Download pdf - STP seminar 04/08

Transcript
Page 1: STP seminar 04/08

Structural studies of bacterial TIR-

domain containing proteins:

Paracoccus denitrificans

Chan Siew Leong

Pascual’s Lab

Burnham Institute for Medical Research

Page 2: STP seminar 04/08

Innate immunity

First line of defense

Innate immunity is the common mode of defense

against microorganisms, using limited set of pattern-

recognition molecules.

Rely on receptors to recognize microbial signatures

such as LPS, CpG DNA, peptidoglycan and dsRNA

from viruses.

Toll-like receptors (TLR): Signal Transduction

through the TIR (Toll/IL-1 receptor) domain

Page 3: STP seminar 04/08

Trinchieri, G. and A. Sher (2007). Nat. Rev. Immunol. 7: 179

Signaling of Toll-like Receptor

Page 4: STP seminar 04/08

Models of Ligand-Induced TLR Activation

Brodsky, I. and R. Medzhitov (2007). Cell 130: 979

Toll/IL-1 Receptor (TIR) domain

Leucine-Rich Repeats (LRR)

Kim, H. M. et al. (2007). Cell 130: 906

Jin, M. S. et al. (2007). Cell 130: 1071

Page 5: STP seminar 04/08

Kim, H. M. et al. (2007). Cell 130: 906

Jin, M. S. et al. (2007). Cell 130: 1071

Protein and non-protein ligands bind to different surfaces of

TLR’s Leucine Rich-Region

Page 6: STP seminar 04/08

Human TIR-domain-containing Adaptor Family

Page 7: STP seminar 04/08

TLR1

TLR2

Xu, Y. et al. (2000) Nature 408: 111

BB

Loop

N C

Crystal structures of TIR-domains of TLR1 and TLR2

Page 8: STP seminar 04/08

TLR10 TIR domains homodimerize via BB-Loop

PDB: 2j67BB

Loop

Page 9: STP seminar 04/08

TRAM

MAL

TLR4

TLR4

A Model for TIR-TIR domains signaling: TLR4 homodimer

docked with MAL and TRAM

Nunez Miguel R. et al. (2007) PLoS One 2(8):e788

Page 10: STP seminar 04/08

TIR-domains are also present in prokaryotes

Page 11: STP seminar 04/08

• What role does TIR domain play in bacteria?

• An evolved mechanism to interfere with host’s innate

immune responses?

Page 12: STP seminar 04/08

TIR-Containing Proteins (E. coli and B. melitensis) reduce cytokine

secretion and increases accumulation of intracellular bacteria

Cirl, C. et al. (2008). Nat. Med. published online 9 March 2008; doi:10.1038/nm1734

Page 13: STP seminar 04/08

TIR-Containing Proteins (E. coli and B. melitensis) impair TLR

signaling and interact with MyD88

Cirl, C. et al. (2008). Nat. Med. published online 9 March 2008; doi:10.1038/nm1734

Page 14: STP seminar 04/08

Objectives:

Determine 3D Structure of prokaryote TIR domain

Prokaryote TIR vs. Eukaryote TIR

Interaction between Prokaryote TIR and Eukaryote TIR

Plant TIR domains

Page 15: STP seminar 04/08

1 2 3 4 5 6Lane 1: MW Marker

Lane 2: Cell Lysate

Lane 3: After IPTG induction

Lane 4: Full Length PdTLP (after His-

Trap and S200 Gel Filtration)

Lane 5: After Chymotripsin Digestion

Lane 6: After final S-200 Gel

Filtration

Coiled-coil domain TIR

Chymotrypsin cleavage

>PdTLP(Paracoccus denitrificans)

MSANDRAIETLRREIAKLQTDGAAIARKDAGIRAKLASAMAAQAKAKTAPALRLKQAEASRLEKELMATSKSQADIATKIAKKQSSLSAKLVVQ

ANEAKKADAKAKKNQERVSKTQEEATRKLEAGYRKLTLENQSLEQRLQRELSAMKPTAGPTTNADLTSAPPHDIFISHAWEDKADFVEALAHTL

RAAGAEVWYDDFSLRPGDSLRRSIDKGLGSSRFGIVVLSTHFFKKEWPQKELDGLFQLESSGRSRILPIWHKVSKDEVASFSPTMADKLAFNTS

TKSVDEIVADLMAIIRD

16.9kDa; 154 a.a; 3M; ! = 23490

TIR-Like Proteins from Paracoccus denitrificans (PdTLP)

Page 16: STP seminar 04/08

Low, L. Y. et al. (2007). Biochem. Biophy. Res. Comm. 356: 481

PdTLP is composed of two independent folded domains

Page 17: STP seminar 04/08

PdTIR showed well-dispersed 2D 15N-HSQC spectra

Page 18: STP seminar 04/08

Crystallization PdTIR

• Protein concentration 5.3 mg/ml in buffer 10 mM Tris pH 8.0

• Room temperature and 4°C

• Screening: Classics, PEGS, Hampton I & II, Wizard I & II,

MPD, PACT, Cryos, JCSG+ Screening Suites.

• 0.1 M Sodium cacodylate pH 6.5, 0.2 M Ammonium sulfate

and 30% PEG 8000

PdTIR on Native Gel

Page 19: STP seminar 04/08

X-ray diffraction of Pd TIR-domain crystals: 2.4 Å

• 0.1 M Sodium cacodylate pH 6.5, 0.2 M Ammonium sulfate and 30% PEG 8000

• Sitting drop, 4°C, 7 days

• Orthorhombic crystal system; P212121 space group; a=80.78, b=85.61; c=89.62

Page 20: STP seminar 04/08
Page 21: STP seminar 04/08

Low, L. Y. et al. (2007). Biochem. Biophy. Res. Comm. 356: 481

PdTLP!s TIR domain binds to TLR4 and MyD88 TIR domains

Page 22: STP seminar 04/08

Microbial Pathogens Utilize Structural Mimicry To Manipulate Host Cellular Functions

Page 23: STP seminar 04/08
Page 24: STP seminar 04/08

Burch-Smith, T. M. and S. P. Dinesh-Kumar (2007). Science 401: pe46

Plant TIR Domains

• p50 effector associates with TIR

domain (LRR?)

• Mechanism of signaling is not

known

Page 25: STP seminar 04/08

Arabidopsis TIR-Containing Protein exists as monomer and dimer

Dynamic Light Scattering (DLS)

•Two species, non homogenous

•Poor Polyindex ~ 0.6

Native Gel

8.6 5.0 2.5 mg/ml

Page 26: STP seminar 04/08

Arabidopsis TIR-Containing Protein exists as monomer under

reducing conditions

Dynamic Light Scattering (DLS)

•Homogenous

•PolyIndex = 0.26

Native Gel

1.0 5.0 10.6

mg/ml7.5

Page 27: STP seminar 04/08

Future work

Determine crystal structure of TIR-Like Protein from

Paracoccus denitrificans

Structures of TLP from other organisms (E. coli, Brucella,

Yersinia, Agrobacterium, Arabidopsis)

Do bacterial TIR domains use BB-loop to bind to MyD88

and other adaptors?

Interactions between TIR domains and in-complex with

other adaptors

Page 28: STP seminar 04/08

Acknowledgement...

Jaime Pascual

Ray Low and Eugenio Santelli

Sarah Hamilton

Yvonne

Thank You


Recommended