Joseph F. Thiel

Kuztown University of Pennsylvania Professional Seminar Summer 2016

Major Concentration: Professional WritingMinor Concentration: LiteratureGraduation Date: Summer 2016

1

STATEMENT OF PURPOSE

When I was in grade school, I always found myself writing fictional stories for my fellow classmates in between classes. I never would have imagined that I would have come this far with my writing to now have a degree in professional writing. Kutztown University exposed me to many different styles of writing which I can now use successfully in a given circumstance. I am always up for the challenge when given a new way of ap-proaching writing such as in Travel Writing, Sports Writing, and Technical Writing. With these classes among many others, I have developed my writing abilities to a profes-sional level in the working world.

This portfolio will showcase my best work during my time in the professional writing pro-gram at Kutztown University. I have also included some of my best writing samples dur-ing my internship at Saint Katherine of Siena Grade School located in Philadelphia, PA.

The pieces of writing shown in this portfolio will show the world that I can make the tran-sition from a student with a dream to a successful writer in a working school environ-ment. I feel much gratitude for all of the professors and faculty members at Kutztown University who helped guide me during my journey of becoming an aspiring writer.

2

TABLE OF CONTENTSStatement of Purpose…………………………………….. 2

Resume…………………………………………………….. 4

Internship Work

Parent Student Handbook………………………….. 6

Resource Room Packet…………………………….. 39

Photo Release Form………………………………… 46

Professional Writing Work

Travel Feature……………………………………….. 48

Sequence 2………………………………………….. 53

Sports Prediction……………………………………. 73

3

To contribute my refined, professional, and creative writing skills through your organization. I can be an asset with my interpersonal and leadership skills to your team.

BA Kutztown University of PennsylvaniaMajor in Professional Writing Minor in LiteratureGPA: 3.2, Deans List: Fall 2014-2016

Organized, Problem Solving, Word Processing, Powerpoint, Creative Writing, Persuasive Writing, Argumentative Writing, Informative Writing

11th Annual KU Composition Conference - Spring 2014“Exploring the Lines in Advanced Composition”Read and Spoke on different argumentative topics

The Keystone Newspaper - Kutztown University, Kutztown PA — Spring 2016 Sports Writer Contributor Work published in the university’s newspaper

Saint Katherine of Siena, Philadelphia PA — May 2016 - July 2016 Writing Intern

• Assisted the Advancement Director in updating the school website and social media outlets• Conferred, consulted and rewrote the school handbook• Wrote grant application for school library

Saint Katherine Marketing and Development Committee — June 2016 - Present Volunteer

• Promote the mission of Saint Katherine of Siena through social media• Confer with committee members on best marketing strategies

MTS Software Solutions, Morristown NJ — May 2014 - August 2015 Computer Data Entry/Document Scanner

• Organized and scanned company files• Gathered documents from the tri-state area

Rev. Paul M. Kennedy - Pastor at Saint Katherine of Siena ParishPhone: 215.637.7548E-Mail: pmkenn18@aol.com

Mrs. Colleen M. Wisler - Advancement Director at Saint Katherine of Siena Elementary SchoolPhone: 267.449.2539E-Mail: cwislersks@gmail.com

Judi Mclane-Neeld- Director of Development, Foundation for Catholic EducationPhone: 610.793.8503E-Mail: jneeld@foundationforcatholiceducation.org

Mr. Eric Smith - Manager at MTS Software SolutionsPhone: 856.979.2539

215.485.6960 josephthieljoe@aol.comJOSEPH THIEL

4220 Lackland Place Philadelphia, PA 19114

Objective

Education

Skills

Achievements & Awards

Experience

References

4

Internship Work

During the summer of 2014, I was given the opportunity to intern in a school environment at Saint Katherine of Siena in Philadelphia, Pennsylva-nia. The school has over 7,000 alumni and takes pride in teaching Catholic values to everyone in the community.

The first work I would like to present is the Parent/Student handbook for the 2016-2017 school year that I wrote during the course of my internship. The Parent/Student handbook had not been updated since the 2012-2013 school year, so the principal and advancement director decided it was time to update it. When designing the new document, I found it to be most chal-lenging when I was unsure of current school policies to incorporate in the handbook and no faculty member was around to clarify any questions I had. The target audience of the Parent/Student handbook are families who belong to the school as well as potential families who may consider en-rolling their child(ren) to the school in the near future. Parents and guardians need to feel comfortable about how the school is run on a day to day basis and giving them a set of rules and regulations is the best way to handle that. A PDF of the handbook was also added to the school’s web-site, which I redesigned over the summer as well. This example of my in-ternship work shows my ability to design a longer document which readers can feel comfortable reading all at once or skipping ahead to an area they may have a question about.

5

SaintKatherineofSienaCatholicSchoolPhiladelphia,PA

�

“BewhoGodmeantyoutobeandyouwillsettheworldon>ire.”

-StKatherineofSiena

Parent/StudentHandbook2016-2017

�16

SaintKatherineofSienaSchool9738FrankfordAvenuePhiladelphia,PA19114

(215)637-2181Fax:(215)637-8803

www.sksgradeschool.org

Parent/StudentHandbook

ThishandbookcontainscertainpoliciesandproceduresofSaintKatherineofSienaSchool.SaintKatherineofSienaSchoolmaychangeanyofitspoliciesand

proceduresandapplythemascircumstancesdictate.Ifyouhaveaquestionaboutaparticularpolicyorprocedure,pleasecontacttheschool.

STUDENTSANDPARENTSMUSTACCEPTANDABIDEBYSAINTKATHERINEOFSIENASCHOOLPOLICIESANDPROCEDURESINORDERFORTHESTUDENTTOATTENDSAINTKATHERINEOFSIENASCHOOL.

MISSIONSTATEMENT

St.KatherineofSienaSchoolisafaithcommunitydedicatedtohighacademicstandardsandstronggospelvalues.FamilieschooseSt.KatherineofSienaSchoolsothattheir

childrenmaysafelygrowintheloveofGodandservicetotheirneighbor.WiththeHolyFamilyasourguide,weprepareourstudentstosucceedonalllevelsinthepresent,for

thefuture.

SaintKatherineofSienaSchoolisafullandofficialmemberintheMiddleStatesAssociaBonofCollegesandSchools.

�27

AGREEMENTBETWEENTHEHOMEANDSCHOOL

Theadministra-onandfacultyofSaintKatherineofSienaSchoolrecognizeandrespecttheuniquenessofeachfamilywhochoosethisschool.Asuccessfuleduca-onalexperienceatSaintKatherineofSienaisbuiltonahealthy

agreementbetweenthehomeandschool.

Werecognizeourparents/guardians“arethenaturalandirreplaceableagentsintheeduca9onoftheirchildren”(TheReligiousDimensionofEducaBonina

CatholicSchool,VaBcanDocument),theschoolstaffrespectsfamiliesandhopestohavethesamerespectfromthefamilieswhomakeupourSaintKatherineof

Sienafaithcommunity.

However,whenthisagreementisinconsolablybrokenandaIerthoroughreviewbyboththepastorandprincipal,theschoolreservestherighttorequiretheparent/guardiantowithdrawhisorherchildfromSaintKatherineofSiena

School.

Someexamplesthatauthorizethisextremeac-oninclude:

• Demandingthetermina9onofateacher/facultymember,oranyaLempttoorganizeparentstohaveafacultymemberremoved.

• Underthepolicyoftheschool,theprincipalandpastormakethefinaldecisiononastudent’sacademicplacement.Theagreementbetweentheschoolandparent/guardianwillbeconsideredbrokeniftheparentarguesagainstthisdecisioninanaggressivemanner.

• Therefusaltoaccepttheschool’sdecisionregardingwhetherornottheycanmeettheneedsofachildwithspeciallearningassistance.

• Pos9ngnega9ve,demeaning,orderogatorycommentsonanysocialmediaplaRormaboutSaintKatherineofSienaSchool.

• Dis9nctrefusaltofollowapolicyoftheschoolwhichtheparent/guardianagreedtofollowthroughthesigningoftheHandbookAgreementformofthenewschoolyear.

PHILOSOPHY

ThepurposeofSt.KatherineofSienaSchoolistoprovideaqualityfaithbasededuca9oninordertoproducehighachievementsfromourstudents.Ourschoolcentersonprideandhasresultedinourstudentsreceivingconsiderablerecogni9onforourschoolthroughacademicsandextracurricularac9vi9es.Itisourgoaltocon9nueworkingtogetherasparents,teachers,staff,andadministra9on,sowecanhelpourchildrenbesuccessfulandreachtheirhighestpoten9al.

�38

AtSaintKatherineofSienaSchool,webelieve:• CatholicschoolistherolemodelofCatholicfaithandvalues.• WepromoteCatholiceduca9onineveryaspectoftheschool’sac9vi9es.• Wecreateaposi9veacademicenvironmentforstudentsandfaculty.• Weshareideastogrownotjustacademicallybutalsospiritually.• Wehelpstudentstobecomesuccessfulandac9vemembersoftheparish

community.

THEHISTORYOFST.KATHERINEOFSIENASCHOOL

St.KatherineofSienaParishwasestablishedonJune19,1922bytheArchdioceseofPhiladelphiatohelpfilltheneedofthegrowingpopula9oninNortheastPhiladelphia.Ourschoolwasestablishedin1938,whentheSistersoftheSacredHearttookourstudentsintotheEdenHallChurch.OnJanuary5,1941,thecornerstoneofourfirstschoolbuilding,atwostorystructureonConventLane,wasbuiltbyCardinalDougherty.InSeptember1961,ourcurrentschoolbuildingopeneditsdoorsforthefirst9me.AllofourstudentshadfinallyaLendedschoolonParishpropertyforthefirst9meinitshistory.InSeptemberof1970,theaddi9onofasecondfloortotheschoolwascompleted.

Sincethat9me,ourschoolhasadvancedinmanywaysasoursocietyhaschanged.Wearenowequippedwithtransportablelaptops,smartboardsineveryclassroom,wirelessinternet,Chromebooks,iPads,andarecentlyrefurbishedcomputerlab.OurCYOhasgrownrapidlyandnowincludessevensports.Astheworldevolves,sodoweatSt.KatherineofSienaSchool.Wearededicatedtoacademicexcellencehere,butmostimportantly,Christisatourcenter;weareabondedcommunityoffaith.

�49

AcademicPolicy

Grading

Class par9cipa9on, home study, and test averages, as well as credit for projects invarious subjects, are combined in order to obtain a report card average. This averageshows the parent/guardian and the student what steps are necessary for furtherprogress.

Ifparentsarenot receiving testpapersorotheracademic communica9onsduring themarkingperiod,itistheresponsibilityoftheparenttocontacttheteacher.

Parentswillbeno9fiedapproximatelyonemonthbeforereportcardsare issued if thestudent is failing in any subject. Parents are also encouraged to contact the teacherconcerningtheconduct,progress,andeffortoftheirchild.

Reportcardsareissuedthree9mesayear.Parentsarerequiredtosignthereportcardandreturnittoschoolassoonaspossible.

Criteriaforhonors

Grades1-3:

Highhonors–“VG”oraboveinallsubjectareasand“3”ineffortandconductHonors–“G”oraboveinallsubjectareasand“3”ineffortandconduct.

Grades4-8:

Highhonors–92oraboveinallsubjectareasand“3”oraboveinmusic,computers,art,effort,andconductHonors–85orabove inallsubjectareasand“3” inmusic,computers,art,effort,andconduct.

Op-onC

Asabackup,teacherspostassignments,classroomnewsandremindersontheOp9onCwebsitegiventostudentsatthebeginningoftheschoolyear.

Gradua-on–Grade8

Inorder tograduate fromSaintKatherineof Siena school, the following requirementsmustbemet:

• Thestudentmustachieveageneralaverageof70.0.• A studentwhohas earned a passing general average, but has received afinal

gradeof“I” (unsa9sfactory) inconductmayaLend thegradua9on,butwillberequiredtositwithhisorherparentsratherthantheclass.

• Allfinancialobliga9onsmustbeseLled.

�510

Non-Promo-on

Each student is expected to use and develop the God-given talents in the academicprogrambyconsistenteffortandmeaningfulapplica9on.Therefore:

• InsufficientadvancementineitherMathorReadingorbothindicatestheneedtorepeatingrades1-3.

• Ifachildevidencesemo9onalimmaturity,itisadvisabletorepeatthegrade.• If the general average is below 70 on the final report card, the studentmust

repeatthegrade.• Eighth grade students are not permiLed to repeat in Saint Katherine of Siena

School.• Ifan8thgradestudentfailsMath,orELA,he/shemustaLendtheArchdiocesan

HighSchoolSummerSchoolPrograminordertobeadmiLedinSeptember.

AccidentsandIllnesses

Parents will be no9fied immediately in the event of sudden illness or accidents of aseriousnature. If theparentcannotbereached, theemergencycontactwillbecalled.PLEASE BE SURE THE OFFICE AND HOMEROOM TEACHER HAVE THE CURRENTINFORMATIONFORYOURCHILD’SEMERGENCYCONTACT.

Emergency/IllnessForms

TheEmergency/Illnessformisthebestmeansofcontac9ngparentsincaseofachild’semergencyorillness.Itisessen9althattheformcontainstwoalternatenamesoflocalpersons to be called in the event of an emergency or illness. The school should beno9fiedimmediatelywheneveranyinforma9onontheemergency/illnessformchanges.This is to ensure the physical safety of the child. Whenever possible, parents areresponsiblefortranspor9ngtheillorinjuredchildtohis/herhome,doctor,orhospital.

DIRECTIONSFORSTUDENTABSENCE:

• Keepyourchildathomeun9lhe/sheiscompletelywell.• Onthemorningofyourchild’sabsence,call theschoolofficeat215-637-2181

before 8:30 AM to report the absence. Leave a message sta9ng your child’sname,grade,roomnumber,andreasonforabsenceontheansweringmachine.Also,atthis-me,pleasestatewhethersomeonewillcometoschooltopickupthe student’s homework for that day. Homework for absent students isavailable only a`er three consecu-ve days of schoolmissed. If your child isregisteredinourC.A.R.E.SProgram,pleaseinformusontheansweringmachinethatyourchildwillnotbeaLendingtheprogramthatdayduetoabsence.Thesecretaryrelaysallinforma9ontotheappropriatestaffmembers.

• If you informusofyour inten9on topickupyourchild’shomeworkwhenyoureport the student’s absence in the morning, homework, books, etc. will beavailable to you in themainofficebetween2p.m.and3p.m. Pleasedonotexpectyourchild’shomeworktobeready in theofficebefore2p.m.or ifyou

�611

have not informed us at the 9me of the absence report you make in themorning. We will not interrupt class to get homework for students whoseparents have not requested it at the appropriate 9me and in the appropriatemannerasstatedabove.

• Onthedayofyourchild’sreturntoclassaIeran illnessorotherabsence,he/shemustpresentfromhis/herparent/guardiantohis/herhomeroomteacherawriLenabsencenotesta9ngthe lengthof theabsenceandthereason for theabsence.IfastudentreturnswithoutawriLenparentalexcuse,theteacherwillbeforcedtocodetheabsenceasparentalneglect.Ifastudenthasbeenabsentdue to illnesson threeormore consecu-vedays, adoctor’s cer-ficatemustalsobepresentedwiththeparentalnote.

PhysicalExamina-on

Students must have a complete physical examina9on upon entry into school(kindergartenorfirstgrade)andingradesix.StudentsnewtoPAschoolsmusthave a physical exam if the student’s record does notmeet PA requirements.Parents/guardians are urged to take their children to their own physician forexamina9onstoprovidecon9nuityofcare.Yourfamilyphysicianisfamiliarwithyour child and thus is beLer able to detect anyphysical changes.Appropriateformscanbedownloadedfromtheschoolwebsite.

DentalExamina-on

Studentsmusthaveadental examuponentry into kindergartenorfirst gradeandingradesthreeandseven.Formsareavailableontheschoolwebsite.

Allergies

Parents/guardians of childrenwith known insect/food allergiesmust alert theschool and provide medica9on with wriLen instruc9ons for emergencytreatment.

SymptomsofaSickChild

Thereare9meswhenyoumaynotbesurewhetheryoushouldsendyourchildtoschoolorkeepthemhome.Hereaareafewsymptomsthatmaymeanyourchildissickandshouldstayhome:

• Fever/Chills• Rash• Runningorinflamedeyes• AbdominalPain• Vomi9ng• Diarrhea• SoreThroat

�712

• EnlargedGlands• ExcessiveCoughing

A child should remain at home at least 24 hours with no fever or vomi9ngfollowing an illness. Remember to no9fy the school that your child will beabsent.

Byfollowingtheseguidelines,youwillprotectnotonlythehealthofyourchild,butthehealthofhis/herclassmatesandtheschoolstaffaswell.

AdmissionPolicy/Enrollment

Ourschooladmitsstudentsofanyrace,color,creed,na9onalorethnicorigintoalloftherights,privileges,programsandac9vi9esgenerallyaccordedormadeavailable to itsstudents.SaintKatherineofSienaSchooldoesnotdiscriminateonthebasisofrace,color,na9onalorethnicorigin intheadministra9onof itseduca9onal policies, its admission policy, or in any school-administeredprogram.

Our school endeavors to accommodate students with special needs as theschool’s resourcesand capabili9es reasonablypermit. SaintKatherineof SienaSchool reserves the right to decline admission or to impose reasonablecondi9onsofaLendancewherecircumstanceswarrantsuchac9on.

ToenterSaintKatherine’sPre-Kprogram,achildmustbethreebySeptember1st.AchildwhoisfiveyearsoldbySeptember1stiseligibleforkindergarten.Toenter1stgrade,achildmustbesixbySeptember1st.

Thefollowingformsarerequiredforregistra-on:

• OriginalBirthCer9ficate• OriginalBap9smalCer9ficate (UnlessBap9zedat St.Katherineornon-

Catholic• OriginalSocialSecurityCard• ProofofResidency(Photo)• OriginalCustodyPapers(ifapplicable)• TransferslipfromanypreviousschoolthestudentmayhaveaLended• Medicalrecords-Immuniza9onisrequiredasacondi9onofaLendance

atanypublicorparochialschool.

Therequiredvaccina-onsare:

• Hepa99sB–Threedoses• DiphtheriaandTetanus– Fourdoses,onedoseadministeredaIer the

fourthbirthday

�813

• Poliomyeli9s–Threedoses• Measles,Mumps,Rubella–Twodoses• Varicella(ChickenPox)–TwodosesorwriLenverifica9onofoccurrence

ofChickenPox• 7th grade students only: Meningococcal Conjugate (MCV) & Tdap

(Tetanus,diphtheria,acellularpertussis–Onedose.

Familiesregisteredinourschoolarerequiredtoregisterannually.Registra9oninforma9onforthefollowingyearisforwardedtoeachfamilythroughtheschoolcommunica9onchannelsinFebruarypriortothenextschoolyear.Tui9onfeesandnon-refundableregistra9onfeesarepublishedinFebruary.Allfinancialobliga9onsmustbecurrentbeforeregistra9onforthenextschoolyearcanbeprocessed.

Theenrollmentprocess(forstudentsnewtoSKS)isongoing,andcanbedoneany9methroughouttheen9reyear.Theprocessbeginsbycommunica9ngwithourAdvancementDirector,Mrs.Wisler.Uponreviewofaplacementtestandnecessarypaperwork,thefamilywillbecontactedastowhetherornottheavailablespaceandappropriateacademicsesngisavailableforthechild(ren).

AcceptableUsePolicyforTechnology

ThefollowingareunacceptableusesoftechnologyandSaintKatherineSchool:

• Usersmustnotusetechnologytoharass,threaten,deceive,in9midate,offend,embarrass,orannoyanyindividual.

• Users must not post, publish, or display any defamatory, inaccurate, violent,abusive, profane or sexually oriented material. Do not use obscene, profane,vulgar,rude,orthreateninglanguage.Donotknowinglyorrecklesslypostfalseinforma9onaboutanypersons,students,stafforanyotherorganiza9on.

• Usersmustnotuseaphotographorimageofanystudent,oremployeewithoutexpressed permission of that individual and the school’s principal.Usersmustalso not use school equipment to create any site, post any photo, or image/videoofanotherexceptwiththeexpressedpermissionoftheindividualandtheschool’s principal. Maintaining or pos9ng material to a website or blog thatthreatensa likelihoodof substan9aldisrup9on in school, includingharmingorinterfering with the rights of other students to par9cipate fully in school orextracurricularac9vi9es isaviola9onof theAcceptableUsePolicyandsubjecttothedisciplinarymeasurefoundherein.

• Usersmust not aLempt to break through the school’s security system, guesspasswords,or inanywayaLempttogainaccesstosecuredresources,anotherperson’sfiles,oranotherperson’spassword.

• Usersmustnot install,move,delete,download,upload,reconfigure,ormodifyanysoIwareorfilesonschoolequipmentwithoutpermission.

• Usersmustnotmove,repair,reconfigure,modify,oraLachexternaldevicestothesystemswithoutpermission.

�914

• Usersmustnotdeliberatelyvisitasiteknownforunacceptablematerialoranymaterial that is not in support of educa9onal objec9ves. Students must notaccess entertainment sites, for example social networking sites such asfacebook.comor twiLer.comor gaming sites, except for educa9onal purposesunderteachersupervision.

• Usersarenottoplagiarizecontentandmaynotpresenttheworkofanotherastheirownwithoutproperlyci9ngthatwork.

• Users must not violate license agreements, copy disks, CD-ROMS, or otherprotectedmedia.Usersmustnotuse technology forany illegalac9vity.Useoftheinternetforcommercialgainsorprofits isnotallowedfromaneduca9onalsite.

Repor-ng: Users must report immediately any damage or change to theschool’shardware/soIwarethatisno9cedbytheuser.ElectronicDevices:Usersmustadheretolocalschoolpolicyregardingtheuseof addi9onal electronic devices including but not limited to personal devices:calculators, gaming devices, cellular phones, and iPads. Access will bedeterminedby theadministratorof the school. The school’s technologypolicyregarding authoriza9on, use, responsibility, integrity, intellectual property, andmonitoringwillbeappliedtothesedevices.

Administra-ve Rights: The Office of Catholic Educa9on or the schooladministra9onatany9memayaddaddi9onalrulesandrestric9ons.Theschoolhastherighttomonitorbothstudentandemployeeuseofschoolcomputers.

Viola-on of the above ruleswill be dealtwith by the administra-on of theschool.Viola-onoftheserulesmayresultinanyorallofthefollowing:

• Loss of use of the school network, computers and soIware, includinginternet access. The student will be expected to complete work on anon-networked,stand-alonecomputersystem.

• Issuanceofdemerits/deten9ons,ifapplicable.• Disciplinary ac9on including, but not limited to, dismissal and/or legal

ac9onbytheschool,civilauthori9es,orotherinvolvedpar9es.

Arrival/Dismissal

Childrenwill have supervision in the schoolbuildingat7:30a.m.The school isnotheldresponsibleforstudentswhoarrivepriorto7:30a.m.

DailySchedule:

Monday-Thursday PK3/PK4 7:50a.m.to2:40p.m.

1stto8th 7:50a.m.to2:50p.m.

Friday PK3/PK4 7:50a.m.to2:15p.m.

�1015

1stto8th 7:50a.m.to2:30p.m.

AMCARESRUNSFROM7:00A.M.TO7:30A.M.

DropOff:

PreK3to2ndGrade McBrideHall

3rdGradeto8thGrade FrontLot

NOCARSONFRANKFORDAVENUEORINFRONTLOT!

Lateness

Theofficialschooldaybellringsat7:50a.m.Astudentisconsideredlateifhe/sheisnotin the lineby thatbellor inside in thebuildingwhenweatherdoesnotpermit.A latestudentmustreporttothemainofficewiththeirparent/guardianforalatepass.

Consistentandunexcusedlateness(noparentinvolvementviaanotetoschoolorcall)maybereportedtotheDHSforparentalneglect,asmandatedbystatelaw.Unexcusedlateness impactsaperfectaLendance recordandprohibitsa student fromreceivingaperfectaLendancecer9ficateattheendoftheyear.

EarlyDismissal

Theparentorthepersonsenttopickupthestudentmustsignthestudentout inthefrontoffice.Iftheparent/guardianwillnotbethepersonpickingupthestudent,pleaseincludeinyourwriLennote,thenameofthepersonwhowillbepickingupthestudent.

Athle-cs

Saint Katherine’s CYO can be found on their Facebook page for any informa9onregardingSaintKatherineofSienasports.TheCYOisaself-suppor9ngorganiza9onthatisindependentfromtheschool.

AeendancePolicy

Regular aLendance at Saint Katherine of Siena School greatly impacts our student’sacademicdevelopment. The total amountof days/instruc9onal hours that school is insessionisprescribedbytheCommonwealthofPennsylvaniaandfollowedbytheschoolsintheArchdioceseofPhiladelphia.

Students who are absent more than 25 days throughout the school year will be prohibited fromentering thenextgradeunless thestudent isenrolled inanapproved

�1116

summer school program for one or two subjects and successfully completes thecourse(s). The school will make the recommenda9on/decision as to the number of coursesrequiredbeforethestudentmayreturntoschoolinSeptember.

Theonlyexcep9onofanabsenceisaserioushealthissue,documentedbyadoctor, inconsulta9onwithourschoolnurse.Thenumberofdaysabsentinthatcaseisviewedas“excused”.

BusTransporta-on/Conduct

All students using bus transporta9on to or from Saint Katherine of Siena schoolmustreadandsignthebuscodeofconduct.Failuretocomplywithanyoftheruleswillresultinstudentlosingbusprivileges.

Calendar

TheSaintKatherineofSienaschoolcalendar is tenta9veandsubject tochangeduringthecourseoftheschoolyear.

C.A.R.E.S.

SaintKatherineofSienaoffersabeforeandaIerschoolprogram(ChildrenAreReceivingExtendedServices).Ourgoalistoprovideasafeenvironmentforstudentswithworkingparentsandins9llChris9anvaluesthroughmeaningfulinterac9onwiththechildren.

C.A.R.E.S. has separate policies and procedures from the school which can be foundupontalkingtothedirectoroftheC.A.R.E.S.program,HeatherOwens.

HoursofService

A.M.Services 7:00-7:30

P.M.Services 3:00-6:00

Celebra-ons

Studentsmay bringMunchkins, cupcakes, or fruit to celebrate their birthday. Parentsshould consult with the teacher before making any birthday arrangements in theclassroomforthechild.

Please do not bring pizza or juice for the whole class. Time does not warrant theadministeringoffood/drinkstothestudents.

*Pleasenotethatsomestudentshavefoodrelatedallergies.

�1217

CellPhonePolicy

Cell phones may be brought to Saint Katherine of Siena school under the followingcondi9ons:

• Studentsmust hand in their phone to the teacher at the beginning of eachschoolday.

• Phonesmustbekept inthestudent’sbookbagintheOFFposi9onduringtheschoolday.

• 7thand8thgradestudentsmustabidebythecellphonecontractthattheysignatthebeginningoftheschoolyear.

• Phonesmaynotbeusedfortakingpictures, textmessaging,orplayinggamesduringtheschoolday.

• Studentsmaynotpostanypicturestakeninschooltosocialmediasites.• Parentsshouldnottextastudentduringtheschoolday, instead,callthemain

officeandthemessagewillberelayedtoyourchild.

Sincephotoreleaseformsarerequiredbeforetakingpicturesofstudents,studentsareprohibitedfromusingacamera,cellphone,oranyotherpicturetakingdevicetotakeapictureofanotherstudent.Ifanelectronicdeviceisheardorseenbyateacher/facultymember, itwill be given to the teacher/principal un9l a conversa9on is hadwith theparent/guardian.

ChangeinChild’sTransporta-on

• Inthecaseofchangingthetransporta9onofachildto/fromSaintKatherineofSienaSchool,anotemustbesenttoachild’steacher.

• Youmustalsocalltheschoolofficeaheadof9mewiththenameofthepersonwithwhichyourchild is supposedtogohomewith in theeventofasitua9onthatwouldpreventtheparent/guardianfrompickingupthechild.

ChangeofName,Address,Telephone

Changeofnamesofparentsandchild(ren),address,maritalstatus,telephonenumbers,andworktelephonesshouldbereportedtoboththeofficeandtheclassroomteacher.IMMEDIATELY. This is very important both in case of emergency and in keeping ourrecordsup-to-date.Emergencycontactsarevery importantandmustbedifferentthantheparent/guardian.

Curriculum

TheacademicprogramofSaintKatherineofSienaSchoolonaCatholicIntegra9onofthePennsylvania Common Core State Standards as adopted by the Office of CatholicEduca9onoftheArchdioceseofPhiladelphia.Informa9onaboutthediocesanstandardsisavailableatwww.catholicschools.phl.org

�1318

Curriculum guidelines are developed for each area of instruc9on. Teachers areresponsible for the teaching of informa9onwithin the curriculum guidelines. Throughthe use of differen9ated instruc9on delivered in both small and whole groupinstruc9onalsesngs,teachersworktowardmee9ngtheindividualneedsofstudentsintheirclassroom.Bestprac9cesforearlyliteracyinstruc9onareu9lizedbyteachersinPrektothirdgradesinordertoestablishstrongliteracyskillsintheprimarygrades.

ThefollowingcurriculumsubjectsaretaughtingradesPrekto8th:Mathema9cs,EnglishLanguage Arts (Reading, Grammar, Phonics, Wri9ng, Spelling, Speaking, Handwri9ng,Library Skills), Social Studies, Spanish (Grades 4-8), Science, Music, Art, PhysicalEduca9on,Health,andTechnology.Religion istaught ingradesPrekto8thandfollowstheReligionCurriculumGuidelinesoftheArchdioceseofPhiladelphia.Throughreligiousinstruc9on, children begin to learn that their faith is a way of life. Their faith shouldshape,guide,andnurturetheirloveofGod,neighborandself.Studentsarepreparedforthe recep9onof thesacramentsPenance (in2ndgrade)and receivePenanceandHolyEucharistin3rdgrade.StudentswillalsopreparetoreceiveConfirma9onin5thgradeandcon9nuetoprepareandreceivethesacramentin6thgrade.Parentsareexpectedtotakean ac9ve role in the instruc9onandprepara9onof their children for the recep9onofsacraments.Parentsaretheprimaryeducatorsoftheirchildrenandaretherolemodelsfor their childrenby theiraLendanceatMassandother liturgical celebra9ons,and tosupport the school community in its teachings. Students will aLendMass and otherliturgicalcelebra9onsthroughouttheliturgicalyear.

An accommodated or adapted curriculum will be developed for any student whoseneedswarrantsuchanac9on.Thesemodifica9onsoradapta9onswillbemadeupontherecep9on of necessary evalua9ve informa9on by qualified school and/or medicalpersonnel. Regular scheduled mee9ngs among the school psychologist, schoolcounselor, principal, teacher, and parents/guardians to set up, maintain, and reviewprogress aremandatory for all par9es involved. Individual learning plans and gradingprovisions will be made upon the recommenda9ons of qualified school personnelincludingtheteacher,schoolpsychologist,counselor,andprincipal.Parentalcoopera9oninmanagingstudentadapta9onsoraccommoda9onsismandatory.

Custody

Parentsareasked to informschoolpersonnelwhen the legal custodyof thechild(ren)resideswithoneparent. It ismandatory for the school tohavea copyof the custodydecree.Thiswillhelpschoolpersonneltomakeeffec9vedecisionswhentheneedarises.Custodial parents are likewise asked to supply the school with copies of restrainingordersiftheneedarises.

Those individualswhohave legal custodyof the studentmay aLend schoolmee9ngs,par9cipate in educa9onal decisions and review educa9onal records regarding thatstudent. Personswhodonothave legal custody (including thosewith visita9on rightsbutnotlegalcustody)havenosucheduca9onalrightsandmaynotpar9cipateinthesemaLer.SchoolrecordsofthestudentmaybedisclosedonlyuponwriLenconsentoftheparentwithlegalcustody.

�1419

Achildwillnotbereleasedtoaparentwhodoesnothavephysicalcustody,withoutthewriLenconsentofthecustodialparent.Todeterminethecustodialparent,allseparatedordivorcedparentsofstudentsenrolledinSaintAndrewSchoolmustprovidetheschoolwithacopyofthecourtorderorcustodialagreementadjudica9ngthatdetermina9onofcustody.Thiscourtorder/custodialagreementisplacedinaconfiden9alfile.Saint Katherine of Siena School requires parents/guardians to sign an agreementregarding the administra9on of parental par9cipa9on issues and payment of tui9on.Tui9onisbilledandcollectedfromtheparentswithlegalcustodyonly.

The school is required to provide only one set of school grades, no9ces, and otherrelatededuca9onalmaterials.Theschool isnotrequiredtoholdseparatemee9ngsforparents. However, one mutual mee9ng will be held for all par9es involved. It is theresponsibilityoftheparent/guardiantocommunicatesuchinforma9ontoeachother.

Discipline

“Effec9vedisciplinehasasitsendthedevelopmentofstudentswhorespectthemselves,other persons, and those in authority.” (Policies and Procedures – Archdiocese ofPhiladelphia,S319)

TomaintainaChrist likeatmosphere inSaintKatherineofSienaSchool,weencouragestudents, faculty, staff, parents and guardians to “treat others as they wish to betreated.”Thegoalofourcodeofconductistoguideourstudentstorespectthemselvesandothersastheygrowinself-disciplineandresponsibility.

Self-disciplineincludes:

• Respectforandcoopera9onwithothers• Obediencetoschoolauthorityandschoolrules• Truthfulnessinallsitua9ons• Self-controlwhileac9ngorspeaking• Courageindealingwithdifficultsitua9ons• Perseveranceinspiteofobstacles• Responsibilitytowardproperty,assignmentsandotherdu9es

The discipline code applies to students and parents both in school and at school-sponsored events, as well as in the Saint Katherine of Siena Parish community andoutsidetheSaintKatherineofSienaParishcommunitywherethebehavioriscontrarytoCatholicteachingsorcouldbringdisreputeorembarrassmenttotheschool.

ConsequencesresultforstudentswhochoosetodisregardChris9anbehavior.Inordertomaintaineffec9ve school andparent communica9on, the followingprocedureswill beenforced.

GradesK-3

�1520

Amonthlyeffort and conduct calendar isdistributed.Parents are required to sign theappropriateboxdaily.Occasionally,studentsinkindergartenthroughthirdgrademaybeissuedademeritordeten9onifthesitua9onwarrantsit.

Grades4-8Ademerit/deten9onformisused.Whenissued,parentsarerequiredtosignandreturntheform.Ademeritwillbegivenfor,butnotlimitedto,thefollowing:

• Infrac9onsthatdisruptthelearningenvironmentoftheschool• Disregardforclassroomrules• Bullying• Testsnotsigned• Dresscodeviola9ons• Chewinggum• Chea9ng• UsingaCellPhone• Lackofmaterialforclass• Disregardforacademicassignments

AIerastudentreceivesathirddemerit,thenextinfrac9onwillresultinadeten9on.Adeten9onmaybeissuedwithoutreceivingpriordemeritswhendeemednecessary.Thefollowing behaviors may warrant, but are not limited to, a deten9on without priordemerits:

• Disrespecttoanymemberoftheschoolcommunity• Figh9ng• Foullanguage/obscenegestures/profanity• Damagingschoolorpersonalproperty• Forgery• Invasionofprivacy

Astudentwhohasreceivedthreeormoredemeritsoranimmediatedeten2onshouldnotexpecttoreceivea“3”oraboveinPersonalandSocialGrowth.

Harassment

SaintKatherineofSienaSchoolfollowsthePhiladelphiaArchdiocesanPolicyprohibi9ngharassment, including sexual harassment which refers to any unwelcome sexualaLen9on,sexualadvances,requestsforsexualfavorsorotherverbal,visualorphysicalconductofasexualnature.

Sexual Harassment is unacceptable conduct and will not be tolerated. Anystudent or parent who is determined to have violated this policy will be subject toappropriatedisciplinaryac9onuptoandincludingdismissalofthestudent.

Vandalism

Theparentsorguardiansofanystudentwhopar9cipatesinvandalismordestruc9onortheIofpropertywillbefinanciallyresponsibleforreimbursingtheschoolortheviolated

�1621

party. An invoice for themonetary amount of the destruc9onwill be issued. This billmust be paid in a 9mely fashion. Registra9onwill be denied and report cardswill bewithheldun9lallfinancialobliga9onshavebeenmet.

Violent/Threatening/HarassingandInappropriateConduct

ItistheintentofSaintKatherineofSienaSchooltoprovideaneduca9onalenvironmentfree from all forms of improper threats, in9mida9on, hos9lity and offensive andinappropriatebehavior.Such improperconductmaytaketheformofunwantedverbalor physical conduct, verbal or wriLen derogatory or discriminatory statements andbehaviornototherwiseconducivetotheeduca9onalandreligiousmissionoftheschool.

Unacceptableconduct–eitherbyastudentoraparent–includesbutisnotlimitedto,thefollowing:

• DisrespecRul behavior of any kind toward or about any staffmember,student,volunteerorparent

• Insubordina9on• Figh9ng• Bombscaresortriggeringotherfalsealarms• Chea9ngorPlagiarism• Useorpossessionofdrugsoralcohol• Smoking• Stealing• In9mida9on,harassmentorthreatsofanykind• Possessionofanytypeofweapon

Thesecategoriesdonotcovereverypossiblesitua9on.Theschoolwilldeterminewhichbehaviorisinappropriate.

Thispolicyappliesbothinandoutoftheclassroom,intheschoolcommunitygenerallyandoutsidetheschoolcommunity,wherethebehavioriscontrarytoCatholicteachingsorcouldbringdisreputeorembarrassmenttotheschool.

Inaddi9on,inthecaseofthreatsofviolenceorharassment,inanyform,includingoral,wriLenor electronic, by a student against anymemberof the school community, thestudent, if suspended but not dismissed,may be required to receive psychological orpsychiatricclearancebeforereturningtoschool.

Suspension

Formalsuspensionisaseriousdisciplinaryac9ontakenagainstastudentwhoseac9onscons9tuteamajorinfrac9on.Threedeten9onswithinasemesterresultinasuspensionfromclasses.Thesuspensionwillbe inschooloroutofschoolatthediscre9onoftheadministra9on. The parents of the studentwill be informedof the seriousness of thesitua9onandtheschoolwillseektheimmediatecoopera9onoftheparentstoresolvethe problem. During the suspension period, the student may not par9cipate in anyschool ac9vi9es. Students will be required to complete all school assignments givenduringthesuspension.StudentswhohavebeensuspendedmaybeexcludedfromfieldtripsandSpiritDay.

�1722

A student is liable for an immediate suspension as a result of, but not limited to, thefollowing:

• Physicaland/orverbalabuse• Presenceoruseofanytobaccoproduct,smoking,drugs,oralcohol• Blatantdisrespectforauthorityorschoolrules• Vandalism,destruc9onortheIofproperty–Truancy• Immorality

Reinstatement

Followingsuspension,studentsmayreturntotheclassroomaBerparentshavemet with the appropriate school official. At this 2me, parents will sign anagreementassumingresponsibilityforthefuturebehaviorofthestudent.

Expulsion

Three suspensions (whether they are immediate or an accumula9on of deten9ons)makeastudent liable forexpulsion.Expulsion fromschoolbecomes formalizedaIeraperiodof9mehaselapsedtoallowfordiscussion, inves9ga9onandevalua9onby theprincipalandPastorwhomakethefinaldetermina9onofthestatusofastudent.

Immediate expulsion, due to extraordinary circumstances,may result from, but is notlimitedto,thefollowingtypesofinfrac9ons:

• MajortheI• Alcohol,drugs(presenceoruse)• Immorality• Carryingaweaponsuchasagun,knifeorany instrument intended to

causeharmtoanotherstudentorfacultymember• Seriousvandalism• Violentabusivebehavior

Saint Katherine of Siena School reserves the right to dismiss any student at any 9mewheretheschoolconsiderstheconductofthestudentorparenttobeinconsistentwithschoolpolicy,thegoodoftheschoolcommunityorCatholicteachings.

Deten-on

Deten9onisconductedbytheindividualteacherswhendeemednecessaryonweekdayaIernoonsfrom3:15un9l4:00p.m.,atwhich9meaparentmustsigntheirchildoutfordismissal,unlessthechildisgoingtoC.A.R.E.S.Parentswillbeno9fiedatleastonedayinadvancebeforeachildmustserveadeten9on.

DressCode

Saint Katherine of Siena recognizes the rela9onship between personal dress andpersonal astude; therefore, we encourage our students to dress as to demonstrate

�1823

prideinthemselvesandintheirschool.Allstudentsmustbeinuniformeveryday.Therewill be out-of-uniform dayswhichwill be announced during the course of the schoolyear (a dress code for such days is included). If there is a 9mewhen the prescribeduniformcannot, forsomelegi9matereasonbeworn,anotefromtheparent/guardianmustbewriLentotheprincipal.Studentswhoareoutofuniformwithoutanexcusewillbesenttotheofficeandtheparentswillbecalledtobringtheproperclothing.

During the school year, theprinciple and faculty commit ourselves to adhering to thedress code 100% so that students at Saint Katherine of Siena School, iden9fiable inuniform,willbeambassadorsofthisschool,ourchurch,anditsvalues.Wethankyouforworkingwith us challenging arena especiallywhen uniform altera9ons or new shoes,etc.…becomenecessarytobeincomplianceofthedresscode!

SchooluniformsaretobepurchasedatFlynnO’HarawhiletheschoolshoeswillbesoldatTrevosefamilyShoes.

Cosme-cs

Make-Up,acrylicnailsandnailpolishareneverpermiLed.

HairStyles/Grooming

Hair is to be neat, clean and groomed conserva9vely. No hair colora9on or extremestylesarepermiLed.Small,simplehairornamentsarepermiLed.Studentsareexpectedto come to school in a state of cleanliness. Boys’ hairmust not touch their collars orcovertheireyebrows.

Socks

• Boysmustwearblacksockswiththeiruniforms.• Girlsmustwearnavysockswiththeiruniform.• Bothmustwearwhitesocksforgym.

Nocoloredsocksarepermieedatany-me.

Jewelry

Although jewelry is not part of the school uniform, post earrings of a small andconserva9vestylearepermiLedtobewornbythegirls(oneearringineachearlobe).Boys are not permiLed to wear earrings. Bracelets, both ankle and wrist, pins andbuLons are not part of the school uniform. This includes all rope, yarn, rubber andbeadedneck,wristandanklebands.Aconserva9vereligiousmedalorcrossonachainispermiLed.

DressDownDayGuidelines

• Jeansareacceptableandshouldbeneatlykeptwithoutholes.• Skirtsmustbethesamelengthastheuniformskirts.

�1924

• Shirtsmusthavesleevesandmaynothaveanyinappropriatelogos,picturesorsymbols.

• Notanktops,spaghesstraps,baremidriff,orbareshoulders–noyogapants• Nodanglingearrings• NoplaRormshoesallowed.Duetosafety,sandalsandflipflopsarenotallowed• Parentswillbecalledifastudentcomestoschooldressedinappropriately• TheseguidelinesalsoapplytoaIerschoolsponsoredevents,suchasdances.• Make-up,perfume,cologne,orhairspraymaynotbebroughtintoschool.• FakefingernailsandTaLoosarenotpermiLed

WHENINDOUBT,DON’TWEARIT!

Allstudentsareexpectedtoadheretothedresscode.Infrac9onsofthedresscodewillwarrant disciplinary ac9on. The administra9on and faculty reserve the right todetermine theappropriatenessof studentasreandhair length.They shalldeterminewhat is unkempt, extreme, distrac9ng, and opposi9on to the philosophy of SaintKatherineofSienaSchool.Parentswillbeno9fiediftheirchildisinnon-compliancewiththedresscode.

EmergencyClosings

EarlyDismissal

Theschooldistrictand/orArchdioceseinformsusofanychangetothe9meofdismissaldue to inclementweathercondi9ons.Fewdonot receivemuchno9ce; therefore, it isnecessarythatthestudentshaveaplacetogoincaseofanemergencydismissal.KYWandtheOp9onCwillannounceearlydismissalinforma9on.

InclementWeather

KYWistheofficialsta9onforschoolcancella9onsor lateopenings.OnKYW1060AM,welistenfor“AllArchdiocesanSchoolsareclosed.”Itisimpera9vethateveryfamilyandeverychilddevelopsandknowsanemergencyplanincaseofunexpectedclosure.

Non-Snow/IceRelated

In caseofanearlydismissal (e.g.pipesburst/heaterbreaksdown)all students shouldhaveapre-determinedplacetogoonfilewiththeschool.OurautomatedphonesystemOp9onCParentAlertwillbeu9lizedandwillmakethreeaLemptstocontactyouwiththephonenumberse.g.home,work,cell, textmessage,andemailyouprovidetotheschool.

EmergencyContactForms

The school requires theparents/guardiansofeach student to completeanemergencycontactformprovidedbytheschool.Itisimportantthattheinforma9ononthisformisaccurateandupdatedsothattheschoolcancontacttheparents/guardiansintheeventofanemergency.Anychangesinemergencyinforma9on,especiallytelephonenumbers,mustalwaysbereportedtoschoolimmediately,throughouttheyear.

�2025

Extra-CurricularAc-vi-es

Extracurricular ac9vi9es are sponsored for the enrichment and enjoyment of ourstudents. Most ac9vi9es take place aIer school or on the weekends. The followingac9vi9esareavailabletoourstudents:

• AbrakoodleArtClasses• AcademicTutoring• CYOSports• ReadingOlympics• ScienceOlympics• YearbookCommiLee• StudentGovernment

FacultyMee-ngsandProfessionalDevelopmentalDays

Facultymee9ngsandprofessionaldevelopmentdayswillbeafulldayofschoolfortheteachers.Thestudentswillhavenoschoolonthesedays.Parentswillbeno9fiedintheweeksleadinguptothesemee9ngsandinthetenta9vecalendarthattheywillreceiveinAugust.

FieldTrips

Field tripsaredesigned tocontribute to theeduca9onal, culturalandsocialgrowthofthestudent.Fieldtripsareprivilegeswhichstudentscanbedeniediftheyfailtomeetcertainacademicorbehavioralrequirements(includingsuspensions).Parentsalsohavetherighttodenytheirpermissionforafieldtrip.Studentswhofailtosubmittheproperpermissionformtoschoolwillbedeniedpar9cipa9on inthefieldtrip.Telephonecallswill not be accepted in lieu of proper forms. Students aLending the field trip areexpected to come to school at the regular 9me. Dress code for the field trip will bedeterminedby the teacher inconsulta9onwith theprincipal.Studentsmaybedeniedfield trip privileges due to non-payment of tui9on. The usual school regula9onspertainingtoconductwillapplyonallfieldtrips.

Parents must have all of the proper clearances to chaperone any school field trip.Parentswhoarenotchosentochaperoneastudent’sfieldtripmustnotshowupatthesiteofthetrip.SaintKatherineofSienafollowstheConnellysponsoredfieldtriprulesinregardstoparentchaperones.

Studentmedica9oniscarriedbytheteacheronfieldtripsunlessthestudent’sparent/guardian is a chaperone. Then it is expected that the student’s parent will carry themedica9on.

Children who are not permiLed to aLend a school trip, either by parental or schoolrequest, must report to school. Field trips are considered school days. Therefore,childrenwhodonotaLendthetripandchoosetostayhomearemarkedabsent.

�2126

FireDrills/EmergencyDrills

The safetyof your children is of theutmost importance to the faculty and staffof St.Katherine of Siena School. Fire and emergency drills are held throughout the year toteach students how to respond calmly and responsibly in the event of an emergency.Safemee9ngspotsandproceduresarereviewedwithallstudents.Studentsarerequiredtobesilentduringalldrills.Drilldirec9onsarepostedineveryclassroom.Everystudentmusthavea“ShelterinPlace”baginschool.AleLerexplainingtheShelterinPlacebagcontentsandduedatewillbesenthomeinSeptember.

GovernmentServices

CORA

CORA (Counseling or Referral Assistance) is a tax funded agencywhich offers help tostudents in guidance, educa9onal tutoring and speech therapy. A CORA counselor isavailable to parents for consulta9on and to any of our students who may needsuppor9vecounseling.Theeduca9onalservicesprovidedareforstudentsinallgradesintheacademicareasofMathandReading.

Catapult provides services that include reading remedia9on and tes9ng. Act 195provideslimitedfundingforthepurchaseoftextbooks,andAct90providesfundingforvarious in structuralmaterials. Act 372 allowsbusingof non-public school childrenbytheschooldistrictinwhichthechildresides.Childrennotusuallybusedcannotridethebuses.Studentscannotchangetheirbuswithoutthepermissionoftheresidentschooldistrict, nor may they ride a school bus from any district other than their residentdistrict.AIerschooltutoringisalsoavailabletothestudentsofSaintKatherineofSienaSchool.

HealthServices

The Philadelphia School District provides health services to Saint Katherine of SienaSchool.Emergencycarewillbeofferedtostudentsforanyaccidentorillnessoccurringduring schoolhours. Extended illnessesor injuries,whichoccuroutsideof school, arethe parents’ responsibility to take care of. School nurses are prohibited by law todiagnoseillnessesorinjuries.

AhealthscreeningisheldeachyearforthechildrenatSaintKatherineofSienaSchool.Duringthescreening,eachstudentisweighed,measuredandhis/hervisionandhearingare tested. Pennsylvania state law required that students have a physical examina9onprior to entry to school, and again in grade six by their private physician or schoolarrangeddoctor.

Adentalexamina9onisrequiredpriortoentrytoschool,andingradesthreeandseven,eitherbythefamilyorschoolarrangedden9st.Theparent isno9fiedinwri9ngofanydevia9onsfoundinthescreeningorexamina9onprocess.

�2227

Administra-onofMedica-on

Theschool faculty/nursewilladministerprescrip9onandnon-prescrip9onmedica9onsduringtheschooldayaccordingtothefollowingregula9ons:

• Medica9onmustbe intheoriginalcontaineranddeliveredatthebeginningoftheschooldaytotheschool’smainofficeornurse.

• ParentsmustcompleteaMedica9onFormorsendanotetotheschoolincludingthe following: student’s name, nameofmedica9on, dosage, 9me and date ofadministra9on,reasonforadministra9on,possiblesideeffects,othermedica9onchildistaking,nameofprescribingphysicianincludingtheinforma9onabove.

• Non-prescrip9on drugs require a note from a physician including theinforma9onabove.

• Aparentmaycometoschooltoadministermedica9ons,butmustreporttotheschoolnurseorprincipalbeforedispensingmedica9ontostudent.

HomeandSchoolAssocia-on

The Home and School Associa9on of our parish school has set as its objec9ve theamendment of Catholic educa9on and the welfare of all of the school’s students. Itstrivestoenhancetheparents’/guardians’andteachers’roleineduca9onbyincreasingtheirmutualunderstandingofthestudentsandbyprovidingopportuni9esforparents/guardians and teachers to work together for their good. The Associa9on promotesparent-schoolac9vi9estoincreasemembers’interestineduca9onandcivicaffairs,andconducts fund raisingac9vi9es.Membersof theHomeandSchoolAssocia9on canbecontactedthroughtheschoolofficeoronthewebsitee-mail.

TheHomeandSchoolAssocia9onhasalwaysplayedandcon9nuestoplayanimportantrole in raising funds to support programs, equipment, renova9ons, and educa9onalmaterials.

Homework

Inaccordancewiththeprinciplesofeffec9veeduca9on,theschool’spolicy istoassignhomework to all grades each day. Homework takes priority over all extracurricularac9vi9es.Onweekendsoroverholidays,homeworkisatthediscre9onoftheteacher.Homework isanecessityatSaintKatherineofSienaSchoolbecause it reinforces skillstaughtinclass,trainsthemindthroughmemoriza9on,andenhancescri9calthinking.

Homeworkmaytakeanyofthefollowingforms:wriLenassignments,assignmentsnotcompleted in class, reading assignments, study and review, and long or short termprojects/reports.

Since homework is reinforcement of concepts learned in class, it is essen9al thatparents/guardians are asked to help their children develop good study habits byprovidinganorderlyandquietatmosphereinwhichtodohomeworkandtocheckandsigncompletedassignmentseverynight.

�2328

Homework includes both wriLen and study work. Parental signing of test papers isincludedinthehomeworkassignments.TeachersmayrelievestudentsofwriLenworkonspecialoccasions.

AppropriateTimeSpentonHomework

• K 15minutes• 1st–2nd 30minutes• 3rd–4th 60minutes• 5th–6th 90minutes• 7th–8th 120minutes

Liturgy

AsaCatholic school, SaintKatherineofSienaplacesgreatemphasison theprayer lifeand spiritual development of all members of the school community. The school daybeginsandendswithprayersonthePAsystem.GradeMassesareheldmonthlyintheChurch.TheschoolcommunitycelebratesMasseveryfirstFriday.

Studentsalsoexperienceprayerthroughservices,Sta9onsoftheCross,MayProcession,Presenta9on ofMary on school computers. Students are responsible to par9cipate inschoolliturgiesbysinging,praying,andshowingareverent,respecRulastude.

LunchPeriod

Students who stay for lunch must be enrolled in the school lunch program. Onceenrolled, the studentmay not go home unless a note from the parent is sent to theoffice reques9ng the student to come home. No special hot lunch deliveries arepermiLedinfairnesstoall.Noglassboelesorsodacansarepermieed.

LunchRules

• Allmusthaveaclothplacemat.• Respectshowntothelunchparentmoderators.• StayinseatwhileatFitzgeraldHall.• Leavebuildinginsilencewhengoingoutside.• Walkintheschoolyard–NORUNNING.

LunchSchedule

K–2ndGrade 11:00–11:40a.m.

3rd–6thGrade 11:40–12:20a.m.

7th–8thGrade 12:20–1:00p.m.

�2429

Any student uncoopera9ve with the lunch rules will receive a Pink Correc9on Slipwhereintheparentisno9fiedoftheincident.Theslipshouldbesignedandreturnedtoschoolthefollowingday.A`erthreepinkslips,thestudentwillbesuspendedfromthelunchprogramforoneweek.A`eraneighth,thechildwillbeexpelledfromthelunchprogramandprovisionmustbemadebytheparentforthestudenttoeatelsewhere.

Parent/TeacherConferences

Certain dates are set during the school year for parent/teacher conferences. It isimportant that parents aLend thesemee9ngs to keep communica9onbetweenhomeandschool.

Iftheneedarises,aparent/guardianmaymakeanappointmenttomeetwithateacher.Teacherswillnotbecalledtoaphonecallduringschoolhours;however,amessagemaybeleIforthem.Teachersshouldnotbecalledattheirhomes.ParentswishingtomeetwiththeprincipleaboutachildarewelcometodosoaIerfirstspeakingwiththechild’steacher.

SacramentalProgram

At the very beginning of the Bap9smal Liturgy the following interchange takes placebetweenthePriestsandtheParentsofthechildtobeBap9zed:

“You have asked to have your child BapBzed. In doing so, you are accepBng theresponsibilityoftraininghim/herintheprac2ceoftheFaith.Itwillbeyourdutytobringhim/her up to keep God’s commandments, by loving God and our neighbor. Do youclearlyunderstandwhatyouareundertaking?”Wedo!

AttheconclusionoftheBap9smalLiturgywehearthefollowingblessingwhichisgiventotheparentsofthenewlyBap9zedchild:

“MayGodBlesstheparentsofthischild,theywillbethefirstteachersoftheirchildinthewaysoftheFaith,maytheyalsobethebestofteachersbearingwitnesstothefaithbywhattheysayanddo.”Amen!

Inaddi9ontothese ini9alprayers, theSecondVa9canCouncilstatesthatthefamily isthe “Domes9cChurch.” Inotherwords,whatever is done in churchbeginsfirst in thehomeand is furtherstrengthened inthehomebytheexampleoftheparentsandthefamily.

Withthisinmind,parentsareexpectedtofollowSaintKatherineofSienaParish’spolicywithregardtoSacramentalprepara9onandcelebra9onwiththeirchildren.InthegradewhentheSacrament is tobereceived,parentsarerequiredtoaLendtheSacramentalprepara9onmee9ngswheretheproperunderstandingoftheSacramentwillbeshared.Informa9on necessary for the prepara9on and celebra9on of each Sacrament is senthomeattheappropriate9me.

�2530

IneverygradefromPre-Kthrough8th,itisexpectedthatallstudentswiththeirfamiliesaLendSundayLiturgy.This isthefirstandbestwaytofulfillthepromisesmadeinthenameofthechildatBap9sm.ItalsogivesastrongsupporttowhatisbeingtaughtanddemonstratedtothechildreninSt.KatherineofSienaSchool.

Students who have not received any sacraments must receive one year of religiousinstruc9on first. Parentsmust alsomake an appointmentwith Deacon Duffy tomeettheirSacramentalprerequisiteobliga9on.

StudentCouncil

The Saint Katherine of Siena Student Council is an organiza9on designed to promoteleadership development among its student body. The responsibili9es of its membersconsist of par9cipa9ng in monthly mee9ngs, supervising all student ac9vi9es,represen9ng theschoolcommunity,andpromo9ngschool spirit.Elec9onofofficers isheldinMaypriortotheupcomingschoolyear.

Thestudent’srequirementstorunforofficeare:

• Mustbeaneighthgradestudent• Must have an average of 80 or above in all major subjects and no

failuresinanysubject• Must have sa9sfactory effort and behavior marks for each marking

periodoftheyear• MustbeapprovedbythePastorandPrincipal.• Administra9on reserves the right to remove any student who fails to

complywithanyoftherulesabove.

Theelec9onproceduresare:

• Candidatesmustobtainfivesignaturesoffacultymembers• Candidatesmustbeapprovedbytheprincipal• Primaryelec9onisheldduringthethirdweekofMay• Candidatescampaignoneweekpriortotheelec9on• Dates and 9mes for elec9ons and campaigning are established by the

principalandstudentcouncilmoderator• Winnersoftheelec9onwillbeannouncedduringthelastdayofschool• Installa9onofofficersoccurs inOctoberduringa special school liturgy

heldinchurch

Theelec9onproceduresforhomeroomrepresenta9ves:

• Homerooms fromgradesfive througheighteachhave twohomeroomrepresenta9ves who are chosen by elec9on in homeroom during thesecondweekofschoolasscheduledontheschoolcalendar.

• Candidatesmusthavenofailuresonthepreviousyear'sreportcard• Candidatesmustpossesssa9sfactoryeffortandbehaviormarksforeach

markingperiodofthepreviousyear’sreportcard• CandidatesmustbeapprovedbythePastorandPrincipal

�2631

• Installa9on of homeroom representa9ves occurs in October in a FirstFridayliturgyheldinchurch

StudentLeadershipBoardischosenbytheteachersin8thgrade.ThesestudentsstrivetomodelwhatSaintKatherineofSienastudentsstridetobe.

StudentRecords

Students’recordsmaybereviewedbyparents/guardiansaIerawriLenrequestissenttotheschool.Theprincipal,ordesigneemustbepresentwhilerecordsarereviewed.

Studentrecordsinclude:

• PermanentRecordCard• StandardizedTestsResults• MedicalFile

StudentServices

Services for Math and Reading remedia9on, speech therapy, homebound tutoring,counseling,educa9onal/psychologicalevalua9onareprovidedthroughfederalandstatefunding.Alloftheseservicesarefederalorstatemandatedprogramsandareprovidedtoourstudentsthroughyourtaxdollars.Moneyisnotdistributedtoourschooldirectlybut is channeled through the Archdiocese of Philadelphia. The archdiocese ofPhiladelphiahascontractedwithCORAtoprovidetheseservicestoourstudents.Withthe excep9onof homebound tutoring, services areprovided to students either in ourbuilding or in the trailer located on the school complex. Those students whosestandardizedtes9ngresultshavefallenbelowstateand/ordistrictminimumstandardsin the areas of reading, mathema9cs, and/or communica9on are eligible for theseprograms.

Transfers

Parentsarerequestedtono9fytheprincipalandhomeroomteachersinadvanceofthedateoftransfer.Alltui9onpaymentsandfeesmustbepaidinfulluptodateoftransfer.Norecordsmaybereleasedun9lallbills,etc.arecurrent.

Thefollowinginforma9onmustbegiventotheschool:

• Name,gradeandroomofchild/childrentransferring• Reasonfortransferring• Newaddressifapplicable• Name,address,includingzipcodeofnewschool• Lastdatechild/childrenwillaLendSaintKatherineofSienaSchool• All records will be sent upon receipt of wriLen no9fica9on that the

studenthasbeenregisteredinthenewschool

�2732

• Yellow transfer form (EH25) will be issued to student and must bepresenteduponadmissiontothereceivingschool

Tui-on

Thepastorsetsthetui9oninthespringoftheyear;parentsareobligatedtomeetthepayment requirements. Parents of Pre-K and Kindergarten children are assigned aseparaterate.SpecialratesaredeterminedforstudentswhoarenotmembersofSaintKatherineofSienaParish.Reportcardswillbewithheld if tui9on isnotuptodate.Alltui9onandfeesmustbesa9sfiedtopar9cipateingradua9onforthe8thgrade.

Checktheschoolwebsitesforthemostup-to-datetui9onrates.

Uniform

TheSaintKatherineofSienaSchooluniformiswornbyeverystudentingradesK-8andshouldbewornwithasenseofdignity.Recognizingtherela9onshipbetweenpersonaldress,personalastude,and the livingoutofour faith,weencourageour students todress soas todemonstratepride in themselves, in their school, and in theirGod.Werequestandappreciateparentsupervisioninregardtostudentappearance,aswell.

PreK-KindergartenUniforms(YearRound)• LightSteelGymTeeShirtwithSilkScreen• NavyMicromeshNylonGymShortswithSilkScreen• OxfordHeavyweightSweatshirtwithSilkScreen• NavyHeavyweightSweatpantswithSilkScreen

Grade1st-6thGirlsUniform(Winter)• Blue&GreyPlaidSplitJumperwithEmblem• WhiteShortSleevePeterpanCollarBlouse• WhiteLongSleevePeterpanCollarBlouse• WhiteTurtleneck• NavyCrewNeckCardiganSweaterwithLogo

Grade7th-8thGirlsUniform(Winter)• Navy2PanelSkort• BlueShortSleeveBandedBoLomShirtwithSilkScreen• BlueLongSleeveBandedBoLomShirtwithSilkScreen• HeatherGreyV-NeckPulloverSweaterwithLogo

Grade1st-8thGirlsUniform(Winter)• NavySaddleShoe• NavyOrlonKnee-Hi• NavyOpaqueNylonKnee-Hi• NavyOpaqueTights

Grades1st-8thGymUniform

�2833

• LightSteelGymTeeShirtwithSilkScreen• NavyMicromeshNylonGymShortswithSilkScreen• OxfordHeavyweightSweatshirtwithSilkScreen• NavyHeavyweightSweatpantswithSilkScreen

Grades1st-6thBoysUniform(Winter)• NavyTwillpants• WhiteShortSleevePoloShirtwithSilkScreen• WhiteLongSleevePoloShirtwithSilkScreen• NavyV-NeckCardiganSweaterwithLogo• NavyV-NeckSweaterVestwithLogo• NavyV-NeckPulloverSweaterwithLogo

Grades7th-8thBoysUniform(Winter)• NavyTwillPants• WhiteShortSleeveBuLondownCollarShirt• WhiteLongSleeveBuLondownCollarShirt• Navy/GreyStripedTie• HeatherGreyV-NeckPulloverSweaterwithLogo

Grades1st-8thBoysUniform(Accessories)• Black/BrownReversibleBelt• NavyCrewSocks• BlackOxfordShoeforChildren• BlackLeatherMen’sEastlandOxfordShoe

Grades7th-8thBoysUniform(Spring/FallUniform)• WhiteShortSleevePoloShirtwithSilkScreen• WhiteLongSleevePoloShirtwithSilkScreen

Volunteers

Parents are welcome to enter our school community through full par9cipa9on in allevents.Volunteersforschooleventsandrou9neschoolneedsaremostwelcome.Yardparents and cafeteria moderators, and many other jobs are always open to newvolunteers.All volunteers are required tohavea criminalbackground checkandChildAbuseclearancefromthestateofPennsylvania,aswellastheSafeEnvironmentTraining(whichmayrequiremul9pleclasses)requiredbytheArchdioceseofPhiladelphia.

Novisitororvolunteermaygodirectlytoanyareaoftheschoolwithoutfirstsigninginattheoffice.Forthesafetyofthechildren,visitorsandvolunteersarenotpermiLedtogo to a classroom to visit, conferwith a teacherwithout an appointment or visit anychildinclassoratlunch.Allvolunteersmustwearavolunteers9ckeratall9meswhilevisi9ngtheschoolbuilding.

�2934

St. Katherine of Siena School reserves the right to amend thishandbookatany-medeemednecessary.

MEMORANDUMOFUNDERSTANDING

EveryCatholicschoolstudenthasarighttobetreatedasachildofGod,withtheloveandrespectthatimplies,regardlessoffamilycircumstances.Inlikemanner,thebelievingcommunityhastherighttoandeduca9onguidedbyCatholicteachingandiden9ty,unimpededbypressurescontrarytochurchteaching.

Asaparent/guardianofastudentinaCatholicschool,Iunderstand,affirm,andsupportthefollowing:

1. TheprimarypurposeofaCatholicschooleduca9onistwo-fold:tostrengthentheCatholiccommunityinitsfaith,andtoformstudentsintheteachingsofJesusChristandtheCatholicChurch.

2. Catholicschoolsaredis9nc9vereligiouseduca9onins9tu9onsguidedbytheteachingsoftheCatholicChurch.Theyarenotsimplyprivateschoolsofferingaposi9vemoralcode.Rather,theyexisttoadvancethefaithmissionofthesponsoringCatholicparish(es),Archdiocese,orCatholicreligiouscommunity.

3. WhileCatholiceduca9onplacesahighvalueonacademicexcellenceandextracurricularachievement,itsfundamentalpriorityisfidelitytoCatholicteachingandiden9ty.

4. ALendingaCatholicschoolisaprivilege,notarighttheschoolanditsadministra9onhavetheresponsibilitytoensurethatCatholicteachingandmoralintegritypermeateeveryfacetoftheschool’slifeandac9vityandthattheschoolisabletofunc9onasacommunityoffaith.

5. Inallques9onsthatinvolveCatholicteaching,morals,andChurchlaw,thefinaldetermina9onrestswiththeArchbishop.

Asaparent/guardiandesiringtoenrollmychildinaCatholicschool,Iacceptthismemorandumofunderstanding.IpledgesupportfortheCatholiciden9tyandmissionofthisschoolandbyenrollingmychildIcommitmyselftoupholdallprinciplesandpoliciesthatgoverntheCatholicSchool.

�3035

SaintKatherineofSienaSchoolPARENT/STUDENTENROLLMENTAGREEMENTFORM

DearParents/Guardians,Werequestandneedyoutoreturnthisformassoonaspossible.Pleasecheckoffeach

statementandfillinaseparatesheetforeachchildinyourfamily.Thehandbookcons9tutesaCONTRACTbetweenyourhomeandourschool.Your

signatureconfirmsyourcompliancewiththepoliciesandproceduresofSaintKatherineofSienaSchool.Thankyouforyourpromptresponse!

THISFORMISTOBESIGNEDFOREACHCHILDANDWILLBEKEPTONFILEDURINGTHISSCHOOLYEAR.

____ 1.I[we]understandthatenrollmentofastudentatSaintKatherineofSienaSchoolisbuiltonapartnershipbetweenparentsandtheschool.Tothatend,weagreetoabidebythepoliciesandproceduresoftheschool.

____ 2.I[we]havereadtheFamilyHandbookandwillworkwiththeschoolstafftoinsureasuccessfulschoolyear.

____ 3.I[we]havereadallbehavioralexpecta9onsandwillrespectandobeyourschool’spolicies.

____ 4.I[we]havereadandwillhonorthe“MemorandumofUnderstanding”,anewdocumentfromtheOfficeofCatholicEduca9on

____ 5.I[we]havereadandwillhonorthe“AcceptableUsePolicy”forcomputeruseandunderstandtheconsequencesofnon-compliance.

____ 6.Weunderstandthatparents/guardiansandstudentsmustacceptandabidebytheschool’spoliciesandproceduresinorderforeachstudenttoaLendthisschoolandpar9cipateinany,andallschoolac9vi9es.

N.B.Theschoolreservestherighttoamendthehandbookduringtheschoolyearandwillinformthefamiliesofsuchimmediately.

REQUIREDSIGNATURESParent(s)/Guardians:____________________________________

__________________________________________________________

Pleasesignonesheetforeachchild.Thankyouforyourcoopera9oninthismaLer!

Student:______________________________________________Grade______

ThankyouforchoosingCatholicEduca9onandSaintKatherineofSienaSchool

�3136

AcceptableUsePolicyforTechnologyCatholicSchoolsoftheArchdioceseofPhiladelphia

StudentInternetAccessContract

I understand that when I am using the internet or any other computer/telecommunica9onsdevice, I must adhere to all rules of courtesy, e9queLe, and laws regarding the copying ofinforma9on as prescribed by either Federal, State, or local laws, and the Archdiocese ofPhiladelphiaandSaintKatherineofSienaSchool

My signature below and that ofmy parent(s) or guardian(s) signaturemeans that I agree tofollowtheguidelinesofthisAcceptableUsePolicyforTechnologyfortheCatholicSchoolsoftheArchdioceseofPhiladelphia.

StudentName/ID_____________________________________StudentSignature_______________________________________Date_____/_____/_____Gradua9onYear__________________RoomNumber___________________Grade_________________

ParentorGuardian:Weaskthatyoureviewthispolicywithyourchildandsignbelow.

StudentAccessContract

IherebyreleaseSaintKatherineofSienaandtheArchdioceseofPhiladelphia,itspersonnelandany other ins9tu9onswithwhich it is affiliated, from any and all claims and damages of anynaturearising frommychild’suseof,or inability touse, the internetaccess, includingbutnotlimitedtoclaimsthatmayarisefromtheunauthorizeduseofthesystemtopurchaseproductsorservices.

Iwillinstructmychildregardinganyrestric9onsagainstaccessingmaterialsthatareoutlinedbythe Acceptable Use Policy for Technology for the Catholic Schools of the Archdiocese ofPhiladelphia.Iwillemphasizetomychildtheimportanceoffollowingrulesforpersonalsafety.

Astheparentorguardianofthisstudent,IhavereadtheAcceptableUsePolicyforTechnologyfortheCatholicSchoolsoftheArchdioceseofPhiladelphiaforSaintKatherineofSienaSchool.IherebygivemypermissionformychildtousetheinternetandwillnotholdSaintKatherineofSienaSchoolortheArchdioceseofPhiladelphialiableasaresultofmydaughter’s/son’suseofthe internet on school premises. I understand that my child has agreed not to accessinappropriatematerialontheinternet.

Parent/GuardianSignature_____________________________ Date_____/_____/_____

�3237

Internship Work

The next work I would like to present is a parent/student agreement form for the Saint Katherine of Siena School’s Resource Room. This assignment was given to me by Sister Ann Mark, the faculty member in charge of the students in the special needs program. She teaches students who need ex-tra help in certain subjects and thought it would be a good idea to create an agreement form between the parent, student and herself. The agreement also gives her an idea of what to expect from her students and what their particular interests may be. The target audience for this piece of writing is for any parent/guardian and student who may be contemplating joining the resource room program. For this assignment, I had to work closely with her and put onto paper in an easy design for parents/guardians and grade school students to understand and also edit an early version of the docu-ment she had given to me. This example of internship work shows how well I can design a document just through simple directions and ideas. It also demonstrates how well I can work with others under pressure when a cer-tain task is brought to my attention and needs to be accomplished rather quickly.

38

St. Katherine of Siena School Resource Room Program

2016-2017

Parent/ Guardian/Student Agreement

We have read the standards for participation in the Resource Room Program listed below. St. Katherine of Siena School reserves the right to accept and/or retain a student in this program. A student will be evaluated at the end of each marking period to determine if the child may continue in the Resource Room Program. The following standards must be met each marking period in order for the student to be kept in the program.

1.   The child’s classroom behavior is appropriate and does not hinder the teaching/learning process for others in the room.

2.   The child is not absent for more than 4 days in a marking period. 3.   The child completes all daily homework assignments and the

parents indicate that each assignment has been checked. 4.   Parental cooperation and communication with the teacher are

demonstrated on a regular basis. 5.   The child demonstrates a desire to be in the program by

his/her cooperation with the teacher and by completing all assignments to the best of his/her ability.

If a student can not meet these standards he/she will be dropped from the program and another student on the waiting list will be given a place in the program. We, ___________________________________________ accept and agree with the Parents/Guardians of the Student standards listed above and will do all that is possible to comply with them. We request that our child, _____________________________________ be placed in the Resource Room Program for the 2016-2017 school year. __________________________________ ___________________________________ Guardian/ Parent Signature Guardian/ Parent Signature I, ______________________________________ accept and agree to assume Student’s Name responsibility for the standards listed above and will do all that is possible to comply with them. I wish to participate in the Resource Room Program for the 2016-2017 school year. ____________________________________ Student’s Signature

39

St. Katherine of Siena School 9738 Frankford Ave.

Philadelphia, PA 19114

Curriculum Adaptations and Accommodations Grading Agreement Student_______________________________________________ Grade__________

Academic Year 20___ -20___ Reason: Results and recommendations of psychological-educational evaluation_____________ Date Classroom Accommodations _____ reduced class assignments _____ reduced homework assignments _____ reduced note taking with prepared class notes from teacher _____ modified test content _____ test/directions read to student (Exception: Reading Test) _____ untimed testing ( Does not exceed 1 class period) _____ oral testing or retesting _____ word banks available _____alternative assessments other than paper and pencil test _____other____________________________________________

Location and Frequency Responsibility GEC, RR Daily GEC, RR Teachers GEC, RR Daily GEC, RR Teachers GEC, RR Daily GEC, RR Teachers GEC, RR Test period GEC, RR Teachers GEC, RR Test period GEC, RR Teachers GEC, RR Test period GEC, RR Teachers GEC, RR Test period GEC, RR Teachers GEC, RR Test period GEC, RR Teachers GEC, RR Each trimester GEC,RR Teachers _____________________________________________ **GEC= General Classroom RR = Resource Room

Classroom Accommodations ____preferential seating away from auditory/visual stimuli _____repeat, paraphrase, information and directions _____auditory and visual input of content during instruction _____attention cues and comprehension checks _____use of number line, times table, calculator for basic operations _____ recommendations from PEE _____other_______________________________________________ ** PEE = Psycho-educational Evaluation

Location and Frequency Responsibility GEC, RR Daily GEC, RR Teachers GEC, RR Daily GEC, RR Teachers GEC, RR Daily GEC, RR Teachers GEC, RR Daily GEC, RR Teachers GEC, RR Daily Math GEC, RR Teachers GEC, RR Daily GEC, RR Teachers _____________________________________________ **GEC= General Classroom RR = Resource Room

Student/ Parent Responsibilities Student _____ completes all written/ study assignments _____ uses teacher notes to review and prepare for tests _____ requests instructional assistance to ensure understanding _____ uses assignment book for homework, test, information _____ focuses attention on teacher during instruction _____ keeps desk and school materials organized Parent _____ implements primary PEE recommendations and referrals ____ additional testing ____ counseling service _____ enforces structured time and place for home assignments _____ checks assignment notebook and related assignments for accuracy _____ offers guidance in study skills _____ maintains contact with teachers regarding student academic progress _____ exhibits interest in student’s academic success

Location Frequency Classroom, Home Daily Classroom, Home Daily/prior to test Classroom, Home Daily/test period Classroom, Home Daily Classroom, Home Daily Classroom, Home Daily Parent Indicated Sites ASP/ within 1 year Home Daily Home Daily Home Daily School ____/trimester Home Daily

School Administration Responsibilities _____ review and maintain checks on accommodations implementation _____ Schedule annual accommodations/adaptations review with parents/teachers _

Location Frequency School Each Trimester School 3rd Trimester

40

Saint&Katherine&of&Siena&School&

9738&Frankford&Avenue&

Philadelphia,&PA&&19144&

&

Date&___________________________&

Student&Name&____________________________________&&&&&&&&&&&&Date&of&Birth&_______________&

Placement:&_________________________&

Appropriate&Group:&Resource&Room& & & & Meeting&Date:&____________________&

Level&of&intervention:&Elementary& & & & Duration&of&Services:&_______________&

Location&of&Intervention:&SKS&

Integration&in&General&Education&for:&_______________________________________________________&

Educational&goals:&

The&student&and&his/her&parents/guardians&desire&that:&

&

&

&

Please&identify&your&child’s&disability/needs&________________________________________________&

_____________________________________________________________________________________&

It&is&understood&that&this&report&contains&confidential&information&which&may&be&shared&with&the&

educators&and&administrators&who&agree&to&confidentially.&

Parents/guardians&________________________________&&&&Date________________________&

Special&Ed.&Teacher_______________________________&&&&&Date&________________________&

Teacher&________________________________________&&&&&Date&________________________&

Administrator&___________________________________&&&&&&Date&________________________&

Other&__________________________________________&&&&&Date&________________________&

   

41

LEARNING(STYLE(((

My#child#learns#best#from:#

____#what#he#/she#hears##############################################_____#what#he/she#does#

_____#what#he/she#sees###############################################_____#what#he/she#talks#about#

_____what#he/she#touches/handles##########################

Other(_________________________________________________________________________________#

_________________________________________________________________________________#

What#holds#your#child’s#attention?#

_________________________________________________________________________________#

_________________________________________________________________________________#

#

What#is#distracting#to#your#child?#

___________________________________________________________________________________#

___________________________________________________________________________________#

#

Please#indicate#methods/techniques#that#do#not#work#for#your#child.#

____________________________________________________________________________________#

____________________________________________________________________________________#

Any#other#additional#information?#

_____________________________________________________________________________________#

_____________________________________________________________________________________#

             

42

EMOTIONAL/SOCIAL,WELL,BEING,

What%types%of%events%might%trigger%a%behavior?%

_____________________________________________________________________________________%

_____________________________________________________________________________________%

%

What%are%some%ways/techniques%a%teacher%might%help%your%child%regain%emotional%composure?%

_____________________________________________________________________________________%

_____________________________________________________________________________________%

%

What%should%we%know%about%how%your%child%interacts%socially?%

_____________________________________________________________________________________%

_____________________________________________________________________________________%

%

Other%social%or%emotional%concerns:%

_____________________________________________________________________________________%

_____________________________________________________________________________________%

43

Student Information Form: Resource Room Please Complete the Following: Student’s Full Name___________________________________________ Home Address________________________________________________ _____________________________ Zip Code___________ Home Phone Number___________________________________________ Cell Phone Number____________________________________________ Mother’s Name____________________________________ Father’s Name_____________________________________ Do both parents live at student’s home address? Yes No Does the student have any allergies? Please indicate any significant allergies that could effect school performance. ________________________________________________________________________________________________________________________________________________________________________________________________________________________ Please indicate any medications the student may take daily that could possibly cause side effects or changes in behavior. ________________________________________________________________________________________________________________________________________________________________________________________________________________________ Name any activities the student is involved in after school. ________________________________________________________________________________________________________________________________________________________________________________________________________________________ What are some of the student’s favorite things to do? ________________________________________________________________________________________________________________________________________________________________________________________________________________________ If I need to speak to you what is the best time and best way to reach you? Does the student wear glasses or have a hearing problem? Does the student need to sit in the front of the class?  

44

Internship Work

The final work I would like to present is the Photo Release Form I created for the 2016-2017 academic school year at Saint Katherine of Siena School. Saint Katherine of Siena School is always uploading pictures of their students to their Facebook and Twitter page as well as hanging stu-dents pictures up around the school. Some parents, however, do not feel comfortable with their child’s picture being uploaded to the internet for a va-riety of reasons so signing this form one way or the other is a good indica-tion for the school. The target audience for this piece of writing is for par-ents/guardians of children enrolled in Saint Katherine of Siena School whether they are concerned with their child’s picture on the internet or are indifferent to the idea. This document shows my ability to fact check the Archdiocese of Philadelphia’s policy on a photo release form and craft a document into a companies own piece of writing. It also demonstrates how well I can solve problems because we did not have any forms on record from previous years, so I reached out to other schools in the area and they showed me drafts of their photo release forms for reference.

45

SaintKatherineofSienaPhotoReleaseForm

I, _______________________________________________, hereby give theArchdiocese of Philadelphia, its successors and assigns and those ac9ng with itsauthority, the unqualified right and permission to reproduce, copyright, publish,circulate,orotherwiseuseanyschoolpicturesofmychildproducedbytheArchdioceseofPhiladelphia.Thisauthoriza9onandreleasecoverstheuseofsaidsaidschoolpicturesinanypublishedformandanymediaofadver9singpublicity.

Ialsounderstandthatourschool,maybeiden9fiedbynameandIfullyunderstandthatthis is a complete release of all claims against theArchdiocese of Philadelphia or anyotherperson,firmorcorpora9onbyreasonofanysuchuseofsuchschoolpictures.

I hereby warrant that I free to give this permission. I further warrant that theinforma9onIhaveprovided,tothebestofmyknowledge,trueandaccurate.

OR

I,_______________________________________________,herebydonotgivepermissiontotheArchdioceseofPhiladelphia, itssuccessorsandassignsandthoseac9ngwith itsauthority, the unqualified right and permission to reproduce, copyright, publish,circulateorotherwiseuseanyschoolpicturesofmychildproducedbytheArchdioceseofPhiladelphia.

SignatureofParents(s)/Guardian(s) Date

Student DateofBirth/Grade

Address

City,State,Zip

Phone SchoolYear

�146

Professional Writing Work

My professional writing journey at Kutztown University was a long one, but I crafted a variety of skills along the way. With the help of many professors and students, I have been able to showcase different works of writing from my time at Kutztown University.

The first example of professional writing I would like to present is a Travel Feature I wrote in the Spring of 2016 for WRI 325: Travel Writing. For this assignment, I had to write about a trip I had taken in first person, but relay the details to my audience as if they were also on the trip with me. In the fall of 2015, I went to the annual Mushroom Festival in Kennett Square, Pennsylvania. My roommate of three years had always told me how his hometown was the mushroom capital of the world, so I felt I needed to check it out for myself. The target audience for this article is for people in the Pennsylvania area who have heard of the Mushroom Festival, but want a better idea of what they could experience during the event. The audience could also include people of Kennett Square who want to know what an outsider may think of their thirty year festival. The only major revision I was asked to make was the lead of my story. Since my story centered around a cash crop, my professor wanted me to talk directly how the town celebrates this product instead of dancing around the topic. This piece demonstrates my ability to write about an event and describe it to an audience that may not have a clue what could go on at something like a Mushroom Festival and my words are what is the deciding factor in having them try next year’s festival.

47

Kennett Square’s 30th Annual Mushroom Festival

Most people in the United States are unaware of where the food inside their

pantry comes from. Even if we had an idea, it would be very rare to see us celebrate the

history of a food grown in our town. For the people who live in Kennett Square, also

known as the mushroom capital of the world, this concept has taken place in their town

over the last thirty years. The small town in Chester County, Pennsylvania grows

roughly 65 percent of the mushrooms consumed in the United States.

Less than 7,000 people reside in Kennett Square, which makes it remarkable

that they are able to provide the rest of the nation with its own cash crop. In 1986, a few

mushroom farmers and enthusiasts came together to host their first festival which only

lasted two blocks on the main street of town. The word spread rapidly around the

neighboring counties about this mushroom festival and was soon able to generate

48

thousands of tourists. To keep the festival unique and friendly to people of all ages,

residents of the town came together to develop fun activities for children such as jungle

gyms, face paints, and interactive games provided by volunteers. Adults experienced

the festival to a much different extent. Vendors filled each side of the street with many

mushroom based products ready to sell to curious tourists. Food stations were located

on just about every street corner selling a wide variety of food that can range from

normal festival foods like cheeseburgers and funnel cake or something more festival

based like deep fried mushrooms in a cup.

Even many of the local shops joined in on the festival fun. They welcome many

tourists inside their shops with discounts to entice them to shop in their stores. Some of

them even set up stands out on the middle of the festival in hopes of creating more

revenue for their store. Just in last year’s two day events at the mushroom festival, the

city generated over $80,000 in profits. Since 2000, the city has profited over $700,000

from the mushroom festival.

Early on a Sunday morning in early September, I embarked on my first

mushroom festival experience. The drive alone was about an hour and a half from my

hometown of Philadelphia. Upon arrival, one would think they’re looking to find parking

for the Super Bowl with the amount of traffic in the small side streets of the city. After

getting out of the car, a rotted mushroom stench fills the air from the neighboring

factories that surround the city. It may take some getting used to, but is tolerable after a

few minutes of breathing it in.

The city itself isn’t much of a sight itself. It wreaks of rural farmland Pennsylvania

with all of the open fields and animals such as horses and cows who roam in the grass.

Even with all the open farmland, many Kennett Square residents are of the upperclass

49

simply because of all the land they own.There are also very few chain restaurants and

convenient stores in the area which makes sense since they rely so heavily on the

profits of the festival. One local even told me they must drive twenty minutes to the

nearest Walmart and movie theatre, which many people from larger city would just fine

absurd.

Preteens work the lemonade stand like set-up to charge tourists the three dollar

entry fee to get into the festival. After receiving the bracelet that closely resembles the

elastic Livestrong bracelets from the early 2000’s, I entered the 30th annual Mushroom

Festival. To my surprise, the streets were filled with what seemed like hundreds of

thousands of tourists on the tiny streets of Kennett Square. The festival went on for over

a mile, but I couldn’t see more than five feet ahead of me without reading the back of

someone’s shirt. I had to take each step with caution so that I would not step on the

back of someone’s feet or bump into them with my shoulder.

Overwhelmed is an understatement when it comes to the amount of different

types of mushrooms served throughout the course of the day. White mushrooms,

portabella mushrooms, oyster mushrooms, and even fried mushrooms are among

dozens of mushrooms served at each concession stand. The most shocking event I

came across during the festival had to be the mushroom eating contest. I could barely

stomach eating a few fried portabella mushrooms while walking around, but eating them

competitively seemed a bit much to me. Last year’s winner, Molly Schuyler, consumed

11 pounds of fried breaded mushrooms in under eight minutes. First place won her

$800 and a mushroom shaped trophy.

While continuing to explore, I noticed the amount of merchandising the festival

feeds off of. Countless tents also stand out with every street I pass and inside are

50

mushroom shaped hats and t-shirts with mushroom festival logos on them. I couldn’t

see many tourists stopping by to pick up a shirt, but many kids were running around

with those mushroom shaped hats on. Besides those tents, many of the vendors set up

seemed like they were part of an organized garage sale selling their own homemade

products. Every stand had its own purpose and it stood out differently from the one

before it.

The most drastic stands I remember walking passed were an elderly man giving

away mushroom flavored spices and oils in sample shot glasses. I can’t recall a time

that I gagged in public then when I tried liquid mushrooms mixed in with bacon. The

very next stand less than ten feet away was selling chocolate covered bananas for a

dollar. It sounded like an interesting food choice, but most people seemed to regret that

first bite. The banana must have been sitting in a freezer for more than half the day

before I got my hands on it, so when I did take that first bite I immediately felt a brain

freezing sensation throughout my entire mouth. As I walked away from that stand with

disappointment, I felt a drop of rain fall on my face as the sky began to darken. People

began to panic and so ended the 30th Annual Kennett Square Mushroom Festival.

It was truly a fascinating sight to see so many people gathered in such a small

town for a celebration of one cash crop. I thought in that moment that more towns would

be more closely rooted together if they had these little celebrations at least once a year.

Maybe I would enjoy my neighborhood better if I was involved in such a closely rooted

festival.

51

Professional Writing Work

The second piece of writing I would like to present is a gamer guide for beating the All-Star Mode in Super Smash Brothers on the Wii U in the Spring of 2016 for WRI 220: Technical Writing. For this assignment, we had to find a set of directions/guide that could be improved or if it did not exist then we could create one ourselves. I found a guide to assist in beating the game, but it was black and white text for thirty pages with very few line breaks. Our professor constantly stressed how important document design is for our audience, which is why I included many different colors and im-ages to make the document much more appealing to the reader’s eye. The target audience for this document is people of all ages who have played Super Smash Brothers on the Wii U, or wish to play in the near future. I de-signed the document so people of all ages could understand the language being spoken throughout the guide. However, the game is very popular across the world, so this guide is mostly for people who play in the United States and neighboring countries. There were also no revisions that need-ed to be made from my professor. This example shows my ability to design documents appealing to a large audience and create a step by step guide that can be easily followed by people interested in the topic.

52

Super Smash Brothers Wii U All Star Mode Walkthrough

�

53

Table of Contents

Game Background 3......................................................

What Is All Star Mode? 3...............................................

Controller Layout 4........................................................

Character Selection 5....................................................

Top 5 Characters To Use For Beginners 6.....................

Top 5 characters to use for All Star Mode 11...................

Each Stages’ Specifics 16...............................................

Conclusion 19..................................................................

54

Game Background

Super Smash Brothers has been one of Nintendo’s most popular games since the turn of the millennium. The most recent version of the game for the Wii U became the fastest selling game for the Wii U in the United States. If you’re a fan of Nintendo characters fighting each other to the death than this is the game for you!

What Is All Star Mode?

In All Star Mode, you select one of the 58 playable characters and fight against every character in the game’s roster over the course of seven stages. Your character is given only one life to last through the entire mode and the damage you take in each stage carries over to the next. After completing each stage, you are placed in a peaceful stage that allows you to rest before your next fight. In this area, you are given four items to heal yourself: One heart containers that will heal your damage percentage back to zero, two Maxim Tomato that reduces your damage percentage by fifty percent, and one Fairy Bottle that reduces your damage percentage by one hundred percent only if you’re damage percentage is over one hundred percent. It is crucial that you space out the items between each level since you only have one life.

�

55

Controller Layout

You’re probably noticing that the controller for the game looks the same as the Nintendo Gamecube controller. Well that assumption is correct! The Super Smash Bros. for the Wii U allows you to use your old Gamecube controllers to play this game as long as you have the adaptor that comes with it.

Each character in the game follows the same basic rules for attacks but the strength and abilities varies among each character.

• To move across the screen with your character, use the gray control stick on the left handle of the controller.

• There are several ways to effectively jump in the game. Pressing the silver X and Y buttons repeatedly will allow your character to jump multiple times to attack others in the air or jump back onto the stage. Another way is to tap up multiple times on the control stick.

• To effectively block other characters attack, you must activate your shield. To activate this shield, you must hold down the left trigger, right trigger, or the navy blue Z button. The only con associated with this shield is if you hold it down for more than a few seconds, your shield bubble will pop and leave you stunned for a free attack from your opponent.

• Each character can grab and throw their opponent in different directions depending on their abilities. To throw an opponent, grab and hold the Z button while next to an opposing character and move your control stick to the left, right, up, or down.

56

• Characters also have their own special moves that were taken straight from their previousgames. For instance, Holding down B with Bowser will make him breathe fire on hisopponents. You can also perform a variety of other attacks using a combination of the Bbutton and the control stick.

• The most basic attacks characters can use in the game are derived from the large green Abutton. Tapping the A button will provide your character with a series of low damage attacks. To perform stronger attacks with the A button, you must use the control stick in the same way asthe B button.

• Finally, to taunt your opponents after throwing them off of the stage, touch any directionon the D pad for a showboat from your character.

Character Selection

�

The image above is the character selection screen after you select all star mode from the main menu. Each character has their own unique set of skills and abilities that will help you beat each boss on the way achieving All Star Mode.

Along with selecting a character to play with, you must also select the difficulty in which you want to play on. The three modes to select from are:

• Easy• Normal• Hard

Your experience level in the game will determine the setting that you choose to take on the All Star Mode.

57

Top 5 Characters To Use For Beginners

If you’re new to the game and aren’t sure who to select, I have compiled a short list of characters who work well for beginning players. Other gaming experts may not agree with this list, but these are the five I found to be most useful when I started out this playing this game

5. ROSALINA AND LUMA

�

To start the list, we have Rosalina and Luma from Super Mario Galaxy. Her moves are quite simple, but what really makes her great for

beginners is her sidekick Luma. If you find yourself in a jam of any kind, the little star like creature will come to your aid if it looks like your

enemies are taking it to you pretty hard.

58

4. CAPTAIN FALCON

�

Captain Falcon has been around since the Nintendo 64 version of the game and may be up there for the fastest character on foot in the game.

Simply pressing the B button next to an opponent with his “Falcon Punch” will do a great deal of damage to any opponent. His moves are simple

enough for first timers to get their feet wet in the game.

59

3. PIKACHU

�

Pikachu may look small but don’t let it fool you. His quickness and electricity make him unique to most characters and his moves are easy to learn for beginners. His down and B combo move has been around since his introduction to the series in the Nintendo 64 version of the game and

still does a great deal of damage to opponents today.

60

2. MARIO

�

Everyone knows Mario had to be on this list. He’s been the face of Nintendo for over thirty years now. Mario is well known as the most well-

rounded player in the game and most of his moves create the same steady amount of damage. Mario is the best option for someone who has

never picked up the game and wants to learn the basics.

61

1.CLOUD

�

Finally, we’ve reached the end of the list! Cloud packs the most powerful punch of all the characters on this list and even has a quickness that it is

appealing for someone just starting out in the game. Once you get a good feel for him after a couple rounds, you can use his signature move

“Finishing Touch” that will almost always instantly kill your opponent if they have taken the slightest bit of damage.

62

Top 5 characters to use for All Star ModeSince damage carries over from level to level in All Star Mode, you’re going to need characters who can take a decent amount of damage without flying off the stage. In this list of characters, you will notice most of them will be heavier because they are much better at holding down large amounts of damage.

1. LITTLE MAC

�

Arguably of course, Little Mac is the best option for you to use during the All Star Mode. What makes him stand out from the rest during the All Star Mode is the fact that a lot of times when he is hit by an opponent, he won’t

move at all which is crucial when facing several opponents at once. You cannot go wrong with selecting him to beat the game’s All Star Mode!

63

2. CHARIZARD

�

Charizard is the most powerful of all the Pokemon available to use in the game. Most of his attacks do large amounts of damage, but most notably is his Flare Blitz. Use this move by hitting the over and B button combo

and it will knock most enemies of the stage with little amounts of damage. The only warning with this move is to watch how often you use it because

it reflects damage back at Charizard.

64

3. King Dedede

�

King Dedede is a massive force to be reckoned with no matter what mode you play. Although in All Star Mode, his large hammer does a great deal of damage to any enemy that stands in his way. Another great feature of King

Dedede is his ability jump back onto the stage as if he has a smaller characters body.

65

4. CORRIN

�

Corrin is another well rounded character for her size and will work well in All Star Mode more for his counters than his strength. She is able to

counter other opponents strongest attacks and leave them stunned for several seconds. This works well when you have half a dozen characters

charging at you at the same time.

66

5. LINK

If I’m being honest, I only put Link on this list because he’s my favorite character in the game and I’ve been using him since the first version of the

game was released. What makes him great to use in this mode is his up and B combo attack which has his sword move in a spinning motion. He is able to attack multiple enemies at once with this which works great for All

Star Mode.

67

Each Stages’ Specifics

As I stated earlier, there are seven stages you must complete with only one life to do it. Each stage differs with the amount of characters you will face. The characters you face also go in a descending order in which they were released over the years. The stage you face opponents in will be randomized to fit a stage someone you fight against.

Stage One: (Characters: Present day-2007)

The following nine characters appear in the first stage:

• Robin• Lucina• Corrin• Dark Pit• Shulk• Bayonetta• Wii Fit Trainer• Rosalina and Luma• Greninja

These characters are the newest the Nintendo world has to offer. This also means that these are some of the most complex characters to face in the game. I would recommend holding off using one of your healing items if possible. If you can pass this stage with little damage taken, then you put yourself in a good position to complete the All star mode.

Stage Two: (Characters: 2006-2001)

The following nine characters appear in the second stage:

• Lucario• Villager• Zero Suit Samus• Toon Link• Olimar• Roy • Bowser Jr.• Ike• Lucas

These characters were predominant in the Gamecube era of Nintendo. They are mostly smaller characters and shouldn’t cause much of a problem as it is one of the easier of the seven stages. After this stage would be a good time to use a Maxim Tomato to heal yourself.

68

Stage Three: (Characters: 1993-1998)

The following nine characters appear in the third stage:

• Ganondorf• Sheik• Jigglypuff• Charizard• Pikachu• Mewtwo• Diddy Kong• Ness• Cloud

This group of characters were mostly a part of the Nintendo 64 era of Nintendo. During that era we saw the beginning of Pokemon that still reigns today and even additions to the Legend of Zelda saga. This stage may be a bit more challenging with larger characters such as Charizard and Cloud. I recommend going out of your way to take them out first since they can cause the most damage of the nine characters you’re facing.

Stage Four: (Characters: 1993-1991

The following seven characters appear in the fourth stage:• Meta Knight• Falco• Fox• Wario• King Dedede• Kirby• Sonic

These characters derived right after the Super Nintendo released world wide in 1990. Almost half of these characters were taken from the many Kirby games that started with the original Gameboy. Other than King Dedede, all of the characters are small and quick. The best way to get through this level is to separate Dedede from the other characters and take them out first because he will take up much of your time. Now would be another good instance where you might want to consider using another healing item depending on your damage status.

69

Stage Five: (Characters: 1990-1986)

The following eight characters appear in the fifth stage:

• Captain Falcon• Yoshi• Dr. Mario• Marth• Megaman• Palutena• Pit• Ryu

This group of characters were a part of the end of the original Nintendo era and the original Gameboy. Ryu, Megaman, and Pit are going to lead the way of characters to stand in your way in this stage. It will be incredibly tough to knock them out while they’re together, so you should attempt to separate them and try to fight them one on one.Coming down the final stretch, you may want to use your Fairy Bottle if you are over 100% damage at this point in the game. You do not want to come this far in the game just to lose and have to start over.

Stage Six: (Characters: 1986-1984)

The following seven characters appear in the sixth stage:

• Samus• Zelda• Link• Bowser• Peach• Rob• Duck Hunt

Now we are starting unveil the original cast of Nintendo icons. Link and Zelda appeared from The Legend of Zelda at this time along with Peach and Bowser from the Super Mario series. This stage is more mental than anything else you will encounter. By now, you’re thinking about only being one stage away from completing the All Star Mode and next time you blink, the game is over. These characters will be even tougher than the last stage. Rob, Link, and Bowser will be overly aggressive as soon as the match starts, so try and stay away from them as long as you can. Take down the smaller characters and you should be fine. After completing this stage, use all items you have left! This is your last chance to heal yourself before the final stage, so take advantage!

70

Stage Seven: (Characters: 1984-1980)

The following six characters appear in the seventh stage:

• Mario• Luigi• Pac Man• Mr. Game and Watch• Donkey Kong• Little Mac

These six characters are the first that Nintendo has offered to the public and you’re facing them in the final stage of All Star Mode. The one thing that will surprise you most about the final stage is that it isn’t overly difficult. These characters are not meant to challenge you as much as the other levels. What is supposed to affect you most at this point in the game is the amount of damage you’ve taken and the final six will hope to take advantage. To avoid this, use your shield as much as possible and only expose yourself when you can guarantee a hit on your opponent. Donkey Kong and Little Mac can be dangerous with their big hit capability, so get rid of them quick and you should be in good shape to finish the game strong.

ConclusionIf you follow this guide carefully, you will end up successful in completing the All Star Mode in Super Smash Brother for the Wii U.

71

Professional Writing Work

The final piece of professional writing work I would like to present is a sports prediction I wrote in the Spring of 2016 For WRI 318: Sports Writing and Reporting. For this assignment, I had to make a 300 word sports pre-diction based off of professional or collegiate sports within the next year and explain my reasoning through facts. Since I am from Philadelphia, I chose to write about the Philadelphia 76ers and why I believe they went with a horrendous strategy in regard to rebuilding the franchise. I stated that they would lose out on the number one overall 2016 NBA draft pick. The target audience for this assignment was anyone who enjoys Phil-adelphia sports, NBA discussion, and sports in general. Kutztown Universi-ty students were also part of the target audience because the article fea-tured in the February edition of the Keystone newspaper. My professor en-couraged me to revise my first draft of the prediction because many of my thoughts were scattered across the page when I should have been more direct. My final draft consisted of simple facts and clear information which read much better as a whole instead of trying to comprehend bits and pieces of information that did not connect. This example shows my ability to make a bold opinion and then back it up with facts and have all of the in-formation connect.

72

Headline:76ers’tankingwon’tpayoffSubhead:TeamwillfallshortofthenumberonepicktotheLosAngelesLakers.SecBon:SportsDate:Jan.21,2016Words:313ByJosephThiel

The76ersarecurrentlyinyearthreeoftheirplantotankduringtheregularseasoninordertoobtain

highpicksintheNBAdraM.TheirrecordoverthisBmeisanabysmal43-165ledbyheadcoachBreR

Brown.

ThefrontofficebelievesthisisthebestopBontoachievefuturesuccessbecausedraMingyoungtalentis

mucheasierthansigningsuperstarfreeagents.Unfortunately,thisplanwillnotpanoutfortheminthe

longrun.

The2015-2016seasonstartedjustthewaygeneralmanagerSamHinkiehadhoped.29lossesinthefirst

30gamesplacedtheminprimeposiBoningforthebestoddsatthenumberoneoverallselecBoninthe

2016draM.

However,theteamtradedawaytwosecondrounddraMpickstotheNewOrleansPelicansfor

journeymanpointguardIshSmithonChristmasEve.Thismovewouldnormallynotturnanyheads,but

hehasnowledtheteamtofivewinsintheirlastelevengameswithhisabilitytofeedtheball

underneathtotherecenttoppicksJahlilOkaforandNerlensNoel.

ThesemeaninglesswinsarenowhurBngtheteam’schancesatdraMingthenextLeBronJames.

73

BenSimmonsfromLSUisthisyears’topcollegeprospectandcouldreallyhelpturnthemisfortunesof

theteamaroundwithhiscomparisonstocurrentsuperstarsaroundtheleague.

Evenwiththeirabilitytolosenightinandnightout,theprevioustwoloRerydraMshavecostthe76ers

thetopcollegiateprospect.Thisyearisnodifferent.

TheLosAngelesLakersarenowonlyfourgamesbehindtheSixersfortheworstrecordintheleagueand

nooneoutsideofCaliforniawantstoseetheLakersdraMtheperfectreplacementaMerfirstballotHallof

FamerKobeBryantreBresattheendofthisseason

-30-

74