Jessica Symons Portfolio

  • View
    217

  • Download
    1

Embed Size (px)

DESCRIPTION

Jessica Symons is a graduate student at Kansas State University. She will be graduating May 2013 with her Masters of Architecture degree.

Text of Jessica Symons Portfolio

  • JessicaSymonsArchitectural Portfolio

  • 'XGT[OCPUYQTMYJGVJGTKVDGNKVGTCVWTGQTOWUKEQTRKEVWTGUQTCTEJKVGEVWTGQTCP[VJKPI

    GNUGKUCNYC[UCRQTVTCKVQHJKOUGNH

    3WQVGD[5COWGN$WVNGT

  • [ ]Kansas State UniversityNAAB Accredited Masters of Architecture

    Jessica Marie SymonsGraduate Student

    JessicaSymonsArchitectural Portfolio

    jessie17@ksu.edu913.461.0517

    Watercolor on Paper Church of the Jubilee | 2012

  • CoconutCreamPieDesign + Make Cabin Prototype | 2012 - 2013

    Individual Design Phase Design Analysis Group Design Phase

  • Why Coconut Creme Pie?

    6JG)KTN5EQWVUQH#OGTKECJKTGFQWTCTEJKVGEVWTCNUVWFKQVQFGUKIPCPKPPQXCVKXGIKTNUEQWVECDKPHQTUVEGPVWT[IKTNUKP&QXGT-51PQWTHKTUVUKVGXKUKVYGHQWPFVJGQPGFKPGTKPVJGSWCKPVNKVVNGVQYPVQUVQRCPFJCXGCDKVG6JGKTURGEKCNV[!#OC\KPI%QEQPWV%TGCO2KG5KPEGVJGPVJKUFGNKEKQWUVTGCVJCUEQOGVQU[ODQNK\GQWTEQPPGEVKQPVQVJG)KTN5EQWVUCPFVJGEWNVWTGKPYJKEJYGCTGUVTKXKPIVQYQTM9GJCXGCFQNNCTDWFIGVVQCEEQOOQFCVGUKZIKTNUKPCECDKPQHQWTOCMKPI*GTGYGIQ

    Girl Scout Cabin PrototypeCamp Daisy, Dover, KS | Client: Girl Scouts of America | Budget: $7,500 | 2012 - 2013

    Individual Vs. Group Design

    %QEQPWV%TGOG2KGRTQXKFGFCWPKSWGCECFGOKEGZRGTKGPEGDGECWUGYGCUUVWFGPVUYGTGCDNGVQYQTMDQVJKPITQWRCPFKPFKXKFWCNUGVVKPIUQPTGCNRTQLGEVU

    6JGHKTUVFGUKIP[QWYKNNUGGKUO[QYPFGUKIPYJKEJYCURKEMGFCUDGUVKPUJQYHQTRCTV

    6JGPYGEQPVKPWGFQPVQYQTMKPVGCOUQHVJTGGCPFVJGPUKZVQEQPVKPWGFGXGNQRKPIFGUKIPU

    Construction

    1PGQHVJGOQUVXCNWCDNGRCTVUQHVJGUVWFKQYCUVJGQRRQTVWPKV[VQDGEQOGHCOKNKCTYKVJEQPUVTWEVKQPVGEJPKSWGU+NGCTPGFVQYGNFRQWTEQPETGVGCPFDWKNFHQTOYQTMYQTMYKVJECTRGPVT[WUGUJQRGSWKROGPVCPFFGVCKNGNGOGPVUQHCRTQLGEVVQIGVJGT

    6JKUGZRGTKGPEGICXGOGCDGVVGTWPFGTUVCPFKPIHQTOCVGTKCNUCPFEQPUVTWEVKQPKORTQXKPIO[FGUKIPCDKNKVKGUVJTQWIJJCPFUQPGZRGTKGPEGCPFUMKNN

  • Adapting to topography | Raising above water line

    Modular componant fabrication sequence Assemble Kit of Parts

    Insulative material

    Plexiglass Panel

    Wood Board

  • Finished Modular Element Uses of Modular ElementUses of Modular Element

    Entire wall opens to connect the cabin with nature

  • Floor Plan

    17

    17

  • Step 1: Existing Cabins

    - Falling apart- Hard to maintain- Hot and uncomfortable- Only houses four girls- Eroding foundation

    ProcessofDesign

    Step 2: Individual Design

    - Add color- Develop relationship to the ground- Structure in the works- Corners can be improved- Budget undetermined- Create an indoor/outdoor relationship- Maximum ventilation

    Step 3: Begin Group Work

    - Developing roof structure- Reworking layout- Developing interior structure- Eliminating dead spaces

    Step 4: Presentation

    - Create a roof and wall relationship- Maximize profitability- Increase uniqueness- Develop budget

    A design is never finished, for it is the work of refinement on a set of principles. Design takes the existing and creates something better - something new. My original concept for the Camp Daisy Cabin held to the ideas of social connection, adaptability, and a connection to the natural world. Though the design grew throughout the transition from individual design to group design, the principles always remained as the founding blocks of the idea.

  • Phase 2: Group Design

  • Floor Plan | developed as a group, created by Jessica

    Longitudinal Section | developed as a group, created by Jessica 0 1 2 4 8

  • SeatonRedesignedKansas State University, Manhattan, KS | 2010Team Design Project

  • What's Up With Seaton Hall?

    Seaton Hall, the home of the Kansas State University College of Architecture, Planning & Design, fails to adequately provide an enriching work environment for students, and inadequately represents the prestigious academic program.

    Seaton Hall Redesign ProjectKSU Campus, Manhattan, KS | 2010

    Individual Vs. Group Design

    This studio provided and opportunity to work in groups of five people (four fourth-year students and one fifth year mentor) and learn how to design corroboratively. We worked in tandem on every element of the project and learned to delegate work, compromise ideas, and stand behind one another

    +RTQXKFGFVJGFTCYKPIUKPENWFKPIRNCPUUGEVKQPUCPFGNGXCVKQPUHQTQWTVGCO

    A Project with Reality

    -CPUCU5VCVG7PKXGTUKV[WUGFQWTFGUKIPUCPFOQFGNUVQTCKUGOQPG[HQTVJGRTQLGEV$GECWUGQHVJKUF[PCOKEYGRTQFWEGFYQTMVJCVEQWNFCEWTCVGN[DGDWKNVCPFUWRRQTVGFD[FQPQTUCPFCTEJKVGEVU6JGTGCNYQTNFGZRGTKGPEGCNNQYGFOGVQECVEJCPGCTN[INKORUGKPVQVJGHNQYQHCHKTOCPFVJGSWCNKV[QHYQTMYJKEJ+VJGPFGXGNQRGF

    Small Scale Model Large Scale Model Virtual Model

  • Campus Circulation Study | Produced by Jessica Symons 2010

  • 'ZCORNG(NQQT2NCP%#&+NNWUVTCVQTRJQVQUJQR

    'ZCORNG'NGXCVKQP%#&+NNWUVTCVQT

    2NCPUKNNWUVTCVGCEQORNGZPGVYQTMQHNGXGNUKPVQCUKORNGPGCVFTCYKPI

    6JGGNGXCVKQPFKURNC[UVJGJKUVQTKEQTKIKPCNHCECFGQHVJGDWKNFKPICUVJGPGYDCTQHUVWFKQUUVCPFUCUCNCPFOCTMCDQXGVJGURCEG

    Documentationdeveloped as a group, created by Jessica

    1HHKEG5RCEGU(CEWNV[/GGVKPI5RCEG(CEWNV[.QWPIG#TGC%TKVKSWGTQQOU5OCNNGT6QQN5JQR5RCEG5WUVCKPCDKNKV[%GPVGT(CEWNV[%NCUUTQQOUCPF1HHKEGU)CNNGT[5RCEG.CD

    A

    B B

    C

    C

    D

    D

  • 5VCEM8GPVKNCVKQP%QTG)TGGP4QQH#TGCU0QTVJ0CVWTCN.KIJV)TGGP4COR5QWVJGTP5JCFKPI&GXKEG9KPFOKNNU

    )TGGP4QQHU

    5JCFKPI(CECFG

    )TGGP4COR

    SustainableSeatonLEED Gold

    Campus Map

  • TWAHotelKansas City, KS | 2011Individual Design Project

  • A Place of Comfort

    6JGJQVGNKUOGCPVVQDGCRNCEGVJCVEQODKPGUVJGTGNCZCVKQPQHTGUVYKVJVJGGZEKVGOGPVQHVTCXGNCPFVJGGNGICPEGQHJQURKVCNKV[

    6JGJQVGNTQQOUWUGNKIJVKPIRCPGNUVQRNC[YKVJOCP[FKHHGTGPVECUECFGUQHNKIJV'ZRQUGFOGVCNNKEUVTWEVWTGRNC[UYKVJTGHNGEVCPEGQHVJKUNKIJV

    TWA HotelKansas City, KS | 2011

    A Place of Modernity

    6JG69#JQVGNFGUKIPTGCEJGUUM[YCTFYKVJUNGGMINCUURCPGNUQHVTCPURCTGPVRCPGUVTCPUNWEGPVRCPGUCPFTGFVKPVGFRCPGU6JGTGFRCPGNUKPFKECVGCHNQQTNGXGNCPFVJGVTCPURCTGPVCPFVTCPUNWEGPVRCPGNUEQTTGURQPFYKVJCTGCUKPUKFGVJGDWKNFKPIVJCVTGSWKTGXCT[KPICOQWPVUQHNKIJVCPFFCTM

    Construction

    6JGJQVGNVKNVUVQVJGTKIJVCVJKTFQHVJGYC[WRVJGDWKNFKPIUGZRCPUGVQCNNQYOCZKOWONKIJVYKVJKPVJGJQVGNTQQOUKPETGCUGVJGURCEGCXCKNCDNGCPFETGCVGCPKPVGTGUVKPICPFWPKSWGCRRGCTCPEG

    69#KUCNNCDQWVHNKIJVOKFCKT6JGDWKNFKPIKUOGCPVVQTGRTGUGPVVJGEQORCP[CPFETGCVGWPKSWGIGUVWTGUKPVJGUM[

    6JGUVTWEVWTGKUUWRRQTVGFD[VJGXGTVKECNVTCPURQTVCVKQPEQTTKFQT

    Bar

    Lobby

    Managers Suite

    Kitchen

    Back ofHouse

    Indoor Garden

    Outdoor Garden

    Luxury Spa

  • Light well, maximizing interior luminance

    Metal Structure

    Window panes-translucent-transparent-red translucent

    Entryway and loungearea

    Design Features

  • .QDD[4GPFGTKPI

    *QVGN4QQO4GPFGTKPI

    5KVG2NCP

    SpatialAnalysis

  • (KTUV(NQQT2NCP4GXKV#WVQ%#& +NNWUVTCVQT

    #EJKGXKPI/CZKOWO.KIJVKPI

    5WRRQTVKPIVJG5JKHV

    ((((K(K(K(K(((KKKKKKKKKKKKK(KKTTTTTTUTUTUTUTUTTTUUUTUTUTTUUTUTUUTUUTUTTUTUTUTUUUUTUTTTUTUTTUTUTTUTUUTUUTUUUTUTUUUVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV ((((((((((((((N(N(N(((((((((((N(N(N((((((((((((((((((N(N((((((((N((N(( QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT 2222N2N2N22N2N222222N2222N22N2N22N22N2N222222N2222222222222222222222222N22222NNN2222NNN22NCPCPCPCPCPCPCCPCPCCPCPCPCPCPCCPCPCPCPCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC 4444444444444444444444444444444444444444444444444444GGGGGGGGGGGGXXXXXXXGGXGGGGGXGGXGXXXXXXXXXXXGGXGXXXXXXXGXGXGXGXXXXXXXGXGGGXGGGGXGGGG KVKVKVVKKKVKKKVVVVVKVKKVVVVVVVVKVKVVVVVVKVKVVKVKVKV ########################WVWWWWVWVWVWVQQQQQQQQQ %#%#%#%####%#%###%######%#%#%%%%%#%#%#%%#%#%%#%%%#%##%%#%#########&&&&&&&&&&&&&&&&&& ++++NNN+N++N+NN+N+N+ NNNNNNWNWNNNNWNWWWWWNWWWNWNWWWWW VUVUVUVUVUUUVVUUUUUUUUVUUUUUUUUUUVVVUVUVUVUVUUUUUUVVVUUUUVUVUVUVVVVVVUUUVUVUVUVVVUVVUVVUVUUUUVVVVVVUVUUVUVUVUUUUUUUVVVVVVTTCTTCTCTCTCTCTCCCTCTCTCCCCCTCCTTCCCTCTCTTCCCCCCCTCCTTCTTTTTCCCCCTCTCTTTTCCCTCCTCTTTTCCCCCTCTCTTCCCCCCTCTCCCTCCCCVQVQVQVQVQVQVQVQVQVQQVQVQQTTTTTTTTTTTTTTTT

  • Downtown Economic Assistance CenterSan Francisco, CA | 2011Individual Design Project

  • Downtown Economic Assistance CenterSan Francisco, CA | 2011

    .QDD[QHGFWECVKQPCNHCEKNKV[8KGY#6TCPUXGTUG5GEVKQPQHEQWPUGNKPIHCEKNKV[

    What is the D.E.A.C.?

    6JG&QYPVQYP'EQPQOKE#UUKUVCPEG%GPVGT&'#%KUOGCPVVQKPURKTGJQRGCPFRTQXKFGTGUQWTEGUVQKPFKXKFWCNUCPFHCOKNKGUYJQJCXGUWHHGTGFHTQOLQDNQUUCPFHKPCPEKCNKPUVCDKNKV[#PGFWECVKQPCNHCEKNKV[HQTENKGPVUKUCNUQRTQXKFGFVQIKKXGIWGUVUVJGUMKNNUPGEGUUCT[VQIGVDCEMQPVJGKTHGGV

    What Features Are There?

    #6TGNNKUQHNKXKPIRNCPVITQYVJRTQXKFGUUJCFGCPFCUGPUGQHUGEWTKV[VQVJQUGUWHHGTKPIHTQOLQDNQUU6JGITGGPGT[KPHWUGUCUGPUGQHNKHGCPFTGRTGUGPVUITQYVJCPFPGYQRRQTVWPKVKGU

    How Does the Trellis Work?

    6JGQWVFQQTUMKPOCFGWRQHCVTGNNKUU[UVGOITQYUHQNKCIGCPFXGIGVCDNGUVQETGCVGHQQFCPFLQDUHQTOGODGTUQHVJGHCEKNKV[6JGVTGNNKUCNUQUJCFGUVJGINC\GFGZVGTKQTYCNNCPFRTQXKFGUUGRCTCVKQPHTQOVJGGFWECVKQPCNRQTVKQPQHVJGDWKNFKPI

  • 5MGVEJ+FGCU 4GHKPG%QPEGRVU 6GUV+FGCU6JTQWIJ/QFGNKPI

    Living Wall

    The use of a sheltering trellis decorated in vegetation and life provides both beauty and functionality to the D.E.A.C. The edible elements can be grown, harvested, and sold to provide jobs and revenue for struggling members. The green wall also provides a symbolic element of life, hope, rebirth, and

    Process of Design5MGVEJKPI/QFGN$WKNFKPI&5/CZ4GXKV2JQVQUJQR+NNWUVTCVQT+P&GUKIP5MGVEJ72

  • %QORWVGT)GPGTCVG%QPEGRV (KPCNK\G&GVCKNU &GXGNQR(KPCN/QFGN

    .KIJVKPI5