 Evaluation the effect of FAF-HSA and 𝝀-LC on cytokine
production in HK2 (+/-GF) cells:
A significant increase in LDH release was detected in the supernatant of the HK2 (+/-
GF) cells exposed to (5mg/ml) FAF-HSA and 𝜆-LC for 24 and 72h. The supernatants
from the experiments were used to measure cytokines and chemokines (see 5.2.1.2.1).
Interleukin-6 (IL-6), interleukin IL-8 (IL-8) and monocyte chemo attractant protein-1
(MCP-1) were measured in the supernatants using commercial human ELISA kits.
Also, total RNA was isolated from the control and stimulated HK2 (+/-GF) cells at the
different time-points to quantify IL-6, IL-8 and MCP-1 gene expression.
Epithelial cells produce IL-6 constitutively (Krueger et al., 1991). Therefore, the effects
of FAF-HSA and 𝜆-LC on IL-6 production from HK2 (+/-GF) cells were evaluated.
There was a marked effect on IL-6 secretion (7.1 (A)). HK2-GF cells showed a quick
response with FAF-HSA stimulation at 24h and the maximum effect was seen at 72h of
exposure, the longest time interval tested in these studies, compared to un-stimulated
control cells and medium alone. Also, HK2-GF showed a similar response with 𝜆-LC
stimulation; IL-6 secretion was increased significantly at 24h and the highest IL-6
secretion was at 72h. However, HK2 cells show strong late IL-6 production at 72h in
response to both proteins (7.1 (A)).
Figure (7.1 (B)) shows a direct comparison between mRNA levels of IL-6 from HK2
(+/-GF) cells after 24 and 72h treating with (5mg/ml) FAF-HSA. Treating HK2 (+/-GF)
cells with FAF-HSA for 24h up-regulated the IL-6 mRNA expression significantly. On
the other hand, they showed an important decrease at 72h of stimulation compared to
the control by RT-PCR. The results are presented as a ratio of densitometric values for
the gene relative to β-actin mRNA expression from each control and stimulated sample
using Image J software. Next, in figure (7.1 (C)), after 𝜆-LC stimulation the expression
of IL-6 increased in a time-dependent manner from HK2 (+/-GF) cells compared to
control by RT-qPCR; 2^- ΔΔ CT value was used, then the mRNA expression was
normalised to β-actin and calibrated to the average of un-treated controls. HK2 cells
stimulated with (5mg/ml) 𝜆-LC for 72h showed the highest IL-6 expression.
231
C 2
4h
24h
C 7
2h
72h
C 2
4h
24h
C 7
2h
72h0.0
0.5
1.0
1.5
2.0
2.5
Rat
io o
f m
RN
A (
IL
6 /β-a
ctin
)
GF HK2
**
**
* **
FAF-HSA
C2
42
4C
72
72
C2
42
4C
72
72
C2
42
4C
72
72
C2
42
4C
72
720
100
200
300
400
500
IL6 (
pg/m
l)
FAF-HSA
l-LC
Med
ium
HK2 HK2GF
***
***
***
***
*** ***
GF
232
𝝀-LC
Con
trol
24h 72
h
24h
72h0
5
10
15
m R
NA
IL
6 ex
pres
sion
(Fol
d ch
ange
vs.
cont
rol)
***
***
***
**
GF HK2
Figure (7.1): The effects of 𝜆-LC and FAF-HSA on IL-6 protein production and
mRNA expression by HK2 (+/-GF) cells. Cells were sub-cultured in 6 well plates (5
x 105 cells/well) and incubated with 𝜆-LC or FAF-HSA (5mg/ml) for 24 and 72h.
The supernatants were collected and IL-6 secretion was measured (ELISA), and
total RNA (2𝜇g) from each sample was prepared to study IL-6 gene expression
(PCR). Un-treated cells were used as the control. (A) 𝜆 -LC and FAF-HSA
significantly stimulated IL-6 protein production at 72h from HK2 cells, however,
HK2-GF produced IL-6 from the first 24h of stimulation time with both proteins.
(B) The expression of IL-6 mRNA was increased at 24h with FAF-HSA and
decreased after 72h in HK2 (+/-GF) cells (semi-quantitative RT-PCR). The results
are presented as a ratio of densitometry analysis of the gene relative to β-actin
mRNA expression (housekeeping gene) using Image J software. (C) 𝜆 -LC
stimulation leads to a time-dependent increase of IL-6 expression in HK2 (+/-GF)
cells (RT-qPCR) (2^-ΔΔCT value was used, the mRNA expression normalized to β-
actin and calibrated to the average of un-treated controls). The data are represented
as means of duplicate ± SD (n = 2) (Unpaired t test P < 0.05), C: control sample.
233
Tubular epithelial cells produce IL-8 and they are regulated by a variety of pro-
inflammatory cytokines like TNF-α (Tang et al., 2003). The effects of FAF-HSA and 𝜆-
LC on IL-8 secretion by HK2 (+/-GF) cells are shown in figures (7.2 (A)). After 24h of
exposure to 𝜆 -LC IL-8 production was increased, but the levels were significantly
decreased by prolonged treatment for 72h for both HK2 (+/-GF) cells. In contrast,
exposure HK2 (+/-GF) cells to FAF-HSA had no effect on IL-8 levels after 24 and 72h,
but there was a significant rise at 72h of stimulation of HK2 cells with FAF-HSA. IL-8
was measured in the supernatants of un-stimulated cells and medium alone as controls.
𝜆-LC incubation leads to a peak response of IL-8 at 24h regardless of the culture media
used, and with or without the EGF cocktail. By contrast, the late production of IL-8
caused at 72h by FAF-HSA is blunted in the presence of EGF. The expression of IL-8
was increased gradually with time by (5mg/ml) FAF-HSA at 24 and 72h from HK2-GF
cells, but HK2 cells showed an increase at 72h compared to its controls (figure 7.2 (B))
HK2 (+/-GF) cells behaved similarly; IL-8 mRNA expression was up regulated by
(5mg/ml) 𝜆-LC at 24h, and the increase in expression peaked at 72h compared to the
control (figure 7.2 (C)). These 72h increases could indicate that the HK2 cells are not
exhausted in their IL-8 production at this time point, but rather up regulate their mRNA
expression.
C2
4
24
C7
2
72
C2
4
24
C7
2
72
C2
4
24
C7
2
72
C2
4
24
C7
2
720
200
400
600
800
1000
1200
IL8 p
g/m
l
**
**
FAF-HSA λ-LC
Med
ium
**
*
****
**
***
HK2 GFGF HK2
234
C 2
4h
24
h
C 7
2h
72
h
C 2
4h
24
h
C 7
2h
72
h0.0
0.5
1.0
1.5
Rat
io o
f m
RN
A (
IL
8 /β-a
ctin
)
GF HK2
****
**
FAF-HSA
𝝀-LC
Con
trol
24h
72h 24
h
72h0
1
2
3
4
5
m R
NA
IL8
expr
essi
on
(Fol
d ch
ange
vs.
cont
rol)
***
***
**
**
GF HK2
Figure (7.2): The impacts of 𝜆-LC or FAF-HSA on IL-8 protein production and
mRNA expression by HK2 (+/-GF) cells. Cells were sub-cultured in 6 well plates
(5 x 105 cells/well) and incubated with (5mg/ml) 𝜆-LC or FAF-HSA for 24 and
72h. The supernatants were collected and IL-8 protein production was measured
(ELISA), and total RNA (2𝜇g) from each sample was prepared to study IL-8 gene
expression (PCR). Un-treated cells were used as the control. (A) 𝜆 -LC
significantly stimulated the production of IL-8 in 24h from HK2 (+/- GF) cells,
while FAF-HSA had no effect, except for the significant increase of IL-8
production from HK2 cells in 72h. (B) The expression of IL-8 mRNA was
increased with FAF-HSA at 72h from HK2 (+/-GF) cells (semi-quantitative RT-
PCR). The results are presented as a ratio of densitometry analysis of the gene
relative to β-actin mRNA expression (housekeeping gene) using Image J software.
(C) However, with 𝜆 -LC stimulation of the IL-8 expression rose in a time-
dependent manner in HK2 (+/-GF) cells by (RT-qPCR) (2^-ΔΔCT value was used,
and the mRNA expression normalized to β-actin and calibrated to the average of
un-treated controls). The data are represented as means of duplicate ± SD (n = 2)
(Unpaired t test P < 0.05), C: control sample.
235
Proximal tubular epithelial cells are one of major sources of MCP-1. Chemokine MCP-
1 production is increased in proteinuric conditions. In addition, it plays a major role in
the proximal tubule to produce inflammatory mediators (Wang & Sanders, 2007).
Overnight incubation of HK2 cells with FAF-HSA and 𝜆-LC had no effect on MCP-1
secretion, but it was enhanced at 72h compared to the control cells. On the other hand,
HK2-GF cells showed a slight increase in the MCP-1 production after FAF-HSA and 𝜆-
LC at 24h, and a further increase at 72h just by 𝜆-LC (figure 7.3 (A)).
Presence of the EGF cocktail seems to dampen MCP-1 release and this extends 𝜆-LC
and FAF-HSA induced mRNA expression; the expression of MCP-1 mRNA was
significantly up regulated by 𝜆-LC steadily at 24 and 72h from HK2-GF cells. Also,
HK2 cells appeared to increase in MCP-1 expression at 24h, but at 72h the expression
highly increased compared to the control. FAF-HSA had no effect on MCP-1 mRNA
expression with HK2 (+/-GF) cells compared to the controls, except the slight increase
from HK2 cells at 72h (figure 7.3 (B and C)).
In summary, these results suggest that FAF-HSA and 𝜆 -LC stimulated several
inflammatory mediators in HK2 (+/-GF) cells, which may have a role in proximal
tubular inflammation.
236
FAF-HSA
C 2
4h
24
h
C 7
2h
72
h
C 2
4h
24
h
C 7
2h
72
h0.0
0.5
1.0
1.5
Rat
io o
f m
RN
A (
MC
P-1
/β-a
ctin
)
GF HK2
**
*
C2
42
4C
72
72
C2
42
4C
72
72
C2
42
4C
72
72
C2
42
4C
72
720
100
200
300
400
500
MC
P-1
(p
g/m
l)
*
FAF-HSA
l-LC
Med
ium
**
***
*
***
GF HK2GF HK2
237
𝝀-LC
Con
trol
24h
72h
24h 72h0
5
10
15
m R
NA
MC
P-1
exp
ress
ion
(Fol
d ch
ange
vs.
cont
rol)
**
****
****
**
GF HK2
Figure (7.3): The effects of 𝜆-LC or FAF-HSA on MCP-1 protein production and
mRNA expression from HK2 cells (+/-GF). Cells were sub-cultured in 6 well
plates (5 x 105 cells /well) and incubated with 𝜆-LC or FAF-HSA (5mg/ml) for 24
and 72h. The supernatants were collected and MCP-1 protein production was
measured (ELISA), and total RNA (2𝜇g) from each sample was prepared for
MCP-1 gene expression (PCR). Un-treated cells were used as the control. (A) 𝜆-
LC significantly stimulated the production of MCP-1 in 72h from HK2 (+/-GF)
cells while FAF-HSA had no effect, except the significant increase of MCP-1
production from HK2 cells in 72h. (B) The FAF-HSA had no effects on MCP-1
mRNA expression, except the increase at 72h from HK2 cells (semi-quantitative
RT-PCR). The results are presented as a ratio of densitometry analysis of the gene
relative to β-actin mRNA expression (housekeeping gene) using Image J
software. (C) 𝜆 -LC stimulation MCP-1 expression rise with the time (time-
dependent) in HK2 (+/-GF) cells by (RT-qPCR) (2^-ΔΔCT value was used, the
mRNA expression normalized to β-actin and calibrated to the average of un-
treated controls). The data are represented as means of duplicate ± SD (n = 2)
(Unpaired t test P < 0.05), C: control sample.
238
7.2.2 Complement component production by HK2 (+/-GF) cells:
To study the alternative pathway (AP) complement components in protein overload
conditions, HK2 (+/-GF) cells were sub-cultured in 6 well plates and incubated with
FAF-HSA or 𝜆-LC (5mg/ml) for 24 and 72h; cell protein lysates and total mRNA from
control and stimulated samples were prepared for protein production by Western blot
and gene expression by PCR.
C3 is an essential complement protein to activate AP (Zoja et al., 2003). The effects of
protein overload on C3 complement components are shown in figure (7.4). HK2 (+/-
GF) cells stimulated with FAF-HSA up regulated C3 mRNA expression after 24h. At
72h, the expression from HK2-GF was decreased comparing to the 24h sample but still
higher than control sample at the same time point, however, HK2 cells persisted the
elevation through 72h (figure 7.4 (A)). Comparably, there is a significant time
dependent increase in C3 mRNA after 𝜆-LC treatment of HK2 (+/-GF) cells over 24
and 72h (7.4 (B)).
Complement factor B (FB) mRNA expression was increased in HK2 (+/-GF) cells
stimulated with FAF-HSA at 24h and it returned to the normal level compared to the
control samples at 72h (figure 7.5 (A)). This contrasted with findings obtained for HK2
(+/-GF) cells stimulated with 𝜆-LC for 24h. The greater increase for FB mRNA was
observed for HK2 stimulated with 𝜆-LC for 72h (figure 7.5 (B)).
Complement Factor H (FH) is the important AP regulator to balance between the
complement activation and inhibition, which might be disturbed in the proteinuria
condition. For example, albumin reduces FH binding (Fearn & Sheerin, 2015). FH
mRNA expresses from HK2 cells (Peake et al., 1999) and the protein production was
detected from human proximal tubular epithelial cells (Zhou et al., 2001).
Properdin or FP reportedly has a major role in stabilising the AP convertase in tubular
epithelium cells when binding to glycosaminoglycans on cell surfaces (Fearn &
Sheerin, 2015). HK2 cells express FP mRNA (Peake et al., 1999).
Our result showed that the mRNA was increased after 24h of stimulation with FAF-
HSA (5mg/ml) for HK2 (+/-GF) cells; however, at 72h HK2-GF decreased the
expression of FH, but the expression was still high from the HK2 cells (figure 7.6 (A)),
239
contrasting with 𝜆-LC stimulation, which led to a significant reduction or no change in
FH mRNA expression from HK2 (+/-GF) cells at 24 and 72h (figure 7.6 (A)). Notably,
the HK2 (+/-GF) cells treated with 𝜆-LC did not significantly increase the mRNA
expression for FH in both 24 and 72h incubation, although, the same samples did yield
enhancement of C3 and FB mRNA. The absence of an increase in mRNA coding for the
main regulator of the AP may be functionally important in increasing complement-
mediated damage, if reduced mRNA coincides with reduced protein production. C3b is
formed by the cleavage of C3 complement component to C3a and C3b. C3b binds to FB
to create unstable C3bBb and to be stable should bind to properdin or factor P (FP),
which promotes the association of C3b with FB and inhibits FH. As shown in figure
(7.7 (A)) the mRNA FP expression was increased significantly from HK2-GF cells after
72h of treatment with FAF-HSA, but there was no change in properdin mRNA
expression in HK2 cells. On the other hand, 𝜆-LC stimulation led to an increase in the
mRNA FP level at 24 and 72h from both HK2 (+/-GF) cells compared to their un-
stimulated controls (figure 7.7 (B)).
240
C 2
4h
24
h
C 7
2h
72
h
C 2
4h
24
h
C 7
2h
72
h0.0
0.5
1.0
1.5
2.0
2.5
Rat
io o
f m
RN
A (
C3 /β-a
ctin
)
GF HK2
*
* *
***
FAF-HSA
Con
trol
24h 72h
24h
72h0
1
2
3
4
5
m R
NA
C3
expr
essi
on
(Fol
d ch
ange
vs.
cont
rol)
****
****
****
****
GF HK2
𝝀-LC
Figure (7.4): Effects of FAF-HSA or 𝜆-LC on C3 mRNA expression from HK2
(+/-GF). Cells were sub-cultured in 6 well plates (5 x 105 cells/well) and
incubated with (5mg/ml) 𝜆-LC or FAF-HSA for 24 and 72h. (A) The FAF-HSA
up-regulate C3 expression from HK2 (+/-GF) compared to the control by (semi-
quantitative RT-PCR). The results are presented as a ratio of densitometry
analysis of the gene relative to β-actin mRNA expression (housekeeping gene)
using Image J software. (B) 𝜆-LC elevates C3 expression in a time dependent
manner) in HK2 cells (+/-GF) by (RT-qPCR) (2^- ΔΔCT value was used, the
mRNA expression normalized to β-actin and calibrated to the average of un-
treated controls). The data are represented as means of duplicate ± SD (n = 2)
(Unpaired t test P < 0.05).
241
C 2
4h
24
h
C 7
2h
72
h
C 2
4h
24
h
C 7
2h
72
h0.0
0.2
0.4
0.6
0.8R
atio
of
mR
NA
(F
B /β-a
ctin
)
GF HK2
**
**
FAF-HSA
Contr
ol
24
h
72
h
24
h
72
h0
1
2
3
4
5
m R
NA
FB
exp
ress
ion
(Fol
d c
hang
e vs
.cont
rol)
**
**
GF HK2
𝝀-LC
Figure (7.5): Impacts of FAF-HSA or 𝜆-LC on FB mRNA expression from HK2
(+/-GF). Cells were sub-cultured in 6 well plates (5 x 105 cells/well) and
incubated with (5mg/ml) 𝜆-LC or FAF-HSA for 24 and 72h. (A) FAF-HSA up-
regulates FB expression from HK2 (+/- GF) at 24h comparing with the control
(semi-quantitative RT-PCR). The results are presented as a ratio of densitometry
analysis of the gene relative to β-actin mRNA expression (housekeeping gene)
using Image J software. (B) 𝜆-LC had no effects on FB expression except the
significant increase from HK2 cells at 72h by (RT-qPCR) (2^-ΔΔCT value was
used, the mRNA expression normalized to β-actin and calibrated to the average of
un-treated controls). The data are represented as means of duplicate ± SD (n = 2)
(Unpaired t test P < 0.05).
242
C 2
4h
24
h
C 7
2h
72
h
C 2
4h
24
h
C 7
2h
72
h0.0
0.5
1.0
1.5
2.0R
atio
of
mR
NA
(F
H /β-a
ctin
)
GF HK2
**
**
** ***
FAF-HSA
Contr
ol
24
h
72
h
24
h
72
h0
1
2
3
4
5
m R
NA
FH
expre
ssio
n
(Fold
chan
ge
vs.
contr
ol)
**** ****
GF HK2
𝝀-LC
Figure (7.6): Effects of FAF-HSA or 𝜆-LC on FH mRNA expression from HK2 (+/-GF).
Cells were sub-cultured in 6 well plates (5 x 105 cells/well) and incubated with (5mg/ml) 𝜆-
LC or FAF-HSA for 24 and 72h. (A) FAF-HSA elevates FH expression from HK2 (+/- GF)
at 24h comparing with the control (semi-quantitative RT-PCR). The results are presented as
a ratio of densitometry analysis of the gene relative to β-actin mRNA expression
(housekeeping gene) using Image J software. (B) 𝜆-LC decreased FH expression by (RT-
qPCR)(2^-ΔΔCT value was used, the mRNA expression normalized to β-actin and calibrated
to the average of un-treated controls). The data are represented as means of duplicate ± SD
(n = 2) (Unpaired t test P < 0.05).
243
FAF-HSA
Con
trol
24h
72h
24h 72
h0
2
4
6
m R
NA
Pro
perd
in e
xpre
ssio
n
(Fol
d ch
ange
vs.
cont
rol) ***
GF HK2
Con
trol
24
h
72
h
24
h
72
h0
2
4
6
m R
NA
Pro
perd
in e
xpre
ssio
n
(Fol
d ch
ange
vs.
cont
rol)
****
**
****
GF HK2
𝝀-LC
Figure (7.7): Effects of FAF-HSA or 𝜆-LC on Properdin mRNA expression
from HK2 (+/-GF). Cells were sub-cultured in 6 well plates (5 x 105
cells/well) and incubated with (5mg/ml) 𝜆-LC or FAF-HSA for 24 and 72h.
(A) FAF-HSA elevates properdin expression from HK2-GF at 72h, but no
significant change in HK2 cells at both time points compared to the control.
(B) Also, 𝜆-LC increase properdin mRNA expression at 72h from HK2 (+/-
GF) by (RT-qPCR)(2^- ΔΔ CT value was used, the mRNA expression
normalized to β-actin and calibrated to the average of un-treated controls).
The data are represented as means of duplicate ± SD (n = 2) (Unpaired t test P
< 0.05).
244
Because there is not necessarily concordance between mRNA expression and protein
production, complement components protein production in HK2 (+/-GF) cells were
examined. The extracted protein lysates from stimulated HK2 (+/-GF) cell with FAF-
HSA or 𝜆-LC (5mg/ml) at 24, 72h and un-stimulated control samples were analysed by
Western blot.
The C3 protein production was noticeably elevated from stimulated HK2 (+/-GF) cells
with FAF-HSA at 24h and continually up-regulated with the longer time incubation
72h. Compared to the level of C3 from un-treated control cells, HK2 and HK2-GF
behaved similarly (figure 7.8 (B)). Meanwhile, stimulating the HK2 (+/-GF) cells with
𝜆-LC increased the C3 production at 24h. Nerveless, the C3 level was clearly reduced at
72h compared to the C3 production level from the 24h stimulated sample, but the
production was still higher than the control samples (figure 7.8 (B)).
Following, the results figure (7.9 (C)) displays elevated FB levels from HK-GF cells at
24h of FAF-HSA stimulation, but at 72h the FB production was decreased to the basal
level. However, there was no significant effect on FB at 24 and 72h of stimulation of
HK2 cells with FAF-HSA. Moreover, 𝜆-LC had the same effect as FAF-HSA on HK2-
GF cells in increasing FB production with no effect on HK2 cells at 24h. In contrast, 𝜆-
LC stimulation led to an increase in the FB production significantly at 72h from HK2
cells.
The protein bands were quantified by scanning densitometer ImageJ software in figure
(7.8 (B) and 7.9 (C)), respectively. In addition, FH (polyclonal 150kDa) and properdin
(polyclonal 55kDa) have been detected by Western blot; however, the bands were too
faint to be analysed (data not shown).
245
𝜷 -Actin
42 kDa
C S C S
72h 24h
C S C S
72h 24h
FAF-HSA 𝝀-LC
GF
H
K2
C3
100 kDa
C 2
4h
24
h
C 7
2h
72
h
C 2
4h
24
h
C 7
2h
72
h
0
1
2
3
4
5
Den
sit
om
erty
rati
on
(C
3 /β-a
cti
n)
HSA-FFA
GF
*
** *****
HK2
C 2
4h
24
h
C 7
2h
72
h
C 2
4h
24
h
C 7
2h
72
h
0
1
2
3
4
5
LC
Den
sit
om
erty
rati
on
(C
3 /β-a
cti
n)
GF
**
***
HK2
𝝀-LC FAF-HSA
Figure (7.8): Effects of exposure to FAF-HSA or 𝜆-LC on C3 protein production
from HK2 (+/-GF) cells. Cells were sub-cultured (5 x 105 cells/well) in 6 well plates
and stimulated with FAF-HSA or 𝜆-LC (5mg/ml) for 24 and 72h. Cell lysates were
prepared and analysed by Western blot. (A) Strongest C3 production from HK2 (+/-
GF) cells was observed at 72h of stimulation with FAF-HSA, while the 𝜆 -LC
increased C3 abundance early (24h) in HK2 (+/-GF) cells. 𝛽-actin was used as the
loading control. (B) Densitometric analysis of C3 protein production in (A). The
results are presented as a ratio of densitometry analysis of C3 to β-actin using Image J
software. The data are represented as means ± SD (n = 2) (Unpaired t test P < 0.05),
C: control sample and S: stimulated sample.
246
FB
95 kDa
C S C S
24h 72h
C S S
24h 72h
GF
H
K2
𝝀-LC FAF-HSA
kDa
130
100
70
50
Human Plasma
(positive control
for FB)
C 2
4h
24
h
72
h
C 2
4h
24
h
72
h0
2
4
6
HSA-FFA
GF
Den
sito
mer
ty r
atio
n (
FB
/β-a
ctin
)
HK2
**
C 2
4h
24
h
C 7
2h
72
h
C 2
4h
24
h
C 7
2h
72
h0
1
2
3
4
LC
Den
sit
om
erty
rati
on
(F
B /β-a
cti
n)
GF
*****
HK2
𝝀-LC FAF-HSA
Figure (7.9): Effects of exposure to FAF-HSA or 𝝀-LC on FB protein production
from HK2 (+/-GF) cells. Cells were sub-cultured (5 x 105 cells/well) in 6 well
plates and stimulated with FAF-HSA or 𝛌-LC (5mg/ml) for 24 and 72h. Cell
lysates were prepared and analysed by Western blot. (A) Positive control for FB in
25𝝁𝒍 of human serum albumin (1:100 dilutions in H2O). (B) FAF-HSA and 𝝀-LC
elevated FB production from HK2- GF cells at 24h. 𝜷 -actin was used as the
loading control. (C) Densitometric analysis of FB protein production in (A). The
results are presented as a ratio of densitometry analysis of FB to β-actin (loading
control) using Image J software. The data are represented as means ± SD (n = 2)
(Unpaired t test P < 0.05), C: control sample and S: stimulated sample.
247
From figure (7.10) it can be concluded that FAF-HSA and 𝜆-LC up-regulated the C3
mRNA expression and protein production at both time points, except the C3 production
at 72h with 𝜆-LC was decreased compared to the 24h C3 production.
Also, FB mRNA was increased at 24h with FAF-HSA and then decreased at 72h to the
normal control level. In contrast, 𝜆-LC had no effect at 24h on FB expression from HK2
(+/-GF) cells but at 72h HK2-GF decreased and HK2 cells increased FB expression
significantly.
About FH, FAF-HSA had the same effect on HK2 (+/-GF) cells FH mRNA elevated at
24h and 72h except HK2-GF was decreased at 72h. On the other hand, 𝜆-LC had no
effect on FH mRNA expression in HK2 (+/-GF) cells except HK2 was increased at 72h.
Interestingly, it was noticed that FH and FP behaved oppositely. From figure (7.10)
with FAF-HSA stimulation when FH mRNA increased, there was no change in the FP
mRNA but when the FP increased at 72h from HK2-GF cells the FH decreased. Also,
when HK2 (+/-GF) cells were stimulated with 𝜆-LC the FP mRNA expression was
increased at both time points, however, no change in FH mRNA levels was detected.
The lacks of analysis of alternative forms of FH do not allow firm conclusions to be
drawn from this seemingly opposing behaviour FH/FP.
248
AP components 24h 72h 24h 72h 24h 72h 24h 72h
C3 mRNA/Protein
FB mRNA/Protein
P mRNA _ _ _
FH mRNA _ _ _
Figure (7.10): Juxtaposition of mRNA and protein for AP components (C3, FB, P and FH) from HK2 (+/-GF) stimulated with FAF-HSA
and 𝜆-LCfor 24 and 72h. The results in this figure are compiled from comparisons with the control samples for each time point.
Increase Decrease No change
FAF-HSA
GF HK2
𝝀-LC
GF HK2
249
7.2.3 Effect of Protein Overload on H2O2 production:
To investigate if protein overload conditions are capable of generating H2O2 that could
be one of cells damage causes in proteinuric condition, HK2 (+/-GF) cells were sub-
cultured in 96 well plates and exposed to FAF-HSA or 𝜆-LC (5mg/ml) over a time
course (5, 10, 20, 30, 60 and 360min) to measure the H2O2 generation. Intracellular
content and release of H2O2 in supernatants were measured by the oxidant-sensitive
dye, carboxy-H2DCFDA. The medium alone was measured as background control.
FAF-HSA and 𝜆-LC induced intracellular and extracellular release of H2O2 in HK2
(+/GF) cells. The FAF-HSA induced intracellular production of H2O2 from HK2-GF
after 5min of incubation; however, the maximum production was at 10min of
stimulation time and after that the production was decreased gradually with increasing
times of incubation. Similarly, the 𝜆-LC induced the H2O2 production from HK2-GF
cells at 5min of incubation and the maximum production was at 10min of stimulation;
after that the production reduced compared to H2O2 production from the control sample.
However, the amount of H2O2 that was produced from stimulated HK2-GF cells with
(5mg/ml) 𝜆 -LC at 10min was significantly higher over HK2-GF stimulated with
(5mg/ml) FAF-HSA at 10min by approximately a two-fold increased (figure 7.11 (A)).
A parallel and significant increase in the extracellular H2O2 release occurred throughout
the observation period. FAF-HSA showed significant elevation in the H2O2 release from
HK2-GF by the same level at 5, 10 and 20min incubation periods, but from 30 up to
360min the secretion was reduced gradually with the time. Comparably, when HK2-GF
cells were exposed to 𝜆-LC the H2O2 release was significantly raised at 5min, remaining
elevated until 60min. Also, by comparing the amount of the H2O2 that was released
from HK2-GF cells stimulated with 𝜆-LC, it was significantly higher over the HK2-GF
stimulated with FAF-HSA (figure 7.11 (A)). In addition, the extracellular production
remained high until 1h with 𝜆-LC incubation; however, with FAF-HSA it started to
decrease after 30min time of incubation.
HK2 cells showed a slight increase in the H2O2 intracellular production after FAF-HSA
stimulation at all-time points. Likewise, 𝜆-LC induced the H2O2 production from HK2
cells at 5min and the maximum production were at 20min, and then the production
decreased but was still higher than the control sample. After that, the H2O2 released
250
from HK2 cells stimulated with FAF-HSA was elevated at 5min and remained up until
30min, but at 60min the cells showed the maximum release, and at 360min the release
was returned to the normal level compared to the control sample. In contrast, when HK2
cells were exposed to 𝜆-LC, the H2O2 extracellular release was increased at 5min and
persisted throughout the 360min (figure 7.11 (B)).
Moreover, in order to detect H2O2 production in the medium collected from HK2 (+/-
GF) cells sub-cultured in 6 well plates with density (5 x 105 cells/well) and stimulated
with FAF-HSA or 𝜆-LC (5mg/ml) for 24 and 72h (prolonged incubation), Amplex red
was used.
Overnight incubation of HK2-GF cells with FAF-HSA decreased the medium level of
H2O2 at 24 and 72h, when compared with the medium of un-stimulated control cells. In
contrast, exposed HK2-GF cells to 𝜆-LC produced a slightly detectable level of H2O2 at
24h, but at 72h the level returned to the normal level compared to the control (figure
7.12 (A)). On the other hand, HK2 cells showed a reduction in the H2O2 release at both
time points with FAF-HSA stimulation compared to the control samples. Also, with 𝜆-
LC stimulation both incubation periods showed a significant decrease in H2O2 released
in the medium compared to H2O2 levels in the control sample medium (figure 7.12 (B)).
In summary, 𝜆-LC led to an increase in the H2O2 intracellular production more than
FAF-HSA at 10min, and at the longest time of incubation 360min with both proteins the
H2O2 production decreased significantly in HK2-GF cells. However, the extracellular
secretion of H2O2 was higher with 𝜆-LC than FAF-HSA incubation, but it reduced to
the normal level with FAF-HSA and remained high with 𝜆-LC at the 360min incubation
period. The HK2 cells increased the H2O2 cell production at 60min with FAF-HSA and
the level decreased with the longer time of incubation, but 𝜆-LC showed a quicker
response and the significant increase at 20min and the level remained high with the
longest incubation period of 360min.
Comparing the H2O2 intracellular production from HK2 (+/-GF) cells after stimulation
with both proteins showed that HK2-GF cells increased the H2O2 cell production
quicker than HK2 cells with both proteins, but the level was decreased from HK2-GF at
360min; however, it remained high in HK2 cells, which means the HK2 still produce
more H2O2.
251
Regarding extracellular release, HK2-GF cells also showed a quicker response with
FAF-HSA, however, HK2 showed extreme production at 60min. Additionally, HK2-GF
elevated the release of H2O2 and this production decreased at 360min, but HK2 cells
increased the production and this elevation remained until the 360min incubation period
with 𝜆-LC. Lastly, at 24 and 72h of incubation time, HK2 (+/-GF) cells showed a
decrease in H2O2 release with both stimulator proteins.
In conclusion, this experiment has shown that in HK2 (+/-GF) cells, FAF-HSA and 𝜆-
LC elicited rapid H2O2 generation in cell supernatant as well as at the intracellular level.
252
C 5 10 20 30 60 360 C 5 10 20 30 60 36
00
1000
2000
3000
4000
5000
HK2-GF Cells
Flu
ore
scen
ce I
nte
sity
min
*
***
FAF-HSA l-LC
C 5 10 20 30 60360 C 5 10 20 30 6036
00
5000
10000
15000
HK2-GF Supernatant
Flu
ores
cen
ce I
nte
sity
min
Med
ium
****
****
FAF-HSA l-LC
C 5 10 20 30 60 360 C 5 10 20 30 60 36
00
1000
2000
3000
4000
5000
Flu
ore
scen
ce I
nte
sity
min
***
***
FAF-HSA l-LC
HK2 Cells
C 5 10 20 30 60360 C 5 10 20 30 60
3600
5000
10000
15000
HK2 Supernatant
Flu
ore
scen
ce I
nte
sity
min
Med
ium
**** ****
FAF-HSA l-LC
253
Figure (7.11): Time course of H2O2 generation in HK2 (+/-GF) cells. HK2 (+/-
GF) cells sub cultured in 96 well plates with density (1 x 103 cells /well) and
exposed to FAF-HSA or 𝜆-LC (5mg/ml) for (5, 10, 20, 30 60 and 360 min).
H2O2 production within the cells or cell supernatants was measured by the
oxidant-sensitive dye, carboxy-H2DCFDA. The medium alone was measured as
the background control. C: control samples. (A) HK2-GF and (B) HK2 cells
showed the H2O2 intracellular and extracellular production after exposed to
FAF-HSA and 𝜆-LC. The data are represented as means of duplicate ± SD (n =
2) (Unpaired t test P < 0.05).
HK2-GF
C 2
4h
24
h
C7
2h
72
h
C 2
4h
24
h
C7
2h
72
h0
2
4
6
8
10
Med
ium
H2O
2 p
rod
uct
ion
(µ
M)
**
*
FAF-HSA l-LC
254
HK2
Figure (7.12): Effect of FAF-HSA or 𝜆-LC on H2O2 production by
HK2 (+/-GF) cells. Cells were incubated with (A) FAF-HSA or (B)
𝜆-LC (5mg/ml) for 24 and 72h. At the end of incubation, H2O2
production was measured in cell supernatants by Amplex Red
method. The medium alone was measured as the background control.
C: control samples. The data are represented as means of duplicate ±
SD (n = 3) (Unpaired t test P < 0.05).
C 2
4h
24
h
C7
2h
72
h
C 2
4h
24
h
C7
2h
72
h0
2
4
6
8
10
Med
ium
H2O
2 p
rod
uct
ion
(µ
M)
* *
FAF-HSA l-LC
255
7.2.4 Study of potential biomarkers of human kidney injury using an
in vitro protein stimulation model:
Apoptosis and inflammatory mediators can contribute to kidney injury in proteinuric
condition. The proteome profiler array kit was used to detect different biomarker
proteins that may have a role in renal cell damage.
To identify early kidney cell injury biomarkers, HK2-GF cells were sub-cultured in 6
well plates (1x 106 cells/well) and stimulated with FAF-HSA (5mg/ml), 𝜆-LC (1 and 5
mg/ml) for 72h. Un-treated HK2-GF cells were used as the control. HK2-GF was
chosen because they were grown in the same medium that primary cells grow in; 𝜆-LC
concentrations were decided to examine the dose effect on the cells and the FAF-HSA
to examine the mechanism of damage between 𝜆-LC and FAF-HSA by using the same
concentration. 200μg of protein cell lysate from each sample was analysed as described
previously (Materials and Methods, see 2.15). Image J and Graph prism 6 software were
used for data analysis. Negative (PBS) and positive (reference spots) controls were
tested for accuracy.
The expression of 38 different types of protein biomarkers for kidney injury was
examined. Our results divided and presented the quantification expression level of these
proteins depending on several categories (figure 7.13).
Four low molecular weight proteins will be presented. First, 𝛽2-microglobin (𝛽2M) is
11kDa and Cystatin C is 13kDa proteins. 𝛽2M expresses regularly on the cell surface of
all nucleated cells. Both protein are filtered by the glomerulus and reabsorbed by
PTECs without secretion (Pacific Biomarker, 2012). It reported that Cystatin C is a
sensitive marker of renal injury in patients with MM (Chae et al., 2015). The secretion
of both proteins in urine used as a marker for renal function specifically reflects the
tubular dysfunction (Vaidya et al., 2008).
As shown in figure (7.13 (A)) 𝛽2M was increased after stimulation in HK2-GF cells
compared with the control. Though, 𝛽2M is used as a housekeeping protein, in renal
injury 𝛽 2M has been described as a marker of proximal tubular damage (Pacific
Biomarker, 2012).
256
Similarly, stimulated HK2-GF with 𝜆-LC and FAF-HSA elevated 𝛽2M production at
the same level. In contrast, HK2-GF cells showed a higher increase in Cystatin C with
𝜆-LC stimulation compared to FAF-HSA (figure 7.13 (A)). The mechanism of this
increase is unknown, especially as Cystatin C is thought to be independent of
inflammation (Coll et al., 2000) and there is a slight increase after albumin stimulation.
Lipocalin-2 or neutrophil gelatinase-associated lipocalin (NGAL) protein is one of the
earliest markers for PTECs injury (Pacific Biomarker, 2012) and the most robustly
expressed protein in the kidney after nephrotoxic injury (Chae et al., 2015). In a normal
kidney, NGAL expression is found only in distal tubules and collecting ducts, however,
in the case of kidney injury NGAL protein was also stained in proximal tubule cells
(Geus et al., 2012). For example, one study demonstrated that NGAL was up-regulated
in the first few hours in mouse model after ischemic renal injury. In addition, NGAL
was up-regulated in the kidneys of mice 3h after cisplatin (20 mg/kg), which induced
renal injury and has been proposed as an early biomarker for diagnosing acute kidney
injury (Vaidya et al., 2008). NGAL was raised in HK2-GF cells after stimulating with
FAF-HSA and 𝜆 -LC, however, HK2-GF with (1mg/ml), 𝜆 -LC led to a greater
expression (figure 7.13 (A)).
Fatty acid-binding proteins (FABPs) are small proteins with (15kDa) molecular weight.
Two types of FABP were identified in the human kidney: liver-type FABP (L-FABP) or
(FABP1) and heart-type FABP (H-FABP). L-FABP expresses in PTECs and appears to
be a sensitive biomarker for renal injury (Pelsers, 2008). Stimulated HK2-GF cells with
FAF-HSA and 𝜆-LC showed that FABP expression was significantly reduced compared
to the control sample (figure 7.13 (A)).
Then, the up-regulated proteins. Kidney injury molecule-1 (KIM-1) is a promising and
sensitive marker for proximal tubule injury. It is the best-characterised urinary
biomarkers in animals and human models with renal disease (Lock, 2010). In addition,
it is undetectable in a normal kidney but induced in proximal tubules after toxic injury
like proteinuria (van Timmeren et al., 2006).
257
As demonstrated in (figure 7.13 (A)) KIM-1 expression was raised after treating HK2-
GF with FAF-HSA and 𝜆-LC; the higher production appeared with (1mg/ml) 𝜆-LC.
Similarly, clusterin is associated with tubular kidney injury (Khan & Pandey, 2014) and
was increased after treating the HK2-GF cells with both proteins to the same extent.
Cysteine-rich protein (Cyr61) is normally induced in proximal straight tubules of
kidney and raised in kidney injury (Vaidya et al., 2008). It was elevated after treating
HK2-GF with both proteins; also Cyr61 was elevated more with (1mg/ml) 𝜆-LC (figure
7.13 (A)).
Epithelium growth factor (EGF) produced from PTECs with massive proteinuria
(Rodriguez-Iturbe et al., 2005), and HK2-GF increased the EGF expression slightly
after exposure to overload FAF-HSA or 𝜆-LC (figure 7.13 (A)).
Vascular cell adhesion molecule-1 (VCAM-1) plays an important role in the
inflammatory process (Baek et al., 2010). FAF-HSA had no effects on VCAM-1
expression from HK2-GF compared to the control; however, stimulating HK2-GF cells
with (1 and 5 mg/ml) 𝜆-LC showed a significant increase compared to the control
(figure 7.13 (A)).
Matrix metallopeptidase 9 (MMP-9) is an enzyme that has been implicated as an early
predictive kidney biomarker of tubular epithelial cells injury (Dimas et al., 2013). The
FAF-HSA had no effects on the MMP-9 production from HK2-GF cells after
stimulation, compared to stimulated HK2-GF with both concentrations of 𝜆-LC that
showed significant increase in the MMP-9 production (figure 7.13 (A)). Additionally,
the accumulation of MMP-9 in epithelial cells was controlled by the stimulation of
TGF-β and thrombin promotes the expression of thrombospondin-1 (TSP-1) (Diams et
al., 2013). It has been reported that in diabetes, TGF-β is a key mediator of the cellular
processes that induce renal disease, including renal tubular injury leading to proteinuria.
In addition, TSP-1 is a significant regulator of TGF-β activation and important for the
development of tubular damage (Lu et al., 2011). TSP-1 (THB1) is a glycoprotein that
mediates cell-to-cell interactions. TSP-1 was clearly elevated after treating the HK2-GF
with (1 and 5 mg/ml) 𝜆-LC. On the other hand, the FAF-HSA (5mg/ml) had no effect
on TSP-1 (figure 7.13 (A)).
258
Furthermore, kidney injury as explained previously can be the result of inflammatory
pathogenesis. PTECs produce pro-inflammatory mediators as early biomarkers of
kidney injury such as cytokines and chemokines.
IL-6 expression was elevated after stimulating the HK2-GF; cells stimulated with 𝜆-LC
(1 and 5 mg/ml) produced the higher IL-6 level comparing with FAF-HSA stimulated
cells (figure 7.13 (A)).
Additionally, TNF-𝛼 mediator of inflammatory tissue damage and TNF-RI showed an
increase when treating HK2-GF cells with (5mg/ml) FAF-HSA and 𝜆-LC, but showed a
highly significant increase with (1mg/ml) 𝜆-LC. Similarly, tumor necrosis factor-like
weak inducer of apoptosis (TWEAK) is a member of the TNF superfamily. It is a
multifunctional cytokine in kidney injury involved in cell proliferation, cell death, cell
differentiation, tissue regeneration and inflammation. In addition, it is constitutively
expressed in human and murine renal tubular cells in low level, and it can be up
regulated in tissues damaged by acute kidney injury and inflammatory disease and
proteinuria (Sanz et al., 2011). Figure (7.13 (B)) demonstrated the elevation of TWEAK
level after treating HK2-GF with FAF-HSA, but it increased more with 𝜆 -LC
incubation.
Next, FAF-HSA had no effect on MCP-1 chemokine production from HK2-GF cells
after treating. In contrast, the 𝜆-LC had a clear significant effect by increasing the MCP-
1 production compared to the control (figure 7.13 (B)).
CXCL16 is a chemokine that has a role in several different models of renal injury
causing renal inflammation, fibrosis and renal failure when elevated in kidney tubular
epithelial cells (Norlander et al., 2013). Nonetheless, treating HK2-GF cells with both
(5mg/ml) FAF-HSA and 𝜆-LC did not lead to a raise in the CXCL16 level compared to
a slight increase with (1mg/ml) 𝜆-LC (figure 7.13 (B)). In addition, it found that the
chemokine CXCL16 is induced by angiotensin (Norlander et al., 2013), and by
measuring the angiotensin after stimulating the cells with both proteins; they also had
no effect on angiotensin production (figure 7.13 (A)).
Anti-inflammatory cytokines counterbalance the pro-inflammatory cytokine.
Interleukin-10 (IL-10) is an effective anti-inflammatory cytokine that inhibits
inflammatory and cytotoxic pathways to protect the kidney from injury (Akcay et al.,
259
2009). IL-10 effect was tested in ischemia (acute renal injury) mouse model and it was
found that a single injection of IL-10 inhibited renal damage in general (Deng et al.,
2001). As displayed in figure (7.13 (B)) the IL-10 production from HK2-GF cells after
exposure to FAF-HSA and 𝜆-LC was noticeably very weak.
260
control
1m/ml LC
5mg/ml LC
5mg/ml HSA-FFA
Control
𝜆-LC (1mg/ml)
𝜆-LC (5mg/ml)
FAF-HSA (5mg/ml)
No
rmal
ised
den
sito
met
ry d
ensi
ty
b2
M
Cyst
ati
n C
NG
AL
FA
BP
1
KIM
-1
clu
steri
n
Cy
r61
EG
F
EG
F-R
VC
AM
-1
MM
P-9
TS
P-1
TF
F3
Angio
ten
-0.2
0.0
0.2
0.4
0.6
0.8
1.0
LMWP up-regulated proteins
261
Norm
alis
ed d
ensi
tom
etry
den
sity
IL6
TN
F-α
TN
F-R
I
TW
EA
K
MC
P-1
CX
CL
16
IL10
-0.2
0.0
0.2
0.4
0.6
0.8
1.0
Cytokines Chemokine's Anti-inflammatory
control
1m/ml LC
5mg/ml LC
5mg/ml HSA-FFA
Control
𝜆-LC (1mg/ml)
𝜆-LC (5mg/ml)
FAF-HSA (5mg/ml)
262
Figure (7.13): The human kidney biomarker array detects multiple analyses cell culture lysates samples. HK2-GF cells were sub-cultured
overnight and stimulated with FAF-HSA (5mg/ml) and 𝜆-LC (1 and 5 mg/ml) for 72h. Protein lysates were prepared and (200𝜇g) from
each sample was run on each array. The data was analysed by Image J soft wear. (A and B) Show the different biomarker behavior in this
project module (protein overload) as a cause of kidney injury. Un-treated cells were used as the control. The biomarkers were divided
depending on the type, such as pro-inflammatory cytokines. LMWP: low molecular weight proteins.
263
One of the highly induced proteins in the proteomic profile assay is trefoil factor 3
(TFF3). TFF3 is a small peptide ~7kDa, produced by epithelial cells. It plays a role in
epithelial regeneration and wound healing, inhibiting apoptosis and promoting survival
(Yu et al., 2010). Also, it is important for mucosal protection, cell proliferation and cell
migration in vivo and in vitro.
At the same time, the serum and urinary level of TFF3 is associated with kidney injury
due to its providing a sign for ongoing inflammation processes (Du et al., 2013). In
addition, possible triggers of the release of TFF3 may include damage or inflammation
(Astor et al., 2011). Interestingly, the human kidney biomarker array kit, which was
used to test different kidney injury biomarkers, found that there was an abundance of
TFF3 in lysates from HK2-GF cells exposed to (1 and 5 mg/ml) 𝜆-LC, however, FAF-
HSA had no effect compared to the control un-stimulated sample at 72h incubation
period (figure 7.13 (A)).
For more investigation and to prove the biomarker array results, TFF3 production was
measured in HK2-GF lysates stimulated with 𝜆 -LC (1 and 5mg/ml) or FAF-HSA
(5mg/ml) by Western blot (data not shown) (Done by Dr. Zina Zwaini). The
densitometric analysis of Western blot results showed similar results to kidney
biomarker array results (figure 7.13 (A)). 𝜆-LC (1mg/ml) showed the highest TFF3
production compared to less production with 𝜆-LC (5mg/ml) and no effect with FAF-
HSA (5mg/ml). The level of TFF3 from the stimulated sample with FAF-HSA and un-
stimulated cells (control) are comparable (figure 7.14)
In addition, to detect the effect of both proteins on TFF3 secretion from HK2 (+/-GF)
cells and to examine if the EGF cocktail had any effect on producing TFF3 from HK2-
GF cells with 𝜆-LC stimulation. The supernatants were collected from HK2 (+/-GF)
cells stimulated with FAF-HSA and 𝜆-LC (5mg/ml) for 24 and 72h quantitatively by
ELIZA (Done by Dr. Zina Zwaini). Also, our results correspond to proteomic array
results (figure 7.13 (A)). FAF-HSA had no effect on TFF3 production from HK2 (+/-
GF) cells at both time points. However, 𝜆-LC showed a significant increase in TFF3
secretion from HK2 (+/-GF) cells at both time points, but higher at 24h compared with
264
the 72h (figure 7.15). Taken together, 𝜆-LC initiates more restitution in HK2 (+/-GF)
cells than FAF-HSA.
In summary, several earlier biomarkers for the recognition of cell damage that can be a
sign or cause of kidney injury have been investigated. Using these biomarkers in the
protein overload model showed the difference between the effects of two proteins on the
proximal tubule cells. Interestingly, by comparing the effect of 𝜆-LC and FAF-HSA on
the HK2-GF cells, the (1mg/ml) 𝜆-LC led to the highest increase of 14/38 proteins
compared to (5mg/ml) 𝜆-LC and FAF-HSA. Moreover, FAF-HSA had no change or
decrease in 6/14 markers compared with 𝜆-LC in both concentrations. These results
may support the observation that 𝜆-LC has more damaging effects on PTECs. Figure
(7.16) showed the summary of different effects of each protein with specific
concentrations on several biomarkers.
Figure (7.14): Densitometric intensity for Western blot semi-quantitative analysis
of TFF3 production from stimulated HK2-GF cell lysates; cells stimulated with
FAF-HSA (5mg/ml) or 𝜆 -LC (1 or 5 mg/ml) for 72h. TFF3 was increased
significantly after treating HK2-GF cells with 𝜆-LC compared with no changes
with FAF-HSA stimulation. Normalised density of TTF3 (7kDa) to loading
control (𝛽-actin).
Contr
ol
1m
g/m
l λ-L
C
5m
g/m
l λ-L
C
5m
g/m
l F
AF
-HS
A
0.00
0.05
0.10
0.15
0.20
Den
sito
mer
ty In
tensi
ty
265
Figure (7.15): The effects of 𝜆-LC and FAF-HSA on TFF3 production by HK2 cells
(+/-GF). Cells were sub cultured in 6 well plates (5 x 105 cells/well) overnight, and
incubated with (5mg/ml) 𝜆-LC or FAF-HSA for 24 and 72h. The supernatants were
collected and TFF3 production was measured (ELISA), un-treated cells were used
as the control. Stimulated HK2 (+/-GF) cells with 𝜆-LC was elevated significantly
in the TFF3 secretion, whereas TFF3 was undetected in HK2 (+/-GF) cells
stimulated with FAF-HSA at both time points compared to control samples. The
data are represented as means duplicate ± SD (n = 2).
C2
4h
24h
C7
2h
72h
C2
4h
24h
C7
2h
72h
C2
4h
24h
C7
2h
72h
C2
4h
24h
C7
2h
72h-1000
0
1000
2000
3000
4000
5000
pg/m
l
GF GFHK2 HK2
l-LC FAF-HSA
266
Markers 𝝀-LC (1mg/ml) 𝝀-LC (5mg/ml) FAF-HSA (5mg/ml)
Cystatin C
NGAL
KIM-1
Cyr61
VCAM-1
MMP9
TSP-1
TFF3
IL-6
TNF-𝜶
TNF-RI
TWEAK
MCP-1
CXCL16
Figure (7.16): Compilation of proteins detected by proteome profile human kidney array, which are differentially influenced by
𝜆-LC and FAF-HSA.
Highest increase Lower increase Lowest increase No change
267
7.3 Discussion:
Overloading protein on PTCs induces pro-inflammatory and inflammatory cytokines,
which may have a direct or indirect role in kidney injury (Sengul et al., 2002). In our
project, the effect of (5mg/ml) FAF-HSA and 𝜆-LC on HK2 (+/-GF) cells for 24 and
72h on IL-6, IL-8 and MCP-1 was examined by measuring the mRNA gene expression
and protein production levels in supernatants.
Starting with IL-6, one study showed that stimulated HK2 cells, which were grown in a
medium supplemented with EGF, with a range of FAF-HSA (0.5 up to 5mg/ml) for 8h
had no effect on the IL-6 release (Newman et al., 2000). Similarly, another study
stimulated primary human PTCs with a higher range of HSA (with fatty acid) (3.5 up to
35 mg/ml) for 6h and showed no effect on IL-6 secretion with any of these
concentrations (Sengul et al., 2002). In contrast, our results illustrated that IL-6
production from HK2 (+/-GF) cells elevated at 24 and 72h with FAF-HSA. So, the time
of incubation with albumin could be the reason for not detecting IL-6 before 24h. In
addition, our results displayed a significant increase in IL-6 mRNA expression from
HK2 (+/-GF) cells in the initial 24h but the abundance was notably decreased
at 72h with FAF-HSA. The decrease or lack of increase of IL-6 mRNA expression at
72h could be due to IL-6 produced as a protein in the supernatants of treated cells
because the highest IL-6 secretion at 72h.
The HK2 (+/-GF) cells behaved similarly with 𝜆-LC stimulation compared to FAF-
HSA; IL-6 secretion from HK2 (+/-GF) cells was raised at 24h and persisted through
72h. Our results agreed with Sengul et al. (2002) who showed that (1.5, 3 or 10mg/ml)
of 𝜅 -LC, which was purified from the urine of MM patient, promoted the IL-6
production from human PTCs at 24h. Also, 𝜆-LC elevated the mRNA gene expression
of IL-6 in HK2 (+/-GF) at 24h but the maximum increase was at 72h. By comparing the
mRNA and protein levels for HK2 (+/-GF) cells, HK2 cells showed higher IL-6
secretions than HK2-GF. In addition, the IL-6 mRNA expression decreased at 72h with
FAF-HSA from both HK2 (+/-GF) cells, but with 𝜆-LC the expression was still elevated
compared with 24h, this elevation might cause cell inflammation.
The effect of FAF-HSA on IL-8 showed that FAF-HSA had no effect on IL-8 secretion
with HK2 (+/-GF) cells but the level of IL-8 was significantly raised at 72h with HK2
268
cells. This is consistent with findings in Sengul et al. (2002) who showed that the range
of HSA (with fatty acid) (3.5 up to 35mg/ml) had no effect on IL-8 production from
human PTCs at 6 and 24h stimulation time. With regard to IL-8 mRNA expression,
Tang et al. (2003) presented that IL-8 gene expression in human PTECs was increased
significantly at 3h and then reduced progressively to undetectable levels at 12 and 24h
with (5mg/ml) HSA (with fatty acid). Our results showed a similar response, where the
IL-8 mRNA did not change from HK2 cells stimulated with FAF-HSA for 24h but after
72h a significant increase was detected, and this was comparable with the protein IL-8
secretion results that showed high IL-8 secretion at 72h. On the other hand, stimulated
HK2-GF cells with FAF-HSA led to elevated IL-8 mRNA expression at 24 and 72h,
but, surprisingly, no change in the protein level at both time points. The reason for the
lack of a difference between FAF-HSA stimulated HK2-GF and control cells in IL-8
release is unclear, given the increase in mRNA measured for both time points.
Stimulating HK2 (+/-GF) cells with 𝜆-LC showed augmentation in IL-8 secretion at
24h, but at 72h the production was reduced significantly. Likewise, Sengul et al, (2002)
showed significant elevation in IL-8 production from human PTCs after treatment with
(1.5 and 3mg/ml) 𝜅-LC, purified from the urine of the MM patient at 6 and 24h. IL-8
mRNA expression followed a time-dependent manner; the expression was up regulated
at 24h and reached a maximum at 72h in HK2 (+/-GF) cells. HK2 cells expressed IL-8
more than HK2-GF at 72h. Comparing the IL-8 expression and secretion, at 24h the
HK2 (+/-GF) cells increased the expression and the production of IL-8 significantly.
Nonetheless, at 72h the IL-8 transcription was still increasing, but the protein translation
was significantly decreased. The reason for the significant decrease of IL-8 production
at 72h in spite of the elevation of mRNA levels at the same stimulation time could be
that IL-8 production peaked at 24h. Alternatively, 𝜆-LC may increase expression of
peptidase like anti-peptidase N that degrades and inactivates IL-8 (Kanayama et al.,
1995). Then IL-8 would be antigenically undetectable by ELISA.
Lastly, MCP-1, FAF-HSA had no significant effects on MCP-1 secretion from HK2 (+/-
GF) cells at both time points but at 72h the production was elevated markedly with HK2
cells. Our findings agreed with Sengul and his group in 2002, they determined the
MCP-1 production from human PTCs that stimulated with range of HSA (with fatty
acid) (3.5 up to 35 mg/ml) for 6 and 24h. Their results showed no significant effects on
269
MCP-1 production with all HSA concentrations at both time points. However, a
different study showed opposite results. They found that the release of MCP-1 from rat
PTCs increased only with relatively high concentrations of (10-30mg/ml) BSA
(delipidated) at 8h (Newman et al., 2000), so, this could explain the reason of no change
in the MCP-1 level in our protein overload conditions. First could be the low
concentration of FAF-HSA (5mg/ml) or the long-time of stimulation; MCP-1 might be
secreted earlier than 24h and then decreased. In addition, the late MCP-1 production at
72h from HK2 cells may be the cause of inflammation and the EGF cocktail protects
HK2-GF cells from that. The MCP-1 mRNA expression showed no change from HK2
(+/-GF) cells, however, HK2 showed elevation at 72h. Previous study demonstrated that
rat PTCs induced the MCP-1 mRNA expression strongly after 8h of exposure to a range
of (delipidated) BSA (1-30mg/ml) by PCR. In addition, they stimulated the PTCs to
(15mg/ml) (delipidated) BSA for (2, 4, 8 and 24h) and found the MCP-1 mRNA
expression increased with time but reached its peak at 4h and persisted for 24h (Wang
et al., 1997). On the one hand, by comparing our results with Wang et al. (1997), we
can conclude that stimulating HK2 (+/-GF) cells with (5mg/ml) FAF-HSA showed no
increase in MCP-1 mRNA expression and this might be due to the long-time of
stimulation with low albumin concentration. On the other hand, may be because the
protective effects of the EGF cocktail in the HK-GF cells medium. Also, the low FAF-
HSA concentration in our study might need a longer time to induce MCP-1 from HK2
as an inflammatory response at 72h.
HK2 (+/-GF) behaved similarly with 𝜆-LC stimulation. There was a slight increase in
MCP-1 secretion at 24h, but at 72h production was elevated strongly, especially from
HK2 cells. Wang et al. (2007) in a study stimulating HK2 cells overnight with six
different LC (three k and three 𝜆), purified from different urines of MM patients with
LC proteinuria, showed a mixed response with (1mg/ml) of LCs on MCP-1 secretion
from HK2 cells. Because of a mixed effect of different LCs purified from distinct
patients, it was concluded that the type of the LC purified from the donor plays a central
role in the toxicity effects that lead to induce MCP-1. On the other hand, the MCP-1
promoted at 72h in our study could be due to our 𝜆-LC with (5gm/ml) concentration
need a longer time to induce MCP-1 production from our HK2 (+/-GF) cells.
270
The mRNA expression was increased from HK2 (+/-GF) cells stimulated with 𝜆-LC at
both time points. By comparing the MCP-1 protein production and mRNA expression,
MCP-1 mRNA expression did not increase in HK2-GF cells, maybe because in the
translations of mRNA to protein in the supernatants, a high number of cells were
already detached from flask and became apoptotic or necrotic cells. Or, the effects of
the EGF cocktail, which also could explain the significant increase in MCP-1 mRNA
and production at 72h from HK2 cells. In addition, HK2 cells showed the highest MCP-
1 production and mRNA expression at 72h with 𝜆 -LC may play the role in cell
inflammation that leads to cells damage.
In brief, our observation is that both FAF-HSA and 𝜆 -LC are likely to mediate
cytokines responses and may lead to cell inflammation or to be responsible for
progression of cell injury in proteinuric condition.
Previously, it was shown that HK2 cells express mRNA for all AP major components
(C3, FH, FB and FP) (Peake et al., 1999). Our stimulated HK2 cells with FAF-HSA
showed increase in C3 mRNA and protein levels at 24 and 72h. However, HK2-GF
cells showed different results; the C3 expression elevated significantly at 24h and
reduced at 72h. In contrast, the protein production of C3 was increased strongly at 24
and 72h at the same level. If greater C3 release in detrimental, then cells grown in the
EGF cocktail are in a protective environment. The C3 component might have additional
and independent pro-inflammatory action in the proteinuric condition, which is
independent of the C5b-9 location (Zoja et al., 2003). The in vitro study stimulating
human PTCs with (5mg/ml) serum protein led to an increase in the C3 gene expression
significantly in a time-dependent manner (Tang et al., 1999), so, increasing the C3 in
PTCs may induce pro-inflammatory cytokines and lead to cell inflammation in the
proteinuric condition. In addition, it was reported that the activation of AP on the PTCs
cells’ surface was followed by synthesis of pro-inflammatory cytokines such as IL-6
and TNF-α (Zoja et al., 2003). From that we can perhaps explain the high significant
increase in C3 expression and production from HK2 cells at 72h with FAF-HSA having
a role in inducing the late IL-6, IL-8 and MCP-1 significant secretions; in addition, the
mRNA level for both TNF-α and TGF-β also increased at the same time. All of that
could lead to inflammation and cell damage.
271
In contrast, the reduction of C3 expression and no change in protein level at 72h for
HK2-GF cells stimulated with FAF-HSA might explain the lack of increase in IL-6
secretion and on IL-8 and MCP-1 at 72h, and this might be the protective effect of the
EGF cocktail (Thurman & Renner, 2011). A previous study using biopsy material
demonstrated that IgA nephropathy patients with proteinuria showed elevation in C3
mRNA expression in tubular epithelial cells. The local overproduction of C3 by renal
tubules might contribute to tubular injury (Zhou et al., 2001). Our results displayed
significant up-regulation in C3 gene expression from both cells stimulated with 𝜆-LC at
both time points. Correspondingly, the C3 protein production for both HK2 (+/-GF)
cells was elevated significantly at 24h, however, although the C3 gene expression at
72h was still high, the protein production of C3 was reduced. This may be due to the
huge number of cells that were floating and detached from the plate surface and became
apoptotic or necrotic cells; C3 production was measured in the remaining attached cells.
At 72h, stimulated HK2 (+/-GF) cells with 𝜆-LC showed a significant increase in IL-6
and MCP-1 secretion. Additionally, the mRNA level for TNF-α and TGF-β also
increased at the same time. All that may contribute to inflammation and cell damage.
FB mRNA was detected in tubules of normal human kidney (weak detection) (Zhou et
al., 2001). Our results showed that FB expression from HK2 (+/-GF) cells was detected,
and increased from both cells after FAF-HSA stimulation for 24h, but at 72h the
expression was returned to the normal level. In the same way, HK2 (+/-GF) cells
showed elevation in FB protein production at 24h and reduction at 72h. The 𝜆-LC
effects on FB mRNA expression displayed no change in FB at 24h from stimulated
HK2 (+/-GF) cells; however, HK2-GF cells significantly decreased and HK2 increased
FB expression at 72h. The protein production of FB was increased at 24 and 72h from
HK2 (+/-GF) cells.
Gaarkeuken et al. (2008) showed that in three patients with proteinuric kidney disease,
FP was detected on the tubular brush border, whereas it was absent in the tubular of
healthy kidneys. Exposure of HK2 (+/-GF) cells to FAF-HSA had no effect on FP
expression at both time points, except the strong increase at 72h from HK2-GF.
However, the expression from HK2 (+/-GF) cells was significantly elevated after 𝜆-LC
stimulation. On the one hand, FH mRNA expression was increased after stimulating
HK2 (+/-GF) cells with FAF-HSA at 24h, whereas at 72h the expression was decreased
form HK2-GF but still at the same level from HK2 cells compared with the 24h
272
samples. On the other hand, the 𝜆-LC stimulation enhanced the FH expression from
HK2 (+/-GF) cells at 24h and persisted through 72h.
In brief, our protein overload conditions showed the effect on complement AP
components in transcription and translation in proximal tubular epithelial cells that
could have a role in cell damage and kidney injury. There are several explanations:
possibly, that the continuous C3 expression from cells after both protein stimulation; the
increase in mRNA level of FP from HK2 (+/-GF) cells at 24 and 72h after 𝜆-LC
stimulation compared to no effect on FP levels after FAF-HSA could support the idea of
a 𝜆-LC toxicity effect is more than FAF-HSA, which may lead to over-activation of AP
complement system that might contribute to cell damage; the lack of FH expression
from cells after 𝜆-LC stimulation at both time points may be lead to an inability to
control activation of the pathway. A standard rabbit red blood cells lysis test was
performed in an attempt to quantify AP activity (appendix V). This absence of
detectable AP activity in cell culture supernatants collected from stimulated HK2 (+/-
GF) cells were stimulated with FAF-HSA or 𝜆 -LC (5mg/ml) for 24 and 72h
demonstrated that no hemolytically active MAC was generated in the cell culture
supernatants.
It was reported that LC protein is capable of generating H2O2 (Wang & Sanders, 2007).
Our data from the series of experiments showed that stimulated HK2 (+/-GF) cells with
FAF-HSA and 𝜆-LC for several time points led to an increase the H2O2 intra and
extracellularly. Morigi et al. (2002) showed that in a time course of stimulation of HK2
cells, which were supplemented with EGF in their growth medium, HSA (with fatty
acid) and IgG (30mg/ml) increased H2O2 production threefold over the control, and this
increase extended to 60min of incubation. However, our HK2-GF showed maximum
H2O2 cell production at 10min with both stimulations and this elevation decreased with
longer times of incubation; also, the H2O2 released in supernatants increased
significantly with both proteins, however, at 360min the production returned to the
normal level compared to the control with FAF-HSA stimulation. In contrast, with 𝜆-
LC the amount of H2O2 remained high. This could be due to the higher concentrations
of HSA (30mg/ml), and the fatty acid in HSA may have an extra effect on H2O2
generation in the Morigi et al. (2002) study. In addition, they used IgG to stimulate the
cells, which means heavy and light chains together, but in our study we utilized purified
273
𝜆 -LC, so IgG may have a more toxic effect to keep the cells producing H2O2.
Furthermore, a high concentration of IgG was used (30mg/ml). All these reasons may
affect the H2O2 production. To prove this concept, Morigi et al. (2002) showed the
effect of increasing concentration of both HSA and IgG (1, 10 and 30mg/ml) H2O2
production for 5min of incubation from HK2 cells. They found that the amount of H2O2
released in the supernatants or produced in cells was dose-dependent.
On the other hand, HK2 cells showed the maximum H2O2 cell production at 60min and
20min with FAF-HSA and 𝜆-LC, respectively, but the production remained high up to
360min of incubation. Likewise, H2O2 released in supernatants from stimulated HK2
cells with FAF-HSA and 𝜆-LC displayed that H2O2 increased more with 𝜆-LC and the
elevation remained to 360min, however, with FAF-HSA the production was increased
significantly at 60min and reduced to the same control level at 360min of incubation.
Noticeably, the amount of H2O2 generated from HK2 (+/-GF) stimulated cells with 𝜆-
LC was higher than the amount after FAF-HSA stimulation and the generation
remained high with the longest time of incubation (360min); this is may reflect the more
toxic effect of 𝜆-LC than FAF-HSA. Also, the H2O2 generated from stimulated HK2-GF
quicker than HK2 cells but it decreased with long-term stimulation with HK2-GF and
remained high from HK2 cells. The explanation of that might be that the effect of the
EGF cocktail has a role in preventing higher H2O2 production.
Previous study demonstrated an increase in H2O2 released in culture supernatant of HK2
cells stimulated with (1 mg/ml) (λ and κ) LC for 24h; the cells were grown in a
medium supplemented with EGF (Basnayake et al., 2011). Also, another study showed
that stimulated HK2 cells with six human LC (5mg/ml) for 24h, which was purified
from different urines of MM patients with LC proteinuria, resulted in the generation of
H2O2 in the medium to different extents (Wang & Sanders, 2007). Our data results
partly agree with Basnayake et al. (2011) and Wang & Sanders (2007), in that exposure
HK2-GF cells with (5mg/ml) 𝜆-LC showed increase in H2O2 production in the medium
at 24h; in contrast, HK2 cells showed reduction at 24h. On the other hand, HK2 (+/-GF)
cells stimulated with FAF-HSA showed decreased H2O2 production in the medium at
24h. Wang & Sanders (2007) results support our findings. They found that exposure of
HK2 cells with (15 mg/ml) HSA (with fatty acid) for 24h had no effect on H2O2
production in the medium. Lastly, 𝜆-LC in the medium was decreased when HK2 (+/-
274
GF) cells were incubated with both FAF-HSA and 𝜆 -LC for 72h. Thus, it can be
concluded that both proteins with the same concentration are capable of producing
H2O2from HK2 (+/-GF) cells, but to a different extent.
Several accessible and promising markers for kidney cell injury were measured in
lysates of HK2-GF cells, which were sub cultured in 6 well plates and stimulated with
FAF-HSA (5mg/ml) and 𝜆-LC (1 and 5mg/ml) for 72h using a Proteome Profiler Array
kit. The detected biomarkers will be discussed in categories (figure 7.17).
In vivo study, increased urinary 𝛽2M excretion has been reported as an early sign of
tubular injury such as in patients with nephrotoxicant exposure and renal transplantation
(Vaidya et al., 2008). One vivo study showed that the rate of urinary Cystatin C
excretion is augmented in the proteinuria/albuminuria rat model (Nejat et al., 2012).
Also, Kim and his group in 2014 showed that MM patients with kidney injury
complications showed an increase in total excretion of urinary Cystatin C. All previous
vitro and vivo studies were measured by the urinary secretion of 𝛽2M and Cystatin C
and used as markers for tubular injury. Differently, in our vitro study both markers were
measured as protein production from the HK2 (+/-GF) cells after protein overload
stimulation as a cause of cell injury. FAF-HSA and 𝜆-LC showed increase in 𝛽2M
production by the same level, which could be a sign of cell injury. However, Cystatin C
significantly increased with 𝜆-LC fourfold more than FAF-HSA in HK2-GF cells. So,
the increasing of Cystatin C production from HK2-GF cells also can be used as a good
marker for cell injury.
The relationship between Lipocalin-2 (NGAL) level and renal function in patients with
MM was examined in 199 patients and showed a strong correlation between the level of
NGAL in plasma and the degree of renal injury. A correlation was found between the
NGAL and Cystatin C plasma levels (Chae et al., 2015). Additionally, measuring
urinary NGAL levels might require a 24h urine collection sample; because of that the
use of urinary NGAL as a quantitative marker is limited. In another study, NGAL
plasma and urinary levels were evaluated in 48 patients with newly diagnosed MM.
They showed elevation in NGAL plasma and urinary levels and reported to be an
indicator for early renal tubular damage (Chae et al., 2015). By comparing our vitro
results, NGAL showed a similar result to Cystatin C; it highly increased after 𝜆-LC
stimulation compared to slight elevation with FAF-HSA in HK2-GF cells.
275
Similarly, FABP1 appears to be an attractive biomarker for a number of renal diseases
like chronic kidney disease and IgA nephropathy, but additional studies are needed to
determine the utility of FABP1 especially in the setting of ischemia/reperfusion injury
and nephrotoxin exposure (Vaidya et al., 2008). Our study in vitro results showed no
effect or decrease in FABP1 levels with both overload proteins. In contrast, in our lab
FABP1 level was measured from HK2 in vitro ischemia/reperfusion model for 6 and
24h. The results showed a great increase in the FABP1 level compared to control cells
(Zwaini, 2016). Zwaini’s (2016) result agreed with de Geus et al. (2012), who reported
that the urinary FABP1 was undetectable in the healthy control urine but in ischaemic
conditions, tubular FABP1 gene expression was induced.
These four LMW proteins are reabsorbed in proximal tubules by megalin-mediated
endocytosis and proximal tubular injury reduces that reabsorption, so production and
secretion of these proteins in urine will increase. Also, filtered albumin reabsorbs by the
same process; the competition for receptor-mediated transport between albumin and
LMW proteins could be the reason for elevation of the proteins in the proteinuria
condition. The same reasoning applies for LC, which is another ligand of megalin
receptor.
van Timmeren et al. (2006) measured mRNA, protein, and urinary KIM-1 levels in a
protein overload rat model with renal damage. They found that the mRNA by RT-PCR
and protein production levels by Western blot were up-regulated in the kidney of a
proteinuric rat compared with the control rat kidney; also, a low level of urinary KIM-1
protein was found compared with significant high secretion in the proteinuric model.
Another study also showed up-regulation in the KIM-1 gene and protein products in
animal models with acute kidney injury chemically by cisplatin (Lock, 2010).
Furthermore, kidney biopsies from 102 patients with a variety of kidney diseases were
collected and KIM-1 protein stained in tissue specimens. They showed a positive KIM-
1 staining in PTCs correlated with tubulointerstitial fibrosis and inflammation. At the
same time, the urinary KIM-1 level was measured and they found a correlation between
the KIM-1urinary level and the tissue expression of KIM-1 (Vaidya et al., 2008). Our
results showed an increase in protein levels from stimulated cells compared with the
control sample. Thus, KIM-1 appears to play a role in the pathogenesis of tubular cell
damage in kidney disease.
276
Next, clusterin is expressed in damaged tubular cells (Adiyanti & Loho, 2012). In 2008,
Viadya and his group said that in vivo rat cisplatin induced renal injury showed an
increase in clusterin mRNA and protein levels. However, until now, there has been no
clinical study that uses clusterin as an early marker of kidney injury in humans. Our
results showed an increase in the protein level of clusterin in stimulated HK2-GF cells.
Thus, up-regulation of clusterin suggests the occurrence of renal injury and proves to be
a potential biomarker of nephrotoxicity.
Another promising biomarker for early diagnosis kidney injury is Cyr61. It is induced in
the kidney after toxic and ischemia injury in the animal model (Mussap & Merlini,
2014). In rats, Cyr61 is rapidly increased in proximal tubules of the kidney after renal
ischemia and secreted in urine. In an in vitro study, Xu and his group in 2014
investigated the effect of hypoxia on Cyr61, which is a method to induce damage in
cells by incubating HK2 cells for 1 up to 4h in 1% O2. They found that the protein
expression of Cyr61 was increased significantly from hypoxic HK2 cells compared to
the normoxic control cells by Western blot. Also, in our vitro study, the HK2-GF cells
in the protein overload model of the Cyr61 levels were increased after stimulating the
cells with FAF-HSA or 𝜆 -LC. So, Cyr61 appears to be a marker of cell damage
independent of the type of damage.
VCAM-1, an adhesion molecule, and was tested with proteomic profile array. Plasma
VCAM-1 was measured in healthy and diabetic patients with nephropathy. VCAM-1
was elevated in patients with macroalbuminuria compared to normal patients and
patient with microalbuminuria; that means it increased with overt nephropathy (Hojs et
al., 2015 and Clausen et al., 2000). Also, Seron and his group (1991) showed an
increase in VCAM-1 in PTCs in kidney sections from IgA nephropathy patients
compared to very low levels in a section of proximal tubules from normal kidneys. Our
vitro results showed significant elevation in VCAM-1 after 𝜆-LC stimulation, but the
FAF-HSA had no effect on the VCAM-1 abundance.
One study supported our finding; they showed no effect in VCAM-1 mRNA and protein
levels from HK2 cells after being stimulated with (5mg/ml) FAF-HSA for 4h; in
contrast, the (5mg/ml) albumin with fatty acid increased the expression of both VCAM-
1 mRNA and protein at the 4h incubation period (Baek et al., 2010).
277
The fatty acid bound to the albumin may have a role in inducing VCAM-1 from the
cells due to incubating HK2 with albumin free fatty acid for 4h or 72h showed no effect
on VCAM-1 expression.
Afterward, MMP-9 was tested by proteomic profile as one of the kidney injury markers.
The relation between MMP-9 and kidney damage has been the subject of a limited
number of investigations, specifically the role of MMP-9 in PTCs in conditions of renal
injury. MMPs are involved in acute kidney injury and changes in tubular epithelial
cells; this study said that MMP-9 expression was increased in tubules of rat
ischemia/reperfusion model (Dimas et al., 2013). Another study showed an increase in
MMP-9 activity in supernatant in rat proximal tubular cells treated with delipidated
BSA (1mg/ml) for 72h (Liang et al., 2007). In contrast, our results showed that the
FAF-HSA had no effect on MMP-9 production and this might be due to the MMP-9
secreted in the supernatant or the protective effects of the EGF cocktail. Also, Liang et
al. (2007) used BSA as source of albumin with rat proximal tubular cells (different
species). However, the two concentrations of 𝜆-LC showed a significant increase in
MMP-9 production. Thus, 𝜆-LC might have a more injurious effect than albumin in our
conditions that leads to increasing the MMP-9 production.
As TSP-1/THBS 1 controls MMP-9 (Diams et al., 2013) TSP-1 was investigated an
early marker for the development of tubulointerstitial kidney disease (Neuwirt et al.,
2014). Also, it was involved in TGF- 𝛽 pathways that activated in fibrotic kidney
disease in rat. Moreover, it is an important mediator-induced kidney dysfunction in the
obesity mouse model (Neuwirt et al., 2014). Thus, TSP-1 is involved in several kidney
diseases. When studying the effects of our protein overload model on TSP1 production,
the results showed that FAF-HSA had no effect on TSP-1, however, the 𝜆 -LC
stimulation led to a significant increase of TSP-1 abundance. Both proteins had the
same impact on TSP-1 and MMP-9 production after stimulation; the 𝜆 -LC (1 and
5mg/ml) increased TSP-1 and MMP-9 production but FAF-HSA had no effect on both
markers.
After that, pro-inflammatory cytokines and chemokines were examined as markers for
kidney injury. Several experimental and clinical studies propose that IL-6 has a role in
renal injury in different forms of renal disease. For example in vivo, in an acute kidney
injury patient the circulating level of IL-6 highly increased; also, it increased in kidney
278
mRNA levels of nephrotoxin in mouse model induced acute kidney injury (Jones et al.,
2015). The effect of our kidney cell damage (protein overload) in vitro showed an
increase in IL-6 production in response to 𝜆-LC stimulation. By contrast, FAF-HSA had
no effect on IL-6. Regarding the impact of both proteins on IL-6 mRNA and production
levels at 72h on HK2-GF cells that was discussed previously, FAF-HSA led to decrease
in the mRNA and protein production of IL-6, but the IL-6 secretion was increased
significantly in HK2-GF cells at the 72h incubation period. However, the 𝜆-LC showed
a significant increase in mRNA expression, protein production and secretion of IL-6 in
the same cells. This led to conclude that IL-6 simultaneously promotes an injurious
inflammatory response to protect the kidney from further injury (with FAF-HSA
stimulation) or becomes responsible for progression of cell injury in protein overload
conditions (with 𝜆-LC stimulation).
MCP-1 is produced by kidney cells and acts as a mediator of toxic kidney injury (Peres
et al., 2013). An in vivo study of MCP-1 deficient mice showed less tubulointerstitial
damages after development of nephrotoxic, implying a major role for MCP-1 in
tubulointerstitial inflammation. In the kidney, PTCs are the major source of MCP-1. In
proteinuric conditions, MCP-1 production is increased and this relates to the
progression of renal disease (Wang & Sanders, 2007). In vivo, the protein overload
proteinuria model in rats showed MCP-1 protein localised in tubular cells (Wang et al.,
1997). Our vitro study showed a significant increase in MCP-1 protein production from
HK2-GF cells with 𝜆-LC stimulations, but FAF-HSA had no effect. The MCP-1 mRNA
expression and secretion results that were discussed previously showed similar results.
Next, CXCL16, increased CXCL16 serum and urine levels in humans were found in
chronic kidney disease (Norlander et al., 2013). Another study showed that the urinary
CXCL16 level was raised in mice and patients with lupus nephritis, correlating well
with urine protein levels (Wu et al., 2007). Hypertension is one of the causes of
albuminuria and renal failure and involves angiotensin II, which increases CXCL16 in
kidney PTECs (albuminuria renal failure) (Norlander et al., 2013). Thus, from the prior
studies CXCL16 may have a role in several models of renal disease.
279
In our protein overload model, FAF-HSA and 𝜆 -LC had no significant effect on
CXCL16 production in HK2-GF cells and this might be due to the possibility that
production of CXCL16 depends on the stimulation by angiotensin II, which was also
tested and showed no increase in our vitro protein overload model.
IL-10 is an important anti-inflammatory cytokine. It inhibits IL-6, IL-8, TNF-α and
attenuates the expression of TNF-α receptors (Opal & DePalo, 2000). IL-10 was tested
in different renal injury diseases such as cisplatin and ischemia mouse models that
showed necrosis in PTCs. It found that the injection of IL-10 inhibited renal damage.
These findings were confirmed by histologic levels; IL-10 treated kidneys had less
necrosis in proximal tubules in both models (Deng et al., 2001). The effect of protein
overload on HK2-GF cells and IL-10 production in our study showed no significant
change was detected in IL-10 protein levels after stimulation with both proteins. Thus,
this could be one of the reasons for cell damage. In addition, no increase in IL-10
mRNA expression was detected by PCR from HK2 cells stimulated with (5mg/ml)
FAF-HSA for 24 and 72h compared to the control samples (MSc student Panayiota,
Albumin mediated nephrotoxicity- characterisation of an in vitro model, 2013).
TNF-α is an important inflammatory cytokine involved in kidney injury. For example,
diabetic patients with advanced renal failure showed an increase in TNF-α plasma
levels, and the concentrations were significantly correlated with urinary protein
excretion, which means it may have a role in the pathogenesis of proteinuria and renal
damage in these patients. This concept was examined in animals with nephrotoxic
nephritis; the administration of antibodies against TNF-α led to reduced histological
lesions and albuminuria (Navarro et al., 1999). In another vivo study, mice injected with
cisplatin (20 mg/kg) and severe renal failure showed significant up-regulation in TNF-α
mRNA and urine secretion (Ramesh & Reeves, 2002). Also, Nath in 2010 documented
that rats with a systemic infusion of nephrotoxic light chains over 3 days had increased
TNF-α renal production. In this vitro study TNF-α mRNA and protein production were
also increased from stimulated HK2-GF cells with overload FAF-HSA and 𝜆-LC as a
source of cell damage. So, the elevation would result in cell damage in proteinuria and
use as a marker for cell injury.
280
Furthermore, the TNF-RI also showed a significant increase in HK2-GF cells after
stimulation with both proteins. An increase of TNF-RI with a concomitant decrease of
anti-inflammatory IL-10 as we find in this study has been described before (Joyce et al.,
1994).
Then, TWEAK, for example, mice receiving an overdose of folic acid that developed
acute kidney injury showed an increase in TWEAK in kidney tubular cells. In addition,
patients with MM showed an increase in TWEAK levels (Sanz et al., 2011). In our
protein overload conditions on HK2-GF cells, TWEAK production was significantly
increased with FAF-HSA and 𝜆-LC, so it could be a sign of cell injury.
Finally, TFF3, in 2008, the US Food and Drug Administration (FDA) and the European
Medicines Evaluation Agency (EMEA) jointly accepted seven urinary indicators of
acute drug-induced renal tubular toxicity in drug development. TFF3 is one of these
markers. For example, experimental rats with nephrotoxicity showed a high TFF3
urinary level. In the human model, the high level of TFF3 in diabetic and hypertension
patients with risk factors for chronic kidney disease is associated with ongoing kidney
damage (Astor et al., 2011).
As known from previous studies, TFF3 is involved in the repair of injury, presumably to
the tubular epithelium like in chronic kidney disease. The TFF3 higher levels indicated
in urine are indicative of ongoing repair, which in turn means damage or ongoing
inflammatory processes. If this principle is correct, TFF3 can be useful as a marker for
kidney damage. In our vitro work that examined the effect of protein overload as source
of cell damage, TFF3 was one of the most highly induced proteins in proteomic
analyses from HK2-GF cells stimulated with 𝜆-LC; however, FAF-HSA had no effect
on TFF3 protein production. Western blot analysis of cell lysates for the same
condition, which is HK2-GF stimulated with 𝜆-LC (1 and 5 mg/ml) and FAF-HSA
(5mg/ml), validated this observation. 𝜆-LC stimulated cells showed markedly elevated
TFF3 abundance, contrasting with un-treated and human serum albumin stimulated
cells. From these results, we concluded that 𝜆-LC induced TFF3 in proximal tubular
epithelial cells in vitro more than FAF-HSA. In addition, TFF3 in supernatants secretion
showed that a significant increase of TFF3 was detected from 𝜆-LC stimulated cell
supernatant, whereas there was no detection of TFF3 secretion from FAF-HSA
stimulated cells. Taken together, from our cells toxicity conditions by 𝜆-LC that induce
281
TFF3 but FAF-HSA could not we can explain that 𝜆-LC has more toxic effect on cells
than FAF-HSA due to that the high TFF3 level with 𝜆-LC means ongoing repair, which
in turn, the high level of damage or cells injury. Additionally, the high number of
detached debris cells from the surface of experimental plates after stimulation with 𝜆-
LC but not with FAF-HSA at the same stimulation time (72h) with the same
concentration (5mg/ml), can possibly be used to support this idea.
Taken all together, our protein overload conditions and mediated cell damages might
occur by activating many of the several pathways that lead to cell inflammation,
apoptosis/necrosis and fibrosis, depending on the molecules that are involved in the
mechanisms that induced cell injury. From our studies, we conclude that stimulated
HK2-GF cells with FAF-HSA and 𝜆-LC showed different effects on regulating several
biomarkers. 𝜆-LC with (1mg/ml) showed more of an effect on stimulation of the marker
molecules than (5mg/ml) concentration. By comparing the effect of 𝜆-LC and FAF-
HSA with same concentration (5mg/ml) we found that 𝜆-LC led to stimulating some
marker molecules that FAF-HSA had no effect on. Figure (8.1 and 8.2) showed the
interaction of 𝜆-LC and FAF-HSA with HK2-GF cells, explaining and summarising the
signaling pathways, which might explain the way of proximal tubular damage/repair in
our protein overload conditions
282
LMW and Up regulated
proteins
Pro-inflammatory
(Cytokines/Chemokine’s)
Anti-inflammatory
𝛽2M
Cystatin C
KIM-1
Clusterin
Cyr61
EGF
EGF-R
VCAM-1
MMP9
TFF3
TSP-1
FABP1
IL-6
TNF-𝛼
TNF-R
TWEAK
Lipocalin-2 (NGAL)
MCP1
CXCL16
IL10
Figure (7.17): The biomarkers were measured by proteomic profile assay that might have a role in the process of PTECs injury in our protein
overload condition.
Normal PTECs Damage PTECs
Inflammation, Fibrosis,
Apoptosis, Cell death,
kidney injury and
proteinuria
Biomarkers for early
diagnosis kidney injury
Toxicity by protein
overload
283
8. Summary:
In summary, excessive 𝜆 -LC on HK2-GF cells for 72h led to activating several
pathways leading to production of different injury markers (figure 8.1) C3 complement
component production was increased and this elevation might cause AP activation,
which promotes injury by formation of a membrane attack complex (Abbate et al.,
2006), although our rabbit blood cell lysis system did not detect MAC formation. TNF-
𝛼 production was increased from cells, and also it can be stimulated by C3. TNF-𝛼
activated the IL6. Also, KIM-1 production was increased. These activations led to cell
inflammation; fibrosis and can lead to cells damage. TGF-𝛽 production was increased,
which led to cell fibrosis and can activate IL-8 and MCP-1 and lead to cell
inflammation. Also, TGF-𝛽 can activate PKC or AP-1 to activate clusterine, which also
increased after stimulation and leads to cells fibrosis.
𝜆-LC increased the production of TSP-1, MMP-9, NGAL, Cystatin c, Cyr6 and VCAM-
1; the increased production of all these proteins was used as markers for tubular cell
injury in kidney diseases. TFF3, one of the proteins, which increased in tubular cell
injury but for the purpose of healings cells, was increased significantly from stimulated
cells. From these markers it can be said that 𝜆-LC had a toxic effect on the proximal
tubular cells. The H2O2 and megalin cytoplasmic tail phosphorylation might support this
finding. The extra and intra cellular H2O2 production was increased with 𝜆 -LC
stimulation from HK2-GF cells and this production can lead to activate cytokines and
chemokine production, which end up with cell inflammation. Also, it can activate
caspases, which leads to cells apoptosis.
In addition, H2O2 might play an important role in megalin cytoplasmic tail
phosphorylation by GSK-3, and our results detected megalin tail phosphorylation in
HK2-GF cells pre-stimulated with 𝜆-LC (5mg/ml). This phosphorylation may affect
megalin receptor recycling to the cell surface negatively (reduction), which means no
megalin receptor on cell surfaces to up take light chain and the protein accumulation
might lead to cell damage. By measuring the expression of megalin receptor in
stimulated HK2-GF cells, the results showed a significant decrease in megalin receptor
expression.
284
Lastly, our apoptosis and autophagy results may be able to support our findings as well.
Exposure HK2-GF cells to 𝜆-LC showed an increase in the number of apoptotic cells
significantly. At the same time the autophagy was activated, which might be a
cytoprotective cell response, but autophagy also can be activated in cell stress. In this
condition the autophage play a role in cell damage after 𝜆-LC stimulation because at
this time point a high number of cells were detached and floating in the supernatants.
However, excessive FAF-HSA protein on HK2-GF cells for 72h had a different effect
(figure 8.2). At this stimulation time point, the C3 production was increased and this
elevation might cause AP activation and lead to cell damage. TNF-𝛼 production was
increased from cells, and it can be stimulated by C3. Also, TWEAK, NGAL, Cystatin C
and Cyr61 are markers for tubular injury and they were increased. The elevation of all
these proteins leads to cell inflammation and fibrosis. Also, KIM-1 production was
increased from cells, but the expression of KIM-1 in injured proximal tubule cells could
lead to cell inflammation or repair (Ichimura et al., 2012).
Albumin had no effect on IL6, MCP-1, VCAM-1, MMP-9, TSP-1, TFF-3 and CXCL16
production. Thus, albumin had less effect on proximal tubular cells than 𝜆-LC; the
(5mg/ml) FAF-HSA might cause some cell injury but not as much as 𝜆-LC. The H2O2
production and megalin cytoplasmic tail phosphorylation results may support this
observation. H2O2extracellular production was increased and decreased to the normal
levels at 6h, and had no effect on kinase activation. That plays a role in megalin
cytoplasmic tail phosphorylation because no phosphorylation was detected with
(5mg/ml) FAF-HSA. In addition, albumin increased the megalin receptor expression
and this may be because of the high albumin concentration, so more albumin uptake can
occur. Finally, the apoptosis and autophage results also could help to explain and
support our observation. Albumin showed an increase in the number of apoptotic cells
after stimulation at 24h, but this number did increase at 72h, and at the same time the
stimulated cells with albumin showed autophage activation that may play a
cytoprotective response, because most of the cells were intact to the well surface and
just a few number of cells were floating.
285
The cells that were used in the proteomic profile array were HK2 cells with an EGF
cocktail, which may have some protective effect from cell damage. The EGF cocktail
might have played a protective role with albumin protein overload model, however,
with 𝜆 -LC it did not; this is may be because of the high toxic effect of 𝜆 -LC.
286
Damage PTECs
Cell death, kidney injury
and proteinuria
PTECs
Bruch Border
Megalin Receptor
Excessive Endocytosis
C3
FB
FP
Complement
activation
Apoptosis Fibrosis
Inflammation
TNF-𝜶 H2O2
IL6 IL8 MCP-1
TGF-𝜷
PKC or AP-1
Clusterin
MMP9
TSP-1
TNF-RI
IL10
KIM-1
TWEKA
Caspase
activation
NGAL
Cystatin C
Cyr61
VCAM-1
Excess 𝝀-LC
Cell Repair Cells injury/Healing
TFF3
287
Figure (8.1): Hypothetic signal pathways of proximal tubule cells in response to overload 𝜆-LC. HK2-GF cells were sub-cultured
overnight and stimulated with (1 and 5 mg/ml) 𝜆-LC for 72h. Protein lysates were analysed by proteomic profile array kit. Detected
protein markers involved in potential mechanism in the development of protein overload induce cell damage are presented. In
addition, the mechanism of ROS that involved in response of proximal tubule cells in protein overload conditions. Arrows mean
positive stimulation confirmed in tubular cells.
288
Damage PTECs
Cell death, kidney
injury and proteinuria
PTECs
Bruch Border
Megalin Receptor
Excess HSA-FFA
Excessive Endocytosis
C3
FB
FP
Complement
activation
Apoptosis Fibrosis
Inflammation
TNF-𝜶 H2O2 TGF-𝜷
PKC or AP-1
Clusterin
TNF-RI
IL10
KIM-1
TWEKA
Caspase
activation
NGAL
Cystatin C
Cyr61
Cell Repair
289
Figure (8.2): Hypothetic signal pathways of proximal tubule cells in response to overload FAF-HSA. HK2-GF cells were sub-cultured overnight
and stimulated with (5 mg/ml) FAF-HSA for 72h. Protein lysates were analysed by proteomic profile array kit. Detected protein markers involved
in potential mechanism in the development of protein overload induce cell damage are presented. In addition, the mechanism of ROS that
involved in response of proximal tubule cells in protein overload conditions.
290
Conclusion
It is possible that proteinuria can cause progressive renal damage and lead to end-stage
renal failure. This possibility is supported by increasing the number of experiments and
clinical studies in this issue. This renal damage/injury occurs by activating multiple
pathways in kidney cells, leading to tubular cells inflammation, fibrosis and apoptosis.
This thesis investigated the effect of protein overload conditions causing injury/damage
in proximal tubular epithelial cells using albumin-fatty acid free and light chain purified
from urine of MM patient in vitro, by examining the activation of different pathways
that might have a role in encouraging cell damage in proteinuria conditions.
Measurements involved complement production, inflammatory cytokines and ROS
generation.
In addition, megalin is one of the important receptors in proximal tubular cells to
reabsorb filtered protein from glomerular like albumin and light chain by endocytosis
process. This thesis proved that protein overload conditions using albumin and light
chain lead to phosphorylated MegCT in a specific site (PPPSP) by activating GSK-3
kinase, and this phosphorylation affects megalin receptor recycling to the cell’s surface
negatively (reduction).
From the findings of this thesis it can be concluded that phosphorylation of the megalin
cytoplasmic tail might associate with reduced light chain endocytosis in renal proximal
tubular cells and might impact on the progression of proteinuric nephropathy.
291
Findings and Future work
This table summarises the major findings in this thesis and indications for future work:
Finding Future Work
Characterisation of Renal Proximal
Tubular Epithelial Cells:
Culturing the proximal
tubular cells in vitro with
media supplemented with
EGF cocktail had effect on
cells proliferation, and
some protection from
protein overload impact on
cells.
Investigate the effect of
which component in the
EGF cocktail has the
protective effect on cells
(additive/synergistic
effects of components)
Establishing an in vitro model of
protein-induced epithelial cell
damage:
Proliferation of proximal
tuabular cells in vitro was
inhibited by protein
overload using FAF-HSA.
However, no protective
effect of EGF cocktail on
proximal tubular cells with
protein overload condition
using light chain protein.
Autophage was activated
and apoptotic cells were
detected in both protein
overload conditions using
albumin and light chain.
Examine the effect of EGF
cocktail on protection cells
from protein overload
condition using albumin
with fatty acid.
Investigate the role of
autophagy activation by
inhibiting the process and
measuring apoptosis. In
addition, measuring the
percentage of early/late
cell apoptosis and necrosis
by flow cytometer
technique
292
Megalin Phosphorylation in Renal
Proximal Tubular Epithelial Cells:
Phosphorylation of megalin
cytoplasmic tail using
MegCT-GST fusion with
pre-stimulated cell lysates
with albumin or light chain
derived from HK2 (+/-GF)
cells by Western blot using
specific phosphor-antibody
against (PPPSP) site.
Megalin mRNA expression
was decreased in proximal
tubular cells after light
chain treatment but
increased with albumin.
Investigate the effect of
higher FAF-HSA
concentration on megalin
expression, and examine if
albumin with fatty acid has
different effects.
CD36 mRNA expression
was increased in protein
overload condition.
Inhibiting GSK-3 and
detecting the
phosphorylation. Inhibit
PI3K and measure the
phosphorylation using
albumin with fatty acid.
Time course for 5mg/ml
FAF-HSA.
Optimising conditions to
measure the megalin
protein production by
Western blot in proximal
tubular cells after protein
overload stimulation.
Investigate why megalin
decreased and CD36
increased.
293
Appendix
294
Figure (Appendix I): Poster in The 7th Saudi Student conference, Edinburgh,
UK, February 2014.
295
Figure (Appendix II): Poster in Kidney Week 2014 conference, Glasgow, UK,
April 2014.
296
Figure (Appendix III): Poster in University of Leicester Postgraduate Research Festival, selected as one of the 50 most promising
researchers among 1500 postgraduates at the University, University of Leicester, Leicester, UK, June 2014.
297
A TGF-𝜷
24h
72h
157 bp
GF HK2
1 2 3 4
B IL-6
24h
72h 250 bp
GF HK2
1 2 3 4
C IL-8
72h
24h 111 bp
GF HK2
1 2 3 4
298
D MCP-1
24h
72h
177 bp
GF HK2
1 2 3 4
F FH
24h
72h
276 bp
GF HK2
1 2 3 4
24h
E C3
72h
168 bp
GF HK2
1 2 3 4
299
Figure (Appendix IV): Semi-quantitative analysis (RT-PCR) of mRNA expression
from HK2 (+/-GF) cells after stimulating with FAF-HSA for 24 and 72h (5mg/ml).
2𝜇g mRNA was used from each sample. 𝛽-actin was used as housekeeping gene. (1
and 3) Control sample (2 and 4) stimulated sample.
G FB
548 bp
GF HK2
1 2 3 4
24h
72h
24h
72h
H KIM-1
210 bp
GF HK2
1 2 3 4
GF HK2
1 2 3 4
24h
72h
I 𝜷-actin
160 bp
300
Appendix ( V ) Alternative pathway (AP) hemolytic assay:
The alternative pathway (AP) hemolytic assay aims to quantify the activity of
complement using unmodified rabbit erythrocytes. It is cheap, fast, simple and
insensitive to C3 degradation. The rabbit blood cells (RBC) were used a complement
activator because it is the most AP sensitive of erythrocyte species (Spitzer et al.,
2007) and human serum as a C3 complement source.
The HK2 (+/- GF) cells were seeded in (1X 106 cells/well) in 6 well plates for 24h.
They were then treated with 5mg/ml of FAF-HSA and 𝜆-LC in serum free medium
for 24 and 72h in the incubator 37C˚, 5% CO2. After each time point the supernatants
were collected.
0.5ml from the rabbit red blood cells (RBC) (Rabbit Blood in Alsever's, tcs
bioscience, Cat no. RB053) was centrifuged for 3min at 200g to remove the storage
solution then the pellet was washed twice in PBS. 150𝜇𝑙 from the pellet was mixed
with 15ml of veronal buffer saline to be stable (RBC stock). 50𝜇𝑙 from the diluted
cells was mixed with 200𝜇𝑙 dH2O in cuvette to test the complete hemolysis (100% of
the cells lysis); the OD was measured by spectrophotometer at (413nm) (varian 50 bio
uv-visible spectrophotometer) and should give (1.0). If more than 1 the cells should
be diluted more in buffer (too much cells in the stock) or if less than 1 so the stock is
too dilute and needs more cells. The dH2O was used as a blank.
Different controls were used:
50𝜇𝑙 RBC stock + 200𝜇𝑙 dH2O (100 % hemolysis)
50𝜇𝑙 RBC stock+ 200𝜇𝑙 VBS (No hemolysis)
50𝜇𝑙 RBC stock + 50𝜇𝑙 serum + 100𝜇𝑙 VBS (positive control for hemolysis
by AP- C3)
50𝜇𝑙 RBC stock + 50𝜇𝑙 serum heat in activated for 30min at 56C˚ + 100𝜇𝑙
VBS (less or no hemolysis by AP-C3)
For each test sample 100𝜇𝑙 VBS + 100 𝜇𝑙 sample supernatant + 50𝜇𝑙 RBC stock.
301
In 96 well plate all the samples and controls was added and incubated for 45min in
the incubator 37C˚, because the RBC complete lysis in 30min and does not change
subsequently. Then, the plate was centrifuged for 3min at 200g.
Veronal Buffer Saline (VBS)
4mM barbiturate
145mM NaCl
2mM MgCl2
8mM EGTA
pH 7.4
1- H2O + RBCs
2-Buffer+RBCs
3-Serum+RBCs
4-In active Serum+RBCs
302
References
303
Abbate, M., Zoja, C., Remuzzi, G., 2006. How does proteinuria cause progressive
renal damage? Journal of the American Society of Nephrology : JASN. 17, 2974-2984.
Adiyanti, S.S. & Loho, T., 2012. Acute kidney injury (AKI) biomarker. Acta Med
Indones. 44, 246-255.
Akcay, A., Nguyen, Q., Edelstein, C.L., 2009. Mediators of inflammation in acute
kidney injury. Mediators of Inflammation. 2009, 137072.
Arici, M., Chana, R., Lewington, A., Brown, J., Brunskill, N.J., 2003. Stimulation of
proximal tubular cell apoptosis by albumin-bound fatty acids mediated by peroxisome
proliferator activated receptor-gamma. Journal of the American Society of
Nephrology : JASN. 14, 17-27.
Arimura, A., Li, M., Batuman, V., 2006. Potential protective action of pituitary
adenylate cyclase-activating polypeptide (PACAP38) on in vitro and in vivo models
of myeloma kidney injury. Blood. 107, 661-668.
Astor, B.C., Kottgen, A., Hwang, S.J., Bhavsar, N., Fox, C.S., Coresh, J., 2011.
Trefoil factor 3 predicts incident chronic kidney disease: a case-control study nested
within the Atherosclerosis Risk in Communities (ARIC) study. American Journal of
Nephrology. 34, 291-297.
Baek, J.E., Yang, W.S., Chang, J.W., Kim, S.B., Park, S.K., Park, J.S., Lee, S.K.,
2010. Fatty acid-bearing albumin induces VCAM-1 expression through c-Src kinase-
AP-1/NF-kB pathways: effect of L-carnitine. Kidney & Blood Pressure Research. 33,
72-84.
Baines, R.J., 2010. Megalin Cytoplasmic Tail Phosphorylation and Function in
Kidney Proximal Tubular Cells.
Baines, R.J. & Brunskill, N.J., 2008. The molecular interactions between filtered
proteins and proximal tubular cells in proteinuria. Nephron.Experimental Nephrology.
110, e67-71.
Baines, R.J., Chana, R.S., Hall, M., Febbraio, M., Kennedy, D., Brunskill, N.J., 2012.
CD36 mediates proximal tubular binding and uptake of albumin and is upregulated in
proteinuric nephropathies. American Journal of Physiology.Renal Physiology. 303,
F1006-14.
Basnayake, K., Stringer, S.J., Hutchison, C.A., Cockwell, P., 2011. The biology of
immunoglobulin free light chains and kidney injury. Kidney International. 79, 1289-
1301.
Basnayake, K., Ying, W.Z., Wang, P.X., Sanders, P.W., 2010. Immunoglobulin light
chains activate tubular epithelial cells through redox signaling. Journal of the
American Society of Nephrology : JASN. 21, 1165-1173.
Benbrook, D. & Long, A., 2012. Integration of autophagy, proteasomal degradation,
unfolded protein response and apoptosis. Exp Oncol. 34, 286-297.
304
Birben, E., Sahiner, U.M., Sackesen, C., Erzurum, S. and Kalayci, O., 2012.
Oxidative stress and antioxidant defense. World Allergy Organization Journal, 5(1),
p.1.
Birn, H. & Christensen, E., 2006. Renal albumin absorption in physiology and
pathology. Kidney International. 69, 440-449.
Blobe, G.C., Schiemann, W.P., Lodish, H.F., 2000. Role of transforming growth
factor β in human disease. New England Journal of Medicine. 342, 1350-1358.
Brunskill, N.J., Cockcroft, N., Nahorski, S., Walls, J., 1996. Albumin endocytosis is
regulated by heterotrimeric GTP-binding protein G alpha i-3 in opossum kidney cells.
The American Journal of Physiology. 271, F356-64.
Brunskill, N.J., Stuart, J., Tobin, A.B., Walls, J., Nahorski, S., 1998. Receptor-
mediated endocytosis of albumin by kidney proximal tubule cells is regulated by
phosphatidylinositide 3-kinase. The Journal of Clinical Investigation. 101, 2140-
2150.
Cabezas, F., Lagos, J., Céspedes, C., Vio, C.P., Bronfman, M., Marzolo, M., 2011.
Megalin/LRP2 expression is induced by peroxisome proliferator-activated receptor-
alpha and-gamma: implications for PPARs' roles in renal function. PloS One. 6,
e16794.
CANCER RESEARCH UK. (2012) Myeloma statistics. [Online] Available from:
http://www.cancerresearchuk.org/health-professional/cancer-statistics/statistics-by-
cancer-type/myeloma#heading-One. [Accessed 02 January 16].
Carroll, M.F., 2000. Proteinuria in Adults: A Diagnositc Approach. American Family
Physician. 62, 6.
Caruso-Neves, C., Kwon, S.H., Guggino, W.B., 2005. Albumin endocytosis in
proximal tubule cells is modulated by angiotensin II through an AT2 receptor-
mediated protein kinase B activation. Proceedings of the National Academy of
Sciences of the United States of America. 102, 17513-17518.
Chae, H., Ryu, H., Cha, K., Kim, M., Kim, Y., Min, C., 2015. Neutrophil Gelatinase-
Associated Lipocalin as a Biomarker of Renal Impairment in Patients With Multiple
Myeloma. Clinical Lymphoma Myeloma and Leukemia. 15, 35-40.
Christensen, E.I. & Birn, H., 2001. Megalin and cubilin: synergistic endocytic
receptors in renal proximal tubule. American Journal of Physiology.Renal Physiology.
280, F562-73. .
Clausen, P., Jacobsen, P., Rossing, K., Jensen, J., Parving, H., Feldt‐ Rasmussen, B.,
2000. Plasma concentrations of VCAM‐ 1 and ICAM‐ 1 are elevated in patients with
Type 1 diabetes mellitus with microalbuminuria and overt nephropathy. Diabetic
Medicine. 17, 644-649.
305
Coll, E., Botey, A., Alvarez, L., Poch, E., Quintó, L., Saurina, A., Vera, M., Piera, C.,
Darnell, A., 2000. Serum cystatin C as a new marker for noninvasive estimation of
glomerular filtration rate and as a marker for early renal impairment. American
Journal of Kidney Diseases. 36, 29-34.
Coresh, J. & Jafar, T.H., 2015. Disparities in worldwide treatment of kidney failure.
Lancet (London, England). 385, 1926-1928.
de Geus, H.R., Betjes, M.G., Bakker, J., 2012. Biomarkers for the prediction of acute
kidney injury: a narrative review on current status and future challenges. Clinical
Kidney Journal. 5, 102-108.
de Jong, P.E. & Curhan, G.C., 2006. Screening, monitoring, and treatment of
albuminuria: Public health perspectives. Journal of the American Society of
Nephrology : JASN. 17, 2120-2126.
De, S., Kuwahara, S., Saito, A., 2014. The endocytic receptor megalin and its
associated proteins in proximal tubule epithelial cells. Membranes. 4, 333-355.
Deng, J., Kohda, Y., Chiao, H., Wang, Y., Hu, X., Hewitt, S.M., Miyaji, T., Mcleroy,
P., Nibhanupudy, B., Li, S., 2001. Interleukin-10 inhibits ischemic and cisplatin-
induced acute renal injury. Kidney International. 60, 2118-2128.
Devasagayam, T., Tilak, J., Boloor, K., Sane, K.S., Ghaskadbi, S.S., Lele, R., 2004.
Free radicals and antioxidants in human health: current status and future prospects.
Japi. 52, 4.
Dimas, G., Iliadis, F., Grekas, D., 2013. Matrix metalloproteinases, atherosclerosis,
proteinuria and kidney disease: Linkage–based approaches. Hippokratia. 17, 292.
Dimopoulos, M., Kastritis, E., Rosinol, L., Blade, J., Ludwig, H., 2008. Pathogenesis
and treatment of renal failure in multiple myeloma. Leukemia. 22, 1485-1493.
Diwakar, R., Pearson, A.L., Colville-Nash, P., Brunskill, N.J., Dockrell, M.E., 2007.
The role played by endocytosis in albumin-induced secretion of TGF-beta1 by
proximal tubular epithelial cells. American Journal of Physiology.Renal Physiology.
292, F1464-70.
Dixon, R. & Brunskill, N.J., 2000. Albumin stimulates p44/p42 extracellular-signal-
regulated mitogen-activated protein kinase in opossum kidney proximal tubular cells.
Clinical Science. 98, 295-301.
Donnahoo, K., Meng, X., Ao, L., Ayala, A., Shames, B., Cain, M., Harken, A.,
Meldrum, D., 2001. Differential cellular immunolocalization of renal tumour necrosis
factor‐ α production during ischaemia versus endotoxaemia. Immunology. 102, 53-58.
306
Du, T., Luo, H., Qin, H., Wang, F., Wang, Q., Xiang, Y., Zhang, Y., 2013.
Circulating serum trefoil factor 3 (TFF3) is dramatically increased in chronic kidney
disease. PloS one, 8(11), p.e80271.
Eardley, K., Zehnder, D., Quinkler, M., Lepenies, J., Bates, R., Savage, C., Howie,
A., Adu, D., Cockwell, P., 2006. The relationship between albuminuria, MCP-
1/CCL2, and interstitial macrophages in chronic kidney disease. Kidney International.
69, 1189-1197.
Eisenberg, E. & Levanon, E.Y., 2003. Human housekeeping genes are compact.
TRENDS in Genetics. 19, 362-365.
Erkan, E., De Leon, M., Devarajan, P., 2001. Albumin overload induces apoptosis in
LLC-PK(1) cells. American Journal of Physiology.Renal Physiology. 280, F1107-14.
Erkan, E., Devarajan, P., Schwartz, G.J., 2007. Mitochondria are the major targets in
albumin-induced apoptosis in proximal tubule cells. Journal of the American Society
of Nephrology : JASN. 18, 1199-1208.
Erkan, E., Garcia, C.D., Patterson, L.T., Mishra, J., Mitsnefes, M.M., Kaskel, F.J.,
Devarajan, P., 2005. Induction of renal tubular cell apoptosis in focal segmental
glomerulosclerosis: roles of proteinuria and Fas-dependent pathways. Journal of the
American Society of Nephrology : JASN. 16, 398-407.
Ernandez, T. & Mayadas, T., 2009. Immunoregulatory role of TNFα in inflammatory
kidney diseases. Kidney International. 76, 262-276.
Eruslanov, E. & Kusmartsev, S., 2010. Identification of ROS using oxidized DCFDA
and flow-cytometry. Advanced Protocols in Oxidative Stress II. Springer. 57-72.
Evans, P.D. & Taal, M.W., 2011. Epidemiology and causes of chronic kidney disease.
Medicine. 39, 402-406.
Fearn, A. & Sheerin, N.S., 2015. Complement activation in progressive renal disease.
World Journal of Nephrology. 4, 31.
Gaarkeuken, H., Siezenga, M.A., Zuidwijk, K., van Kooten, C., Rabelink, T.J., Daha,
M.R., Berger, S.P., 2008. Complement activation by tubular cells is mediated by
properdin binding. American Journal of Physiology.Renal Physiology. 295, F1397-
403.
Goumenos, D.S., Tsakas, S., El Nahas, A.M., Alexandri, S., Oldroyd, S., Kalliakmani,
P., Vlachojannis, J.G., 2002. Transforming growth factor-beta(1) in the kidney and
urine of patients with glomerular disease and proteinuria. Nephrology, Dialysis,
Transplantation : Official Publication of the European Dialysis and Transplant
Association - European Renal Association. 17, 2145-2152.
Greer, S., Honeywell, R., Geletu, M., Arulanandam, R., Raptis, L., 2010.
Housekeeping genes; expression levels may change with density of cultured cells.
Journal of Immunological Methods. 355, 76-79.
307
Gris, C.F. & Baldoni, A., 2013. Proteomics and Its Use in Obtaining Superior
Soybean Genotypes. INTECH Open Access Publisher.
Grone, H.J., Weber, K., Helmchen, U., Osborn, M., 1986. Villin--a marker of brush
border differentiation and cellular origin in human renal cell carcinoma. The
American Journal of Pathology. 124, 294-302.
Han, W.K., Bailly, V., Abichandani, R., Thadhani, R., Bonventre, J.V., 2002. Kidney
Injury Molecule-1 (KIM-1): a novel biomarker for human renal proximal tubule
injury. Kidney International. 62, 237-244.
Heher, E.C., Rennke, H.G., Laubach, J.P., Richardson, P.G., 2013. Kidney disease
and multiple myeloma. Clinical Journal of the American Society of Nephrology :
CJASN. 8, 2007-2017.
Hills, C.E., Kerr, M.I., Wall, M.J., Squires, P.E., 2013. Visfatin reduces gap junction
mediated cell-to-cell communication in proximal tubule-derived epithelial cells.
Cellular Physiology and Biochemistry : International Journal of Experimental
Cellular Physiology, Biochemistry, and Pharmacology. 32, 1200-1212.
Hodgkins, K.S. & Schnaper, H.W., 2012. Tubulointerstitial injury and the progression
of chronic kidney disease. Pediatric Nephrology. 27, 901-909.
Hojs, R., Ekart, R., Bevc, S., Hojs, N., 2015. Biomarkers of Renal Disease and
Progression in Patients with Diabetes. Journal of Clinical Medicine. 4, 1010-1024.
Hsieh, T.J., Hsieh, P.C., Tsai, Y.H., Wu, C.F., Liu, C.C., Lin, M.Y., Wu, M.T., 2012.
Melamine induces human renal proximal tubular cell injury via transforming growth
factor-beta and oxidative stress. Toxicological Sciences : An Official Journal of the
Society of Toxicology. 130, 17-32.
Hurowitz, E.H., Melnyk, J.M., Chen, Y.J., Kouros-Mehr, H., Simon, M.I., Shizuya,
H., 2000. Genomic characterization of the human heterotrimeric G protein alpha,
beta, and gamma subunit genes. DNA Research : An International Journal for Rapid
Publication of Reports on Genes and Genomes. 7, 111-120.
Hutchison, C.A., Batuman, V., Behrens, J., Bridoux, F., Sirac, C., Dispenzieri, A.,
Herrera, G.A., Lachmann, H., Sanders, P.W., 2012. The pathogenesis and diagnosis
of acute kidney injury in multiple myeloma. Nature Reviews Nephrology. 8, 43-51.
Ichimura, T., Brooks, C.R., Bonventre, J.V., 2012. Kim-1/Tim-1 and immune cells:
shifting sands. Kidney International. 81, 809-811.
Imai, E., Nakajima, H., Kaimori, J., 2004. Albumin turns on a vicious spiral of
oxidative stress in renal proximal tubules. Kidney International. 66, 2085-2087.
Inal, J.M., Pascual, M., Lesavre, P., Schifferli, J.A., 2003. Complement inhibition in
renal diseases. Nephrology, Dialysis, Transplantation : Official Publication of the
European Dialysis and Transplant Association - European Renal Association. 18,
237-240.
308
Inoki, K., 2013. Proximal tubules forget "self-eating" when they meet Western meals.
Journal of the American Society of Nephrology : JASN. 24, 1711-1713.
Izaguirre-Carbonell, J., Kawakubo, H., Murata, H., Tanabe, A., Takeuchi, T.,
Kusayanagi, T., Tsukuda, S., Hirakawa, T., Iwabata, K., Kanai, Y., Ohta, K., Miura,
M., Sakaguchi, K., Matsunaga, S., Sahara, H., Kamisuki, S., Sugawara, F., 2015.
Novel anticancer agent, SQAP, binds to focal adhesion kinase and modulates its
activity. Scientific Reports. 5, 15136.
Jenkinson, S.E., Chung, G.W., van Loon, E., Bakar, N.S., Dalzell, A.M., Brown,
C.D., 2012. The limitations of renal epithelial cell line HK-2 as a model of drug
transporter expression and function in the proximal tubule. Pflügers Archiv-European
Journal of Physiology. 464, 601-611.
Jha, V., Garcia-Garcia, G., Iseki, K., Li, Z., Naicker, S., Plattner, B., Saran, R., Wang,
A.Y., Yang, C., 2013. Chronic kidney disease: global dimension and perspectives.
The Lancet. 382, 260-272.
Jiang, M., Wei, Q., Dong, G., Komatsu, M., Su, Y., Dong, Z., 2012. Autophagy in
proximal tubules protects against acute kidney injury. Kidney International. 82, 1271-
1283.
Jones, S.A., Fraser, D.J., Fielding, C.A., Jones, G.W., 2015. Interleukin-6 in renal
disease and therapy. Nephrology, Dialysis, Transplantation : Official Publication of
the European Dialysis and Transplant Association - European Renal Association. 30,
564-574.
Joyce, D.A., Gibbons, D.P., Green, P., Steer, J.H., Feldmann, M., Brennan, F.M.,
1994. Two inhibitors of pro‐ inflammatory cytokine release, interleukin‐ 10 and
interleukin‐ 4, have contrasting effects on release of soluble p75 tumor necrosis factor
receptor by cultured monocytes. European Journal of Immunology. 24, 2699-2705.
Kamiyama, M., Garner, M.K., Farragut, K.M., Kobori, H., 2012. The establishment
of a primary culture system of proximal tubule segments using specific markers from
normal mouse kidneys. International Journal of Molecular Sciences. 13, 5098-5111.
Kanayama, N., Kajiwara, Y., Goto, J., el Maradny, E., Maehara, K., Andou, K.,
Terao, T., 1995. Inactivation of interleukin-8 by aminopeptidase N (CD13). Journal
of Leukocyte Biology. 57, 129-134.
Kang, C.K. & Lee, T.H., 2014. Medaka villin 1-like protein (VILL) is associated with
the formation of microvilli induced by decreasing salinities in the absorptive
ionocytes. Frontiers in Zoology. 11, 2-9994-11-2.
Kapoulas, S., Raptis, V., Papaioannou, M., 2015. New aspects on the pathogenesis of
renal disorders related to monoclonal gammopathies. Néphrologie & Thérapeutique.
11, 135-143.
Kaushal, G.P., 2012. Autophagy protects proximal tubular cells from injury and
apoptosis. Kidney International. 82, 1250-1253.
309
Kaushal, G.P., Liu, L., Kaushal, V., Hong, X., Melnyk, O., Seth, R., Safirstein, R.,
Shah, S.V., 2004. Regulation of caspase-3 and -9 activation in oxidant stress to RTE
by forkhead transcription factors, Bcl-2 proteins, and MAP kinases. American Journal
of Physiology.Renal Physiology. 287, F1258-68.
Kavsan, V.M., Iershov, A.V., Balynska, O.V., 2011. Immortalized cells and one
oncogene in malignant transformation: old insights on new explanation. BMC Cell
Biology. 12, 1.
Kendig, D.M. & Tarloff, J.B., 2007. Inactivation of lactate dehydrogenase by several
chemicals: implications for in vitro toxicology studies. Toxicology in Vitro. 21, 125-
132.
Khan, Z. & Pandey, M., 2014. Role of kidney biomarkers of chronic kidney disease:
An update. Saudi Journal of Biological Sciences. 21, 294-299.
Kim, D., Garrett, S.H., Sens, M.A., Somji, S., Sens, D.A., 2002. Metallothionein
isoform 3 and proximal tubule vectorial active transport. Kidney International. 61,
464-472.
Kim, J.S., Yang, J.W., Park, H., Kim, Y.S., Lee, J.Y., Lee, J.I., Han, B.G., Choi, S.O.,
2014. Myeloma progression and urinary gammaglobulin affect the urinary cystatin C
to diagnose acute kidney injury in multiple myeloma. Clinical Nephrology. 81, 345-
349.
Koeppen, B.M. & Stanton, B.A., 2012. Renal Physiology: Mosby Physiology
Monograph Series. Elsevier Health Sciences.
Korbet, S. & Schwartz, M., 2006. Multiple Myeloma. 17, 2533-2545.
Kowolik, C.M., Liang, S., Yu, Y., Yee, J., 2004. Cre-mediated reversible
immortalization of human renal proximal tubular epithelial cells. Oncogene. 23, 5950-
5957.
Kriz, W. & LeHir, M., 2005. Pathways to nephron loss starting from glomerular
diseases—insights from animal models. Kidney International. 67, 404-419.
Krueger, J., Ray, A., Tamm, I., Sehgal, P.B., 1991. Expression and function of
interleukin‐ 6 in epithelial cells. Journal of Cellular Biochemistry. 45, 327-334.
Kuby, J. (1997). IMMUNOLOGY. 3rd ed. United State of America : W.H.Freeman &
Co Ltd.
Kwak, H.B., 2013. Effects of aging and exercise training on apoptosis in the heart.
Journal of Exercise Rehabilitation. 9, 212-219.
Kwon, J., Kim, T., Kim, K., Jung, J., Cho, S., Min, K., Kim, Y., Park, H., 2012.
Differences in airway inflammation according to atopic status in patients with chronic
rhinitis. Asia Pacific Allergy. 2, 248.
310
Lajoie, P., Guay, G., Dennis, J.W., Nabi, I.R., 2005. The lipid composition of
autophagic vacuoles regulates expression of multilamellar bodies. Journal of Cell
Science. 118, 1991-2003.
Lee, K.E., Kim, E.Y., Kim, C.S., Choi, J.S., Bae, E.H., Ma, S.K., Park, J.S., Do Jung,
Y., Kim, S.H., Lee, J.U., 2013. Macrophage-stimulating protein attenuates hydrogen
peroxide-induced apoptosis in human renal HK-2 cells. European Journal of
Pharmacology. 715, 304-311.
Leheste, J., Rolinski, B., Vorum, H., Hilpert, J., Nykjaer, A., Jacobsen, C.,
Aucouturier, P., Moskaug, J.Ø., Otto, A., Christensen, E.I., 1999. Megalin knockout
mice as an animal model of low molecular weight proteinuria. The American Journal
of Pathology. 155, 1361-1370.
Lenderink, A.M., Liegel, K., Ljubanovic, D., Coleman, K.E., Gilkeson, G.S., Holers,
V.M., Thurman, J.M., 2007. The alternative pathway of complement is activated in
the glomeruli and tubulointerstitium of mice with adriamycin nephropathy. American
Journal of Physiology.Renal Physiology. 293, F555-64.
Leung, N. 2007. Light Chain Deposition Disease. International Myeloma Foundation
[Online] Available from: http://myeloma.org/ArticlePage.action?articleId=2163
[Accessed 02 January 16].
Levey, A.S. & Coresh, J., 2012. Chronic kidney disease. The Lancet. 379, 165-180.
Levey, A., Atkins, R., Coresh, J., Cohen, E., Collins, A., Eckardt, K., Nahas, M.,
Jaber, B., Jadoul, M., Levin, A., 2007. Chronic kidney disease as a global public
health problem: approaches and initiatives–a position statement from Kidney Disease
Improving Global Outcomes. Kidney International. 72, 247-259.
Li, M., Balamuthusamy, S., Simon, E.E., Batuman, V., 2008. Silencing megalin and
cubilin genes inhibits myeloma light chain endocytosis and ameliorates toxicity in
human renal proximal tubule epithelial cells. American Journal of Physiology.Renal
Physiology. 295, F82-90.
Li, M., Hering-Smith, K.S., Simon, E.E., Batuman, V., 2008. Myeloma light chains
induce epithelial-mesenchymal transition in human renal proximal tubule epithelial
cells. Nephrology, Dialysis, Transplantation : Official Publication of the European
Dialysis and Transplant Association - European Renal Association. 23, 860-870.
Liang, K., Lee, C., Lin, W., Lin, C., Wu, C., Luo, S., Yang, C., 2007. Interleukin‐ 1β
induces MMP‐ 9 expression via p42/p44 MAPK, p38 MAPK, JNK, and nuclear
factor‐ κB signaling pathways in human tracheal smooth muscle cells. Journal of
Cellular Physiology. 211, 759-770.
Lieberthal, W. & Levine, J.S., 1996. Mechanisms of apoptosis and its potential role in
renal tubular epithelial cell injury. The American Journal of Physiology. 271, F477-
88.
311
Lim, A.I., Chan, L.Y., Tang, S.C., Lai, K.N., Leung, J.C., 2014. Albumin and
glycated albumin activate KIM-1 release in tubular epithelial cells through distinct
kinetics and mechanisms. Inflammation Research. 63, 831-839.
Lin, M., Li, L., Zhang, Y., Zheng, L., Xu, M., Rong, R., Zhu, T., 2014. Baicalin
Ameliorates H2O2 Induced Cytotoxicity in HK-2 Cells through the Inhibition of ER
Stress and the Activation of Nrf2 Signaling. International Journal of Molecular
Sciences. 15, 12507-12522.
Lin, Y., Boone, M., Meuris, L., Lemmens, I., Van Roy, N., Soete, A., Reumers, J.,
Moisse, M., Plaisance, S., Drmanac, R., 2014. Genome dynamics of the human
embryonic kidney 293 lineage in response to cell biology manipulations. Nature
Communications, 5.
Liu, B., Gao, J., Li, Q., Xu, L., 2009. Albumin caused the increasing production of
angiotensin II due to the dysregulation of ACE/ACE2 expression in HK2 cells.
Clinica Chimica Acta. 403, 23-30.
Liu, W.J., Luo, M., Tan, J., Chen, W., Huang, L., Yang, C., Pan, Q., Li, B., Liu, H.,
2014. Autophagy activation reduces renal tubular injury induced by urinary proteins.
Autophagy. 10, 243-256.
Livak, K.J. & Schmittgen, T.D., 2001. Analysis of relative gene expression data using
real-time quantitative PCR and the 2− ΔΔCT method. Methods. 25, 402-408.
Lock, E.A., 2010. Sensitive and early markers of renal injury: where are we and what
is the way forward? Toxicological Sciences : An Official Journal of the Society of
Toxicology. 116, 1-4.
Lote, C.J. & Lote, C.J., 1994. Principles of renal physiology. Springer.
Lu, A., Miao, M., Schoeb, T.R., Agarwal, A., Murphy-Ullrich, J.E., 2011. Blockade
of TSP1-dependent TGF-β activity reduces renal injury and proteinuria in a murine
model of diabetic nephropathy. The American Journal of Pathology. 178, 2573-2586.
Mäkelä, S., Mustonen, J., Ala-Houhala, I., Hurme, M., Koivisto, A., Vaheri, A.,
Pasternack, A., 2004. Urinary excretion of interleukin-6 correlates with proteinuria in
acute Puumala hantavirus-induced nephritis. American Journal of Kidney Diseases.
43, 809-816.
Male, D.K., 2004. Immunology: an illustrated outline. Elsevier Health Sciences.
Mandal, N.A. & Ayyagari, R., 2006. Complement factor H: spatial and temporal
expression and localization in the eye. Investigative Ophthalmology & Visual Science.
47, 4091-4097.
Markowitz, G.S., 2004. Dysproteinemia and the kidney. Advances in Anatomic
Pathology. 11, 49-63.
312
Marzolo, M. & Farfán, P., 2011. New insights into the roles of megalin/LRP2 and the
regulation of its functional expression. Biological Research. 44, 89-105.
Mathern, D.R. & Heeger, P.S., 2015. Molecules Great and Small: The Complement
System. Clinical Journal of the American Society of Nephrology : CJASN. 10, 1636-
1650.
Mehdad, A., Brumana, G., Souza, A., Barbosa, J., Ventura, M., de Freitas, S., 2016. A
Bowman–Birk inhibitor induces apoptosis in human breast adenocarcinoma through
mitochondrial impairment and oxidative damage following proteasome 20S
inhibition. Cell Death Discovery, 2.
Moon, S.Y., Kim, H.S., Nho, K.W., Jang, Y.J., Lee, S.K., 2014. Endoplasmic
reticulum stress induces epithelial-mesenchymal transition through autophagy via
activation of c-Src kinase. Nephron.Experimental Nephrology. 126, 127-140.
Morigi, M., Macconi, D., Zoja, C., Donadelli, R., Buelli, S., Zanchi, C., Ghilardi, M.,
Remuzzi, G., 2002. Protein overload-induced NF-kappaB activation in proximal
tubular cells requires H(2)O(2) through a PKC-dependent pathway. Journal of the
American Society of Nephrology : JASN. 13, 1179-1189.
Morita, Y., Ikeguchi, H., Nakamura, J., Hotta, N., Yuzawa, Y., Matsuo, S., 2000.
Complement activation products in the urine from proteinuric patients. Journal of the
American Society of Nephrology : JASN. 11, 700-707.
Morris, S.M., Tallquist, M.D., Rock, C.O., Cooper, J.A., 2002. Dual roles for the
Dab2 adaptor protein in embryonic development and kidney transport. The EMBO
Journal. 21, 1555-1564.
Mussap, M. & Merlini, G., 2014. Pathogenesis of renal failure in multiple myeloma:
any role of contrast media? BioMed Research International. 2014, 167125.
Nagamachi, S., Ohsawa, I., Suzuki, H., Sato, N., Inoshita, H., Hisada, A., Honda, D.,
Shimamoto, M., Shimizu, Y., Horikoshi, S., 2014. Properdin has an ascendancy over
factor H regulation in complement-mediated renal tubular damage. BMC Nephrology.
15, 1.
Nakamura, A., Suzuki, T., Kohsaka, T., 1995. Renal Tubular Function Modulates
Urinary Levels of lnterleukin-6. Nephron. 70, 416-420.
Nakhoul, N. & Batuman, V., 2011. Role of proximal tubules in the pathogenesis of
kidney disease. Contributions to Nephrology. 169, 37-50.
Nath, K.A., 2010. Receptor-mediated endocytosis is a Trojan horse in light-chain
nephrotoxicity. Journal of the American Society of Nephrology : JASN. 21, 1065-
1066.
National kidney foundation. (2015) GLOBAL FACTS: ABOUT KIDNEY DISEASE.
[Online] Available from: https://www.kidney.org/kidneydisease/global-facts-about-
kidney-disease. [Accessed 02 January 16].
313
Navarro, J.F., Mora, C., Rivero, A., Gallego, E., Chahin, J., Macía, M., Méndez,
M.L., García, J., 1999. Urinary protein excretion and serum tumor necrosis factor in
diabetic patients with advanced renal failure: effects of pentoxifylline administration.
American Journal of Kidney Diseases. 33, 458-463.
Nejat, M., Hill, J.V., Pickering, J.W., Edelstein, C.L., Devarajan, P., Endre, Z.H.,
2012. Albuminuria increases cystatin C excretion: implications for urinary
biomarkers. Nephrology, Dialysis, Transplantation : Official Publication of the
European Dialysis and Transplant Association - European Renal Association. 27
Suppl 3, iii96-103.
Neuwirt, H., Perco, P., Kainz, A., Muhlberger, I., Leierer, J., Braniff, S.J., Mayer, B.,
Mayer, G., Rudnicki, M., 2014. A 3-biomarker-panel predicts renal outcome in
patients with proteinuric renal diseases. BMC Medical Genomics. 7, 75-014-0075-8.
New health guide. (2014) New Health Guide for Your Everyday Health. [Online]
Available from: http://www.harvardgenerator.com/references/website. [Accessed 02
January 16].
Newman, D., Thakkar, H., Gallagher, H., 2000. Progressive renal disease: does the
quality of the proteinuria matter or only the quantity? Clinica Chimica Acta. 297, 43-
54.
NHS. (2014) Acute Kidney Injury. [Online] Available from:
http://www.nhs.uk/conditions/acute-kidney-injury/pages/introduction.aspx. [Accessed
02 January 16].
Norden, A.G., Flynn, F.V., Fulcher, L.M., Richards, J.D., 1989. Renal impairment in
myeloma: negative association with isoelectric point of excreted Bence-Jones protein.
Journal of Clinical Pathology. 42, 59-62.
Norlander, A.E., Saleh, M.A., Madhur, M.S., 2013. CXCL16: a chemokine-causing
chronic kidney disease. Hypertension. 62, 1008-1010.
Obligado, S., Ibraghimov-Beskrovnaya, O., Zuk, A., Meijer, L., Nelson, P., 2008.
CDK/GSK-3 inhibitors as therapeutic agents for parenchymal renal diseases. Kidney
International. 73, 684-690.
Ongeri, E.M., Anyanwu, O., Reeves, W.B., Bond, J.S., 2011. Villin and actin in the
mouse kidney brush-border membrane bind to and are degraded by meprins, an
interaction that contributes to injury in ischemia-reperfusion. American Journal of
Physiology.Renal Physiology. 301, F871-82.
Opal, S.M. & DePalo, V.A., 2000. Anti-inflammatory cytokines. Chest Journal. 117,
1162-1172.
Ozbek, E., 2012. Induction of oxidative stress in kidney. International Journal of
Nephrology. 2012, .
314
Pacific biomarker (2012). Biomarkers and Acute Kidney Injury (AKI).
Panday, A., Sahoo, M.K., Osorio, D., Batra, S., 2014. NADPH oxidases: an overview
from structure to innate immunity-associated pathologies. Cellular & Molecular
Immunology.
Patient. (2014) Urine Dipstick Analysis. [Online] Available from:
http://patient.info/doctor/urine-dipstick-analysis. [Accessed 02 January 16].
Peake, P.W., O'Grady, S., Pussell, B.A., Charlesworth, J.A., 1999. C3a is made by
proximal tubular HK-2 cells and activates them via the C3a receptor. Kidney
International. 56, 1729-1736.
Peart, J.N. & Gross, G.J., 2006. Cardioprotective effects of acute and chronic opioid
treatment are mediated via different signaling pathways. American Journal of
Physiology.Heart and Circulatory Physiology. 291, H1746-53.
Pelsers, M.M., 2008. Fatty acid‐ binding protein as marker for renal injury.
Scandinavian Journal of Clinical and Laboratory Investigation. 68, 73-77.
Peres, L.A.B., Cunha Júnior, Ademar Dantas da, Schäfer, A.J., Silva, A.L.d., Gaspar,
A.D., Scarpari, D.F., Alves, J.B.F., Girelli Neto, R., Oliveira, Thaís Figueiredo
Teodoro de, 2013. Biomarkers of acute kidney injury. Jornal Brasileiro De
Nefrologia. 35, 229-236.
Pober, B.R., Longoni, M., Noonan, K.M., 2009. A review of Donnai‐ Barrow and
facio‐ oculo‐ acoustico‐ renal (DB/FOAR) syndrome: Clinical features and
differential diagnosis. Birth Defects Research Part A: Clinical and Molecular
Teratology. 85, 76-81.
Pote, A., Zwizinski, C., Simon, E.E., Meleg-Smith, S., Batuman, V., 2000.
Cytotoxicity of myeloma light chains in cultured human kidney proximal tubule cells.
American Journal of Kidney Diseases. 36, 735-744.
Qi, W., Johnson, D.W., Vesey, D.A., Pollock, C.A., Chen, X., 2007. Isolation,
propagation and characterization of primary tubule cell culture from human kidney
(Methods in Renal Research). Nephrology. 12, 155-159.
Ramesh, G. & Reeves, W.B., 2002. TNF-alpha mediates chemokine and cytokine
expression and renal injury in cisplatin nephrotoxicity. Journal of Clinical
Investigation. 110, 835-842.
Rao, R., 2012. Glycogen synthase kinase-3 regulation of urinary concentrating ability.
Current Opinion in Nephrology and Hypertension. 21, 541-546.
Reed, J.C., 2000. Mechanisms of apoptosis. The American Journal of Pathology. 157,
1415-1430.
315
Riss, T.L. & Moravec, R.A., 2005. Cell proliferation assays: improved homogeneous
methods used to measure the number of cells in culture. CELIS, JE Cell Biology: A
Labotatory Handbook.San Diego, CA.: Elsevier. 25-32.
Rodriguez-Iturbe, B., JOHNSON, R.R., Herrera-Acosta, J., 2005. Tubulointerstitial
damage and progression of renal failure. Kidney International. 68, S82-S86.
Ryan, M.J., Johnson, G., Kirk, J., Fuerstenberg, S.M., Zager, R.A., Torok-Storb, B.,
1994. HK-2: an immortalized proximal tubule epithelial cell line from normal adult
human kidney. Kidney International. 45, .
Said, A., Desai, C., Lerma, E.V., 2015. Chronic kidney disease. Disease-A-Month. 61,
374-377.
Saito, A., Sato, H., Iino, N., Takeda, T., 2010. Molecular mechanisms of receptor-
mediated endocytosis in the renal proximal tubular epithelium. Journal of
Biomedicine & Biotechnology. 2010, 403272.
Sanz, A.B., Sanchez-Niño, M.D., Ortiz, A., 2011. TWEAK, a multifunctional
cytokine in kidney injury. Kidney International. 80, 708-718.
Sauvonnet, N., 2013. Phosphoinositide 3-kinase at the crossroad between endocytosis
and signaling of cytokine receptors. Communicative & Integrative Biology. 6, e24243.
Sawada, T., Nagai, J., Okada, Y., Yumoto, R., Takano, M., 2012. Gadolinium
modulates gentamicin uptake via an endocytosis-independent pathway in HK-2
human renal proximal tubular cell line. European Journal of Pharmacology. 684,
146-153.
Scheller, J., Chalaris, A., Schmidt-Arras, D., Rose-John, S., 2011. The pro-and anti-
inflammatory properties of the cytokine interleukin-6. Biochimica Et Biophysica Acta
(BBA)-Molecular Cell Research. 1813, 878-888.
Schena, F. (ed.), Daviso, A. (ed.), Koomans, H. (ed.), Grunfeld, J. (ed.),
Valderrabano, F. (ed.), van der Woude, F. (ed.) and Andreoli, T. (ed.) (2001).
Nephrology. Maidenhead: McGraw-Hill Publishing.
Schmitz, G. & Muller, G., 1991. Structure and function of lamellar bodies, lipid-
protein complexes involved in storage and secretion of cellular lipids. Journal of
Lipid Research. 32, 1539-1570.
Sedeek, M., Nasrallah, R., Touyz, R.M., Hebert, R.L., 2013. NADPH oxidases,
reactive oxygen species, and the kidney: friend and foe. Journal of the American
Society of Nephrology : JASN. 24, 1512-1518.
Sengul, S., Zwizinski, C., Simon, E.E., Kapasi, A., Singhal, P.C., Batuman, V., 2002.
Endocytosis of light chains induces cytokines through activation of NF-&kgr; B in
human proximal tubule cells. Kidney International. 62, 1977-1988.
316
Seron, D., Cameron, J.S., Haskard, D.O., 1991. Expression of VCAM-1 in the normal
and diseased kidney. Nephrology, Dialysis, Transplantation : Official Publication of
the European Dialysis and Transplant Association - European Renal Association. 6,
917-922.
Shalamanova, L., McArdle, F., Amara, A.B., Jackson, M.J., Rustom, R., 2007.
Albumin overload induces adaptive responses in human proximal tubular cells
through oxidative stress but not via angiotensin II type 1 receptor. American Journal
of Physiology.Renal Physiology. 292, F1846-57.
Shaw, G., Morse, S., Ararat, M., Graham, F.L., 2002. Preferential transformation of
human neuronal cells by human adenoviruses and the origin of HEK 293 cells.
FASEB Journal : Official Publication of the Federation of American Societies for
Experimental Biology. 16, 869-871.
Sinha, D., Bannergee, S., Schwartz, J.H., Lieberthal, W., Levine, J.S., 2004.
Inhibition of ligand-independent ERK1/2 activity in kidney proximal tubular cells
deprived of soluble survival factors up-regulates Akt and prevents apoptosis. The
Journal of Biological Chemistry. 279, 10962-10972.
Spitzer, D., Mitchell, L.M., Atkinson, J.P., Hourcade, D.E., 2007. Properdin can
initiate complement activation by binding specific target surfaces and providing a
platform for de novo convertase assembly. Journal of Immunology (Baltimore, Md.:
1950). 179, 2600-2608.
Stadnyk, A.W., 1994. Cytokine production by epithelial cells. FASEB Journal :
Official Publication of the Federation of American Societies for Experimental
Biology. 8, 1041-1047.
Sullivan, D.E., Ferris, M., Nguyen, H., Abboud, E., Brody, A.R., 2009. TNF‐ α
induces TGF‐ β1 expression in lung fibroblasts at the transcriptional level via AP‐ 1
activation. Journal of Cellular and Molecular Medicine. 13, 1866-1876.
Suzuki, C., Isaka, Y., Takabatake, Y., Tanaka, H., Koike, M., Shibata, M., Uchiyama,
Y., Takahara, S., Imai, E., 2008. Participation of autophagy in renal
ischemia/reperfusion injury. Biochemical and Biophysical Research Communications.
368, 100-106.
Takabatake, Y., Kimura, T., Takahashi, A., Isaka, Y., 2014. Autophagy and the
kidney: health and disease. Nephrology, Dialysis, Transplantation : Official
Publication of the European Dialysis and Transplant Association - European Renal
Association. 29, 1639-1647.
Tang, J., Liu, N. and Zhuang, S., 2013. Role of epidermal growth factor receptor in
acute and chronic kidney injury. Kidney international, 83(5), pp.804-810.
Tang, S., Leung, J.C., Abe, K., Chan, K.W., Chan, L.Y., Chan, T.M., Lai, K.N., 2003.
Albumin stimulates interleukin-8 expression in proximal tubular epithelial cells in
vitro and in vivo. The Journal of Clinical Investigation. 111, 515-527.
317
Tang, S., Sheerin, N.S., Zhou, W., Brown, Z., Sacks, S.H., 1999. Apical proteins
stimulate complement synthesis by cultured human proximal tubular epithelial cells.
Journal of the American Society of Nephrology : JASN. 10, 69-76.
Tejera, N., Gómez-Garre, D., Lázaro, A., Gallego-Delgado, J., Alonso, C., Blanco, J.,
Ortiz, A., Egido, J., 2004. Persistent proteinuria up-regulates angiotensin II type 2
receptor and induces apoptosis in proximal tubular cells. The American Journal of
Pathology. 164, 1817-1826.
Terryn, S., Jouret, F., Vandenabeele, F., Smolders, I., Moreels, M., Devuyst, O.,
Steels, P., Van Kerkhove, E., 2007. A primary culture of mouse proximal tubular
cells, established on collagen-coated membranes. American Journal of
Physiology.Renal Physiology. 293, F476-85.
Thurman, J.M. & Renner, B., 2011. Dynamic control of the complement system by
modulated expression of regulatory proteins. Laboratory Investigation. 91, 4-11.
Thurman, J.M. & Holers, V.M., 2006. The central role of the alternative complement
pathway in human disease. Journal of Immunology (Baltimore, Md.: 1950). 176,
1305-1310.
Toblli, J.E., Bevione, P., Di Gennaro, F., Madalena, L., Cao, G., Angerosa, M., 2012.
Understanding the mechanisms of proteinuria: therapeutic implications. International
Journal of Nephrology, 2012.
Tojo, A. & Kinugasa, S., 2012. Mechanisms of glomerular albumin filtration and
tubular reabsorption. International Journal of Nephrology, 2012.
Tsaroucha, A.K., Chatzaki, E., Lambropoulou, M., Despoudi, K., Laftsidis, P.,
Charsou, C., Polychronidis, A., Papadopoulos, N., Simopoulos, C.E., 2008. Megalin
and cubilin in the human gallbladder epithelium. Clinical and Experimental Medicine.
8, 165-170.
Vaidya, V.S., Ferguson, M.A., Bonventre, J.V., 2008. Biomarkers of acute kidney
injury. Annual Review of Pharmacology and Toxicology. 48, 463-493.
Van Der Biest, I., Nouwen, E.J., Van Dromme, S.A., De Broe, M.E., 1994.
Characterization of pure proximal and heterogeneous distal human tubular cells in
culture. Kidney International. 45, 85-85.
Van der Hauwaert, C., Savary, G., Gnemmi, V., Glowacki, F., Pottier, N., Bouillez,
A., Maboudou, P., Zini, L., Leroy, X., Cauffiez, C., 2013. Isolation and
characterization of a primary proximal tubular epithelial cell model from human
kidney by CD10/CD13 double labeling. PloS One. 8, e66750.
van Swaay, D., 2013. Microfluidic methods for forming liposomes. Lab on a Chip.
13, 752-767.
318
van Timmeren, M.M., Bakker, S.J., Vaidya, V.S., Bailly, V., Schuurs, T.A., Damman,
J., Stegeman, C.A., Bonventre, J.V., van Goor, H., 2006. Tubular kidney injury
molecule-1 in protein-overload nephropathy. American Journal of Physiology.Renal
Physiology. 291, F456-64.
Vega-Avila, E. and Pugsley, M.K., 2011. An overview of colorimetric assay methods
used to assess survival or proliferation of mammalian cells, Proc West Pharmacol
Soc, 2011, ppe4.
Verroust, P.J. & Christensen, E.I., 2002. Megalin and cubilin--the story of two
multipurpose receptors unfolds. Nephrology, Dialysis, Transplantation : Official
Publication of the European Dialysis and Transplant Association - European Renal
Association. 17, 1867-1871.
Villeneuve, L.M., Reddy, M.A., Lanting, L.L., Wang, M., Meng, L., Natarajan, R.,
2008. Epigenetic histone H3 lysine 9 methylation in metabolic memory and
inflammatory phenotype of vascular smooth muscle cells in diabetes. Proceedings of
the National Academy of Sciences of the United States of America. 105, 9047-9052.
Wada, T., Tomosugi, N., Naito, T., Yokoyama, H., Kobayashi, K., Harada, A.,
Mukaida, N., Matsushima, K., 1994. Prevention of proteinuria by the administration
of anti-interleukin 8 antibody in experimental acute immune complex-induced
glomerulonephritis. The Journal of Experimental Medicine. 180, 1135-1140.
Wan, J., Fukuda, N., Endo, M., Tahira, Y., Yao, E., Matsuda, H., Ueno, T.,
Matsumoto, K., 2007. Complement 3 is involved in changing the phenotype of human
glomerular mesangial cells. Journal of Cellular Physiology. 213, 495-501.
Wang, P.X. & Sanders, P.W., 2007. Immunoglobulin light chains generate hydrogen
peroxide. Journal of the American Society of Nephrology : JASN. 18, 1239-1245.
Wang, Y., Chen, J., Chen, L., Tay, Y.C., Rangan, G.K., Harris, D.C., 1997. Induction
of monocyte chemoattractant protein-1 in proximal tubule cells by urinary protein.
Journal of the American Society of Nephrology : JASN. 8, 1537-1545.
Wang, Y., Rangan, G.K., Tay, Y.C., Wang, Y., Harris, D.C., 1999. Induction of
monocyte chemoattractant protein-1 by albumin is mediated by nuclear factor kappaB
in proximal tubule cells. Journal of the American Society of Nephrology : JASN. 10,
1204-1213.
Wieser, M., Stadler, G., Jennings, P., Streubel, B., Pfaller, W., Ambros, P., Riedl, C.,
Katinger, H., Grillari, J., Grillari-Voglauer, R., 2008. hTERT alone immortalizes
epithelial cells of renal proximal tubules without changing their functional
characteristics. American Journal of Physiology.Renal Physiology. 295, F1365-75.
Williams, G. and Mallick, N. (1994). Color atlas of renal diseases. 2nd ed.
Barcelona: Wolfe.
319
Wilmer, M.J., Saleem, M.A., Masereeuw, R., Ni, L., van der Velden, Thea J, Russel,
F.G., Mathieson, P.W., Monnens, L.A., van den Heuvel, Lambertus P, Levtchenko,
E.N., 2010. Novel conditionally immortalized human proximal tubule cell line
expressing functional influx and efflux transporters. Cell and Tissue Research. 339,
449-457.
Wu, Y., Connors, D., Barber, L., Jayachandra, S., Hanumegowda, U.M., Adams, S.P.,
2009. Multiplexed assay panel of cytotoxicity in HK-2 cells for detection of renal
proximal tubule injury potential of compounds. Toxicology in Vitro. 23, 1170-1178.
Wu, T., Xie, C., Wang, H.W., Zhou, X.J., Schwartz, N., Calixto, S., Mackay, M.,
Aranow, C., Putterman, C., Mohan, C., 2007. Elevated urinary VCAM-1, P-selectin,
soluble TNF receptor-1, and CXC chemokine ligand 16 in multiple murine lupus
strains and human lupus nephritis. Journal of Immunology (Baltimore, Md.: 1950).
179, 7166-7175.
Xu, Y., Shen, X., Ma, R., Jiang, W., Zhang, W., 2014. Protection of renal tubular
epithelial cells from apoptosis by Cyr61 expression under hypoxia. Cell Biology
International Reports. 21, 47-52.
Yamahara, K., Kume, S., Koya, D., Tanaka, Y., Morita, Y., Chin-Kanasaki, M.,
Araki, H., Isshiki, K., Araki, S., Haneda, M., Matsusaka, T., Kashiwagi, A.,
Maegawa, H., Uzu, T., 2013. Obesity-mediated autophagy insufficiency exacerbates
proteinuria-induced tubulointerstitial lesions. Journal of the American Society of
Nephrology : JASN. 24, 1769-1781.
Yang, B., El Nahas, A.M., Thomas, G.L., Haylor, J.L., Watson, P.F., Wagner, B.,
Johnson, T.S., 2001. Caspase-3 and apoptosis in experimental chronic renal scarring.
Kidney International. 60, 1765-1776.
Yang, Y., Lin, S., Chuang, L., Guh, J., Liao, T., Lee, T., Chang, W., Chang, F., Hung,
M., Chiang, T., 2007. CD36 is a novel and potential anti‐ fibrogenic target in
albumin‐ induced renal proximal tubule fibrosis. Journal of Cellular Biochemistry.
101, 735-744.
Yang, D.H., Cai, K.Q., Roland, I.H., Smith, E.R., Xu, X.X., 2007. Disabled-2 is an
epithelial surface positioning gene. The Journal of Biological Chemistry. 282, 13114-
13122.
Ye, Y., Xiao, Y., Wang, W., Gao, J.X., Yearsley, K., Yan, Q., Barsky, S.H., 2012.
Singular v dual inhibition of SNF2L and its isoform, SNF2LT, have similar effects on
DNA damage but opposite effects on the DNA damage response, cancer cell growth
arrest and apoptosis. Oncotarget. 3, 475-489.
Yu, Y., Jin, H., Holder, D., Ozer, J.S., Villarreal, S., Shughrue, P., Shi, S., Figueroa,
D.J., Clouse, H., Su, M., 2010. Urinary biomarkers trefoil factor 3 and albumin enable
early detection of kidney tubular injury. Nature Biotechnology. 28, 470-477.
320
Yuseff, M.I., Farfan, P., Bu, G., Marzolo, M., 2007. A cytoplasmic PPPSP motif
determines megalin's phosphorylation and regulates receptor's recycling and surface
expression. Traffic. 8, 1215-1230.
Zhou, W., Marsh, J.E., Sacks, S.H., 2001. Intrarenal synthesis of complement. Kidney
International. 59, 1227-1235.
Zhuang, S. and Liu, N., 2014. EGFR signaling in renal fibrosis. Kidney international
supplements, 4(1), pp.70-74.
Zhu, S., Jin, J., Wang, Y., Ouyang, Z., Xi, C., Li, J., Qiu, Y., Wan, J., Huang, M.,
Huang, Z., 2012. The endoplasmic reticulum stress response is involved in apoptosis
induced by aloe-emodin in HK-2 cells. Food and Chemical Toxicology. 50, 1149-
1158.
Zoja, C., Morigi, M., Remuzzi, G., 2003. Proteinuria and phenotypic change of
proximal tubular cells. Journal of the American Society of Nephrology : JASN. 14
Suppl 1, S36-41.